A0A087WV63_HUMAN Loading...

Cytoplasmic FMR1 interacting protein 2

AlphaFold DB , UniProt , Accession A0A087WV63, Species HUMAN (Homo sapiens, Human), Gene CYFIP2, Length 71 aa.

						>A0A087WV63_HUMAN|A0A087WV63|CYFIP2
MTTHVTLEDALSNVDLLEELPLPDQQPCIEPPPSSIMYQANFDTNFEDRNAFVTGIARYIEQATVHSSMIF
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	39.7	Very low	77.7	Confident	232 Å²	232	117.4 Å²	117.4	100%	1.143	64%	0.638	S	S	*	*				0	109.8	0	-70.4	-158.4	146.4	0	0	107.2	T3	M1-T3 PolarHBondContact O-N 3.19Å
2	T	49.9	Very low	78.9	Confident	148 Å²	148	112.5 Å²	112.5	91%	0.908	62%	0.619	S	S	*	*			trans	-80.5	95.8	175.8	48.5	0	0	0	0	107.3	H4	T2-H4 PolarHBondContact O-N 3.5Å
3	T	66.4	Low	79.8	Confident	116 Å²	116	111.6 Å²	111.6	71%	0.712	61%	0.613	S	S	*	*			trans	-62.1	120.6	173.6	44.8	0	0	0	0	108.1	M1 V5	M1-T3 PolarHBondContact O-N 3.19Å; T3-V5 PolarHBondContact O-N 3.14Å
4	H	75.6	Confident	80.5	Confident	175 Å²	175	109.5 Å²	109.5	81%	0.81	61%	0.605	S	S	*	*			trans	-67.5	103.3	177.6	-167.2	-77.2	0	0	0	108	T2	T2-H4 PolarHBondContact O-N 3.5Å
5	V	80.7	Confident	81.3	Confident	94 Å²	94	108.4 Å²	108.4	57%	0.57	60%	0.598	S	S	*	*			trans	-73.7	126.1	177.9	-180	0	0	0	0	108	T3 D9	T3-V5 PolarHBondContact O-N 3.14Å; V5-D9 HydrophobicContact CG1-CB 4.11Å
6	T	89.1	Confident	81.8	Confident	57 Å²	57	108.7 Å²	108.7	35%	0.35	60%	0.597	S	S	.	*			trans	-82.3	160.3	176.7	66.9	0	0	0	0	110.6	E8 D9 A10	T6-E8 VanDerWaalsContact C-N 3.25Å; T6-E8 PolarHBondContact O-N 2.99Å; T6-D9 PolarHBondContact N-OD2 3.24Å; T6-D9 PolarHBondContact O-N 3.39Å; T6-D9 PolarHBondContact OG1-N 3.39Å; T6-D9 PolarHBondContact OG1-OD2 3.18Å; T6-A10 PolarHBondContact O-N 3.48Å
7	L	89.5	Confident	82.2	Confident	120 Å²	120	109.7 Å²	109.7	63%	0.628	60%	0.601	S	S	*	*	H	α-helix	trans	-63.4	-38.3	177.4	179	63.3	0	0	0	110.6	D9 A10 L11	L7-D9 PolarHBondContact O-N 3.02Å; L7-A10 WeakPolarHBondContact O-CB 3.37Å; L7-A10 PolarHBondContact O-N 3.2Å; L7-L11 HydrophobicContact CG-CD1 4.11Å; L7-L11 WeakPolarHBondContact O-CG 3.37Å; L7-L11 PolarHBondContact O-N 2.98Å
8	E	91.9	Very high	82.4	Confident	131 Å²	131	112.6 Å²	112.6	61%	0.612	61%	0.61	S	S	*	*	H	α-helix	trans	-61.3	-40.8	176.2	-72.9	68.5	-156.2	0	0	112	T6 A10 L11 S12	T6-E8 VanDerWaalsContact C-N 3.25Å; T6-E8 PolarHBondContact O-N 2.99Å; E8-A10 VanDerWaalsContact C-N 3.32Å; E8-A10 PolarHBondContact O-N 3.49Å; E8-L11 PolarHBondContact O-N 3.39Å; E8-S12 VanDerWaalsContact O-CB 3.3Å; E8-S12 WeakPolarHBondContact O-CB 3.41Å; E8-S12 PolarHBondContact O-N 3.05Å
9	D	90.6	Very high	82.5	Confident	81 Å²	81	115.4 Å²	115.4	43%	0.433	62%	0.618	S	S	.	*	H	α-helix	trans	-64.1	-39.4	174.7	-68	-39.4	0	0	0	111.6	V5 T6 L7 N13	V5-D9 HydrophobicContact CG1-CB 4.11Å; T6-D9 PolarHBondContact N-OD2 3.24Å; T6-D9 PolarHBondContact O-N 3.39Å; T6-D9 PolarHBondContact OG1-N 3.39Å; T6-D9 PolarHBondContact OG1-OD2 3.18Å; L7-D9 PolarHBondContact O-N 3.02Å; D9-N13 VanDerWaalsContact O-CG 3.24Å; D9-N13 PolarHBondContact O-N 3.03Å; D9-N13 VanDerWaalsContact O-N 3.13Å; D9-N13 PolarHBondContact O-ND2 3.48Å
10	A	88.8	Confident	82.6	Confident	44 Å²	44	115.2 Å²	115.2	36%	0.364	62%	0.616	S	S	.	*	H	α-helix	trans	-67	-39.1	178.8	0	0	0	0	0	112	T6 L7 E8 V14	T6-A10 PolarHBondContact O-N 3.48Å; L7-A10 WeakPolarHBondContact O-CB 3.37Å; L7-A10 PolarHBondContact O-N 3.2Å; E8-A10 VanDerWaalsContact C-N 3.32Å; E8-A10 PolarHBondContact O-N 3.49Å; A10-V14 PolarHBondContact O-N 3.45Å
11	L	92.7	Very high	82.5	Confident	93 Å²	93	115 Å²	115	49%	0.487	62%	0.621	S	S	.	*	H	α-helix	trans	-69.4	-44.6	176.6	-68.8	169.2	0	0	0	111.6	L7 E8 N13 V14 D15	L7-L11 HydrophobicContact CG-CD1 4.11Å; L7-L11 WeakPolarHBondContact O-CG 3.37Å; L7-L11 PolarHBondContact O-N 2.98Å; E8-L11 PolarHBondContact O-N 3.39Å; L11-N13 PolarHBondContact O-N 3.33Å; L11-V14 WeakPolarHBondContact O-CA 3.48Å; L11-V14 WeakPolarHBondContact O-CB 3.48Å; L11-V14 PolarHBondContact O-N 3.06Å; L11-D15 PolarHBondContact O-N 3.26Å
12	S	92.5	Very high	84.4	Confident	59 Å²	59	110.3 Å²	110.3	41%	0.413	60%	0.6	S	S	.	*	H	α-helix	trans	-56.9	-38.3	176.3	-179.9	0	0	0	0	112.5	E8 V14 D15 L16	E8-S12 VanDerWaalsContact O-CB 3.3Å; E8-S12 WeakPolarHBondContact O-CB 3.41Å; E8-S12 PolarHBondContact O-N 3.05Å; S12-V14 VanDerWaalsContact C-N 3.29Å; S12-V14 PolarHBondContact O-N 3.41Å; S12-D15 PolarHBondContact O-N 3.13Å; S12-L16 PolarHBondContact O-N 3.31Å
13	N	89.9	Confident	85.7	Confident	101 Å²	101	108.8 Å²	108.8	54%	0.54	59%	0.593	S	S	.	*	H	α-helix	trans	-64.6	-32.7	174.9	-72.6	-21.8	0	0	0	113.1	D9 L11 L17	D9-N13 VanDerWaalsContact O-CG 3.24Å; D9-N13 PolarHBondContact O-N 3.03Å; D9-N13 VanDerWaalsContact O-N 3.13Å; D9-N13 PolarHBondContact O-ND2 3.48Å; L11-N13 PolarHBondContact O-N 3.33Å; N13-L17 WeakPolarHBondContact O-CG 3.41Å
14	V	90.1	Very high	85.7	Confident	82 Å²	82	110.4 Å²	110.4	50%	0.497	60%	0.597	S	S	.	*	H	α-helix	trans	-73.7	-43.1	177.5	175.6	0	0	0	0	110	A10 L11 S12 L16 L17	A10-V14 PolarHBondContact O-N 3.45Å; L11-V14 WeakPolarHBondContact O-CA 3.48Å; L11-V14 WeakPolarHBondContact O-CB 3.48Å; L11-V14 PolarHBondContact O-N 3.06Å; S12-V14 VanDerWaalsContact C-N 3.29Å; S12-V14 PolarHBondContact O-N 3.41Å; V14-L16 VanDerWaalsContact C-N 3.25Å; V14-L16 PolarHBondContact O-N 2.93Å; V14-L17 WeakPolarHBondContact O-CB 3.45Å; V14-L17 PolarHBondContact O-N 3.21Å
15	D	91.4	Very high	85.5	Confident	93 Å²	93	110.4 Å²	110.4	50%	0.497	60%	0.597	S	S	.	*	H	α-helix	trans	-59.7	-38.1	177.2	-61.9	-24.8	0	0	0	111.3	L11 S12 L17 E18	L11-D15 PolarHBondContact O-N 3.26Å; S12-D15 PolarHBondContact O-N 3.13Å; D15-L17 PolarHBondContact O-N 2.92Å; D15-E18 PolarHBondContact O-N 2.92Å; D15-E18 VanDerWaalsContact O-N 3.14Å
16	L	90.8	Very high	84.9	Confident	113 Å²	113	114.1 Å²	114.1	59%	0.592	61%	0.609	S	S	*	*	H	α-helix	trans	-61.1	-28.8	175.6	-118.9	91.9	0	0	0	114	S12 V14 E18	S12-L16 PolarHBondContact O-N 3.31Å; V14-L16 VanDerWaalsContact C-N 3.25Å; V14-L16 PolarHBondContact O-N 2.93Å; L16-E18 VanDerWaalsContact C-N 3.33Å
17	L	87.8	Confident	84	Confident	126 Å²	126	116.6 Å²	116.6	66%	0.66	63%	0.626	S	S	*	*	H	α-helix	trans	-75.6	-25.5	179.6	-63.7	172.4	0	0	0	111.8	N13 V14 D15	N13-L17 WeakPolarHBondContact O-CG 3.41Å; V14-L17 WeakPolarHBondContact O-CB 3.45Å; V14-L17 PolarHBondContact O-N 3.21Å; D15-L17 PolarHBondContact O-N 2.92Å
18	E	85.6	Confident	82.8	Confident	162 Å²	162	116.8 Å²	116.8	76%	0.757	64%	0.636	S	S	*	*	H	α-helix	trans	-72.5	-31	175.9	-64	-166.4	166.5	0	0	112.2	D15 L16 L20	D15-E18 PolarHBondContact O-N 2.92Å; D15-E18 VanDerWaalsContact O-N 3.14Å; L16-E18 VanDerWaalsContact C-N 3.33Å; E18-L20 VanDerWaalsContact C-N 3.29Å; E18-L20 PolarHBondContact O-N 3.32Å
19	E	84.8	Confident	82	Confident	166 Å²	166	118.3 Å²	118.3	78%	0.776	65%	0.646	S	S	*	*	S	Bend	trans	-81.5	-7.5	178.6	-62.8	-172.9	178	0	0	113.4	P21	E19-P21 WeakPolarHBondContact O-CD 3.3Å
20	L	83.9	Confident	81.1	Confident	111 Å²	111	122.5 Å²	122.5	58%	0.581	66%	0.663	S	S	*	*	S	Bend	trans	-74.9	119.3	-175.7	-163.8	80.5	0	0	0	110.4	E18 L22	E18-L20 VanDerWaalsContact C-N 3.29Å; E18-L20 PolarHBondContact O-N 3.32Å; L20-L22 PolarHBondContact O-N 3.37Å
21	P	79.9	Confident	80.3	Confident	111 Å²	111	125.2 Å²	125.2	72%	0.721	68%	0.677	S	S	*	*	P	Polyproline II helix	trans	-63.9	123.1	175.7	26.4	-33	0	0	0	109.5	E19	E19-P21 WeakPolarHBondContact O-CD 3.3Å
22	L	79.5	Confident	79.5	Confident	134 Å²	134	126 Å²	126	70%	0.702	69%	0.688	S	S	*	*	P	Polyproline II helix	trans	-71.9	137.9	174	-63.6	177.9	0	0	0	109.1	L20 D24	L20-L22 PolarHBondContact O-N 3.37Å; L22-D24 VanDerWaalsContact C-N 3.29Å; L22-D24 PolarHBondContact O-N 3.27Å
23	P	77.3	Confident	78.7	Confident	116 Å²	116	129.8 Å²	129.8	75%	0.753	71%	0.711	S	S	*	*			trans	-71	92.3	167.9	28.1	-30.7	0	0	0	108.1	Q25	P23-Q25 PolarHBondContact O-N 3.29Å
24	D	67.5	Low	78.1	Confident	149 Å²	149	129.8 Å²	129.8	80%	0.797	72%	0.719	S	S	*	*			trans	-59.7	-17.9	179.4	-57.6	-24.1	0	0	0	112.8	L22 Q26	L22-D24 VanDerWaalsContact C-N 3.29Å; L22-D24 PolarHBondContact O-N 3.27Å; D24-Q26 PolarHBondContact O-N 2.93Å
25	Q	70.4	Confident	77.6	Confident	175 Å²	175	130.5 Å²	130.5	82%	0.818	73%	0.727	S	S	*	*			trans	-94.8	90.4	-178.6	-63	-175.8	-6.9	0	0	109.7	P23	P23-Q25 PolarHBondContact O-N 3.29Å
26	Q	69.8	Low	77.1	Confident	173 Å²	173	133.6 Å²	133.6	81%	0.808	74%	0.742	S	S	*	*			trans	-57.3	131.7	155.2	-71.7	-172.5	-32.7	0	0	107.9	D24 C28	D24-Q26 PolarHBondContact O-N 2.93Å; Q26-C28 PolarHBondContact O-N 2.95Å
27	P	69.1	Low	76.6	Confident	108 Å²	108	136.2 Å²	136.2	70%	0.701	75%	0.754	S	S	*	*			trans	-58.7	114.6	171.3	22.2	-29.6	0	0	0	108	I29	P27-I29 VanDerWaalsContact O-CG1 3.31Å; P27-I29 WeakPolarHBondContact O-CG1 3.29Å; P27-I29 PolarHBondContact O-N 2.74Å
28	C	65.1	Low	76.2	Confident	125 Å²	125	139.8 Å²	139.8	85%	0.845	76%	0.76	S	S	*	*			trans	-61.5	106.3	169.6	-86.3	0	0	0	0	107.8	Q26	Q26-C28 PolarHBondContact O-N 2.95Å
29	I	74.7	Confident	76	Confident	162 Å²	162	140.6 Å²	140.6	83%	0.831	76%	0.763	S	S	*	*			trans	-82	-5.3	176.1	-24	175.7	0	0	0	110.7	P27 P31	P27-I29 VanDerWaalsContact O-CG1 3.31Å; P27-I29 WeakPolarHBondContact O-CG1 3.29Å; P27-I29 PolarHBondContact O-N 2.74Å; I29-P31 VanDerWaalsContact O-CD 3.29Å; I29-P31 WeakPolarHBondContact O-CD 3.31Å
30	E	72.6	Confident	75.5	Confident	170 Å²	170	134.5 Å²	134.5	79%	0.794	74%	0.741	S	S	*	*	P	Polyproline II helix	trans	-79.3	116.1	-178.5	-164.9	169	-168.3	0	0	109.9
31	P	70.9	Confident	75.2	Confident	101 Å²	101	134.7 Å²	134.7	66%	0.656	74%	0.743	S	S	*	*	P	Polyproline II helix	trans	-63.7	144.7	173	27	-32.3	0	0	0	109.3	I29	I29-P31 VanDerWaalsContact O-CD 3.29Å; I29-P31 WeakPolarHBondContact O-CD 3.31Å
32	P	75.8	Confident	75.2	Confident	108 Å²	108	138.2 Å²	138.2	70%	0.701	75%	0.747	S	S	*	*	P	Polyproline II helix	trans	-57.8	145.7	174.6	24.7	-33.1	0	0	0	110.1	S34	P32-S34 PolarHBondContact O-N 3.21Å
33	P	75	Confident	75.1	Confident	140 Å²	140	135.3 Å²	135.3	91%	0.909	73%	0.733	S	S	*	*			trans	-59.7	109.7	176.5	24.1	-32.4	0	0	0	109
34	S	77.6	Confident	74.9	Confident	101 Å²	101	136.4 Å²	136.4	71%	0.706	74%	0.737	S	S	*	*			trans	-108.9	129.4	178.1	-171.2	0	0	0	0	109.3	P32 I36	P32-S34 PolarHBondContact O-N 3.21Å; S34-I36 PolarHBondContact O-N 3.27Å
35	S	80.5	Confident	75.6	Confident	96 Å²	96	134.1 Å²	134.1	67%	0.671	73%	0.725	S	S	*	*			trans	-68.9	116.7	174.2	178.7	0	0	0	0	109.2	M37	S35-M37 PolarHBondContact O-N 3.04Å
36	I	80.2	Confident	75.9	Confident	158 Å²	158	131.9 Å²	131.9	81%	0.81	71%	0.713	S	S	*	*			trans	-78.6	104	173.1	-58.2	175.7	0	0	0	107.9	S34 Y38	S34-I36 PolarHBondContact O-N 3.27Å; I36-Y38 PolarHBondContact O-N 3.22Å
37	M	81.7	Confident	76.3	Confident	168 Å²	168	129.5 Å²	129.5	83%	0.828	70%	0.702	S	S	*	*			trans	-78.8	102.7	170	-64.1	-64.8	-72.8	0	0	108.4	S35	S35-M37 PolarHBondContact O-N 3.04Å
38	Y	78.6	Confident	76.8	Confident	201 Å²	201	130 Å²	130	79%	0.788	70%	0.698	S	S	*	*			trans	-87.7	116.5	172.5	178.6	-102.1	0	0	0	110	I36 A40	I36-Y38 PolarHBondContact O-N 3.22Å; Y38-A40 HydrophobicContact CE1-CB 3.95Å
39	Q	80.8	Confident	77.7	Confident	179 Å²	179	132 Å²	132	84%	0.836	69%	0.689	S	S	*	*			trans	-113.6	115.3	168.3	-177.2	172.9	-10.1	0	0	108.5	N41	Q39-N41 PolarHBondContact O-N 3.26Å
40	A	75.6	Confident	78.2	Confident	38 Å²	38	130.5 Å²	130.5	31%	0.314	68%	0.682	S	S	.	*			trans	-66.8	119.6	172.1	0	0	0	0	0	109.2	Y38 F42	Y38-A40 HydrophobicContact CE1-CB 3.95Å; A40-F42 HydrophobicContact CB-CD2 4.47Å; A40-F42 HydrophobicContact CB-CE2 3.79Å; A40-F42 HydrophobicContact CB-CZ 3.9Å
41	N	76.4	Confident	78.7	Confident	116 Å²	116	125.3 Å²	125.3	62%	0.62	67%	0.668	S	S	*	*			trans	-92.7	118.2	168.2	-171.2	-0.3	0	0	0	108.4	Q39 D43	Q39-N41 PolarHBondContact O-N 3.26Å; N41-D43 WeakPolarHBondContact OD1-CB 3.1Å; N41-D43 PolarHBondContact OD1-N 2.88Å
42	F	79.5	Confident	79.4	Confident	184 Å²	184	126.1 Å²	126.1	81%	0.807	66%	0.662	S	S	*	*			trans	-98	4.6	175.7	-64.1	-77.6	0	0	0	112.5	A40 T44	A40-F42 HydrophobicContact CB-CD2 4.47Å; A40-F42 HydrophobicContact CB-CE2 3.79Å; A40-F42 HydrophobicContact CB-CZ 3.9Å; F42-T44 PolarHBondContact O-N 3.32Å
43	D	78.8	Confident	80.1	Confident	74 Å²	74	124.8 Å²	124.8	40%	0.396	65%	0.652	S	S	.	*			trans	-65.6	123.4	173.5	-163.6	-8.5	0	0	0	109.8	N41 N45	N41-D43 WeakPolarHBondContact OD1-CB 3.1Å; N41-D43 PolarHBondContact OD1-N 2.88Å; D43-N45 VanDerWaalsContact C-N 3.32Å; D43-N45 VanDerWaalsContact CG-ND2 3.26Å; D43-N45 WeakPolarHBondContact OD1-CB 3.2Å; D43-N45 PolarHBondContact OD1-N 2.93Å; D43-N45 PolarHBondContact OD1-ND2 2.84Å; D43-N45 PolarHBondContact OD2-ND2 2.85Å
44	T	72.9	Confident	80.8	Confident	138 Å²	138	122.1 Å²	122.1	85%	0.847	63%	0.633	S	S	*	*			trans	-90.7	0.9	175.7	58.4	0	0	0	0	112.2	F42	F42-T44 PolarHBondContact O-N 3.32Å
45	N	81.2	Confident	81.4	Confident	102 Å²	102	119 Å²	119	55%	0.545	62%	0.616	S	S	.	*	S	Bend	trans	-59.5	147.1	172	-68.9	-37	0	0	0	110.1	D43 E47	D43-N45 VanDerWaalsContact C-N 3.32Å; D43-N45 VanDerWaalsContact CG-ND2 3.26Å; D43-N45 WeakPolarHBondContact OD1-CB 3.2Å; D43-N45 PolarHBondContact OD1-N 2.93Å; D43-N45 PolarHBondContact OD1-ND2 2.84Å; D43-N45 PolarHBondContact OD2-ND2 2.85Å; N45-E47 HydrophobicContact CB-CG 4.28Å; N45-E47 VanDerWaalsContact CB-OE1 3.26Å; N45-E47 WeakPolarHBondContact CB-OE1 3.26Å; N45-E47 PolarHBondContact O-N 3.3Å
46	F	77	Confident	82	Confident	127 Å²	127	118.4 Å²	118.4	56%	0.557	61%	0.605	S	S	*	*			trans	-79.9	65.8	178	-167.3	-125.7	0	0	0	110.9	D48 R49 F52	F46-D48 PolarHBondContact O-N 3.25Å; F46-R49 HydrophobicContact CD1-CB 3.63Å; F46-R49 HydrophobicContact CD1-CG 4.09Å; F46-R49 VanDerWaalsContact CE1-CA 3.46Å; F46-R49 HydrophobicContact CE1-CB 3.9Å; F46-R49 HydrophobicContact CE1-CG 4.15Å; F46-R49 PolarHBondContact O-N 2.87Å; F46-F52 HydrophobicContact CE1-CB 3.88Å; F46-F52 AromaticContact CE1-CD1 3.99Å; F46-F52 HydrophobicContact CE1-CD1 3.99Å; F46-F52 AromaticContact CE1-CG 3.98Å; F46-F52 HydrophobicContact CE1-CG 3.98Å; F46-F52 HydrophobicContact CE2-CB 4.47Å; F46-F52 HydrophobicContact CZ-CB 3.42Å; F46-F52 VanDerWaalsContact CZ-CB 3.42Å; F46-F52 AromaticContact CZ-CD1 3.93Å; F46-F52 HydrophobicContact CZ-CD1 3.93Å; F46-F52 AromaticContact CZ-CD2 3.91Å; F46-F52 HydrophobicContact CZ-CD2 3.91Å; F46-F52 AromaticContact CZ-CG 3.49Å; F46-F52 HydrophobicContact CZ-CG 3.49Å; F46-F52 VanDerWaalsContact CZ-CG 3.49Å
47	E	77.9	Confident	82.5	Confident	124 Å²	124	113.4 Å²	113.4	58%	0.579	59%	0.587	S	S	*	*	T	Hydrogen-bonded Turn	trans	-59.9	-34	-176.4	-66.6	-60.5	120.3	0	0	112	N45 R49	N45-E47 HydrophobicContact CB-CG 4.28Å; N45-E47 VanDerWaalsContact CB-OE1 3.26Å; N45-E47 WeakPolarHBondContact CB-OE1 3.26Å; N45-E47 PolarHBondContact O-N 3.3Å; E47-R49 PolarHBondContact O-N 3.19Å
48	D	80.6	Confident	83	Confident	117 Å²	117	112.6 Å²	112.6	63%	0.626	58%	0.575	S	S	*	*	T	Hydrogen-bonded Turn	trans	-85.6	22.2	-178.8	-71	-39	0	0	0	114.1	F46 N50 A51 F52	F46-D48 PolarHBondContact O-N 3.25Å; D48-N50 PolarHBondContact O-N 2.95Å; D48-N50 VanDerWaalsContact O-N 3.12Å; D48-A51 HydrophobicContact CB-CB 4.27Å; D48-A51 PolarHBondContact O-N 3.41Å; D48-F52 PolarHBondContact O-N 3.12Å
49	R	83.9	Confident	83.6	Confident	169 Å²	169	111 Å²	111	64%	0.638	57%	0.568	S	S	*	*	H	α-helix	trans	-50.1	-42.4	179.5	-178.7	179.4	176.6	162.3	0.4	113	F46 E47 F52 V53	F46-R49 HydrophobicContact CD1-CB 3.63Å; F46-R49 HydrophobicContact CD1-CG 4.09Å; F46-R49 VanDerWaalsContact CE1-CA 3.46Å; F46-R49 HydrophobicContact CE1-CB 3.9Å; F46-R49 HydrophobicContact CE1-CG 4.15Å; F46-R49 PolarHBondContact O-N 2.87Å; E47-R49 PolarHBondContact O-N 3.19Å; R49-F52 PolarHBondContact O-N 2.88Å; R49-V53 HydrophobicContact CG-CG2 4.5Å; R49-V53 VanDerWaalsContact O-CG2 3.3Å; R49-V53 WeakPolarHBondContact O-CG2 3.3Å; R49-V53 PolarHBondContact O-N 3.01Å
50	N	83.8	Confident	84.1	Confident	130 Å²	130	107.3 Å²	107.3	70%	0.695	55%	0.554	S	S	*	*	H	α-helix	trans	-66.1	-45	179.8	-69.1	-26.3	0	0	0	111.2	D48 F52 V53 T54	D48-N50 PolarHBondContact O-N 2.95Å; D48-N50 VanDerWaalsContact O-N 3.12Å; N50-F52 VanDerWaalsContact C-N 3.31Å; N50-F52 PolarHBondContact O-N 3.21Å; N50-V53 PolarHBondContact O-N 2.84Å; N50-T54 WeakPolarHBondContact O-CB 3.47Å; N50-T54 PolarHBondContact O-N 2.91Å; N50-T54 PolarHBondContact O-OG1 3.49Å
51	A	83.5	Confident	84.9	Confident	61 Å²	61	111.7 Å²	111.7	50%	0.504	57%	0.567	S	S	.	*	H	α-helix	trans	-62.6	-38.9	176.5	0	0	0	0	0	111.8	D48 T54 G55	D48-A51 HydrophobicContact CB-CB 4.27Å; D48-A51 PolarHBondContact O-N 3.41Å; A51-T54 PolarHBondContact O-N 3.45Å; A51-G55 PolarHBondContact O-N 2.97Å
52	F	85.4	Confident	85.5	Confident	117 Å²	117	111.7 Å²	111.7	51%	0.513	56%	0.564	S	S	.	*	H	α-helix	trans	-62.1	-48.7	173.8	176.6	-99.7	0	0	0	112.3	F46 D48 R49 N50 T54 G55 I56	F46-F52 HydrophobicContact CE1-CB 3.88Å; F46-F52 AromaticContact CE1-CD1 3.99Å; F46-F52 HydrophobicContact CE1-CD1 3.99Å; F46-F52 AromaticContact CE1-CG 3.98Å; F46-F52 HydrophobicContact CE1-CG 3.98Å; F46-F52 HydrophobicContact CE2-CB 4.47Å; F46-F52 HydrophobicContact CZ-CB 3.42Å; F46-F52 VanDerWaalsContact CZ-CB 3.42Å; F46-F52 AromaticContact CZ-CD1 3.93Å; F46-F52 HydrophobicContact CZ-CD1 3.93Å; F46-F52 AromaticContact CZ-CD2 3.91Å; F46-F52 HydrophobicContact CZ-CD2 3.91Å; F46-F52 AromaticContact CZ-CG 3.49Å; F46-F52 HydrophobicContact CZ-CG 3.49Å; F46-F52 VanDerWaalsContact CZ-CG 3.49Å; D48-F52 PolarHBondContact O-N 3.12Å; R49-F52 PolarHBondContact O-N 2.88Å; N50-F52 VanDerWaalsContact C-N 3.31Å; N50-F52 PolarHBondContact O-N 3.21Å; F52-T54 VanDerWaalsContact C-N 3.34Å; F52-T54 PolarHBondContact O-N 3.43Å; F52-G55 PolarHBondContact O-N 3.42Å; F52-I56 HydrophobicContact CD1-CG1 4.47Å; F52-I56 HydrophobicContact CE1-CG1 4.13Å; F52-I56 HydrophobicContact CE2-CD1 4.39Å; F52-I56 HydrophobicContact CE2-CG1 4.22Å; F52-I56 HydrophobicContact CZ-CD1 4.29Å; F52-I56 HydrophobicContact CZ-CG1 3.99Å; F52-I56 WeakPolarHBondContact O-CG1 3.33Å; F52-I56 PolarHBondContact O-N 3.06Å
53	V	90.8	Very high	85.9	Confident	81 Å²	81	105.4 Å²	105.4	49%	0.491	55%	0.546	S	S	.	.	H	α-helix	trans	-60.9	-44.2	177.5	170.7	0	0	0	0	110.9	R49 N50 G55 I56 A57	R49-V53 HydrophobicContact CG-CG2 4.5Å; R49-V53 VanDerWaalsContact O-CG2 3.3Å; R49-V53 WeakPolarHBondContact O-CG2 3.3Å; R49-V53 PolarHBondContact O-N 3.01Å; N50-V53 PolarHBondContact O-N 2.84Å; V53-G55 VanDerWaalsContact C-N 3.35Å; V53-G55 PolarHBondContact O-N 3.33Å; V53-I56 PolarHBondContact O-N 3.43Å; V53-A57 WeakPolarHBondContact O-CB 3.46Å; V53-A57 PolarHBondContact O-N 3.47Å
54	T	90.6	Very high	86.5	Confident	84 Å²	84	105.7 Å²	105.7	52%	0.515	55%	0.55	S	S	.	*	H	α-helix	trans	-62.7	-40.9	175.8	-60.1	0	0	0	0	112	N50 A51 F52 A57 R58	N50-T54 WeakPolarHBondContact O-CB 3.47Å; N50-T54 PolarHBondContact O-N 2.91Å; N50-T54 PolarHBondContact O-OG1 3.49Å; A51-T54 PolarHBondContact O-N 3.45Å; F52-T54 VanDerWaalsContact C-N 3.34Å; F52-T54 PolarHBondContact O-N 3.43Å; T54-A57 PolarHBondContact O-N 3.29Å; T54-R58 WeakPolarHBondContact O-CB 3.41Å; T54-R58 PolarHBondContact O-N 3.04Å
55	G	89.4	Confident	87.3	Confident	35 Å²	35	102.3 Å²	102.3	36%	0.361	53%	0.529	S	S	.	.	H	α-helix	trans	-62.2	-45.4	177.2	0	0	0	0	0	112.4	A51 F52 V53 R58 Y59	A51-G55 PolarHBondContact O-N 2.97Å; F52-G55 PolarHBondContact O-N 3.42Å; V53-G55 VanDerWaalsContact C-N 3.35Å; V53-G55 PolarHBondContact O-N 3.33Å; G55-R58 PolarHBondContact O-N 3Å; G55-Y59 PolarHBondContact O-N 2.95Å
56	I	93	Very high	87.6	Confident	83 Å²	83	104 Å²	104	43%	0.426	53%	0.534	S	S	.	.	H	α-helix	trans	-64.2	-45.3	176.4	-66.6	-65.5	0	0	0	111.1	F52 V53 R58 Y59 I60	F52-I56 HydrophobicContact CD1-CG1 4.47Å; F52-I56 HydrophobicContact CE1-CG1 4.13Å; F52-I56 HydrophobicContact CE2-CD1 4.39Å; F52-I56 HydrophobicContact CE2-CG1 4.22Å; F52-I56 HydrophobicContact CZ-CD1 4.29Å; F52-I56 HydrophobicContact CZ-CG1 3.99Å; F52-I56 WeakPolarHBondContact O-CG1 3.33Å; F52-I56 PolarHBondContact O-N 3.06Å; V53-I56 PolarHBondContact O-N 3.43Å; I56-R58 VanDerWaalsContact C-N 3.34Å; I56-R58 PolarHBondContact O-N 3.44Å; I56-Y59 PolarHBondContact O-N 2.95Å; I56-I60 HydrophobicContact CG2-CD1 3.76Å; I56-I60 HydrophobicContact CG2-CG1 4.45Å; I56-I60 WeakPolarHBondContact O-CG1 3.37Å; I56-I60 PolarHBondContact O-N 2.96Å
57	A	91.9	Very high	88	Confident	53 Å²	53	102.4 Å²	102.4	44%	0.438	54%	0.538	S	S	.	.	H	α-helix	trans	-59	-45.2	177.9	0	0	0	0	0	111.8	V53 T54 Y59 I60 E61	V53-A57 WeakPolarHBondContact O-CB 3.46Å; V53-A57 PolarHBondContact O-N 3.47Å; T54-A57 PolarHBondContact O-N 3.29Å; A57-Y59 VanDerWaalsContact C-N 3.33Å; A57-Y59 PolarHBondContact O-N 3.38Å; A57-I60 PolarHBondContact O-N 2.95Å; A57-E61 WeakPolarHBondContact O-CB 3.47Å; A57-E61 PolarHBondContact O-N 3.18Å
58	R	92.1	Very high	88.2	Confident	151 Å²	151	100.3 Å²	100.3	57%	0.57	54%	0.537	S	S	*	.	H	α-helix	trans	-59.1	-44	175.4	-178.6	-172.6	-73.2	155	-4	111.8	T54 G55 I56 E61 Q62	T54-R58 WeakPolarHBondContact O-CB 3.41Å; T54-R58 PolarHBondContact O-N 3.04Å; G55-R58 PolarHBondContact O-N 3Å; I56-R58 VanDerWaalsContact C-N 3.34Å; I56-R58 PolarHBondContact O-N 3.44Å; R58-E61 PolarHBondContact O-N 3.43Å; R58-Q62 HydrophobicContact CG-CG 4.49Å; R58-Q62 WeakPolarHBondContact O-CB 3.37Å; R58-Q62 WeakPolarHBondContact O-CG 3.47Å; R58-Q62 PolarHBondContact O-N 2.98Å
59	Y	91.4	Very high	88.2	Confident	168 Å²	168	100.8 Å²	100.8	66%	0.659	54%	0.537	S	S	*	.	H	α-helix	trans	-64.6	-41.6	-179.1	-166	-90.2	0	0	0	111.9	G55 I56 A57 Q62 A63	G55-Y59 PolarHBondContact O-N 2.95Å; I56-Y59 PolarHBondContact O-N 2.95Å; A57-Y59 VanDerWaalsContact C-N 3.33Å; A57-Y59 PolarHBondContact O-N 3.38Å; Y59-Q62 PolarHBondContact O-N 2.93Å; Y59-A63 WeakPolarHBondContact O-CB 3.4Å; Y59-A63 PolarHBondContact O-N 3.41Å
60	I	90.9	Very high	87.2	Confident	102 Å²	102	100.1 Å²	100.1	52%	0.523	55%	0.545	S	S	.	.	H	α-helix	trans	-63.2	-44.8	176.1	-68.1	166.9	0	0	0	111	I56 A57 A63 T64	I56-I60 HydrophobicContact CG2-CD1 3.76Å; I56-I60 HydrophobicContact CG2-CG1 4.45Å; I56-I60 WeakPolarHBondContact O-CG1 3.37Å; I56-I60 PolarHBondContact O-N 2.96Å; A57-I60 PolarHBondContact O-N 2.95Å; I60-A63 PolarHBondContact O-N 3.15Å; I60-T64 WeakPolarHBondContact O-CB 3.47Å; I60-T64 PolarHBondContact O-N 3.36Å; I60-T64 PolarHBondContact O-OG1 3.43Å
61	E	91.3	Very high	85.9	Confident	130 Å²	130	106.4 Å²	106.4	61%	0.607	57%	0.567	S	S	*	*	H	α-helix	trans	-60.2	-48.5	177.2	-176.7	179.2	-168.1	0	0	111	A57 R58 A63 T64 V65	A57-E61 WeakPolarHBondContact O-CB 3.47Å; A57-E61 PolarHBondContact O-N 3.18Å; R58-E61 PolarHBondContact O-N 3.43Å; E61-A63 VanDerWaalsContact C-N 3.34Å; E61-A63 PolarHBondContact O-N 3.48Å; E61-T64 WeakPolarHBondContact O-CB 3.48Å; E61-T64 PolarHBondContact O-N 3.41Å; E61-T64 VanDerWaalsContact O-N 3.15Å; E61-V65 WeakPolarHBondContact O-CG2 3.36Å; E61-V65 PolarHBondContact O-N 3.28Å
62	Q	89.6	Confident	86	Confident	115 Å²	115	108.7 Å²	108.7	54%	0.537	57%	0.57	S	S	.	*	H	α-helix	trans	-60.1	-42.7	177.3	-74.6	179.8	-14.1	0	0	112.3	R58 Y59 T64 V65 H66	R58-Q62 HydrophobicContact CG-CG 4.49Å; R58-Q62 WeakPolarHBondContact O-CB 3.37Å; R58-Q62 WeakPolarHBondContact O-CG 3.47Å; R58-Q62 PolarHBondContact O-N 2.98Å; Y59-Q62 PolarHBondContact O-N 2.93Å; Q62-T64 VanDerWaalsContact C-N 3.32Å; Q62-T64 PolarHBondContact O-N 2.82Å; Q62-V65 PolarHBondContact O-N 3.44Å; Q62-H66 VanDerWaalsContact O-CB 3.31Å; Q62-H66 WeakPolarHBondContact O-CB 3.38Å; Q62-H66 PolarHBondContact O-N 2.71Å
63	A	88.7	Confident	86	Confident	52 Å²	52	108.3 Å²	108.3	43%	0.43	57%	0.573	S	S	.	*	H	α-helix	trans	-63.4	-39.3	176.2	0	0	0	0	0	111.9	Y59 I60 E61 H66 S67	Y59-A63 WeakPolarHBondContact O-CB 3.4Å; Y59-A63 PolarHBondContact O-N 3.41Å; I60-A63 PolarHBondContact O-N 3.15Å; E61-A63 VanDerWaalsContact C-N 3.34Å; E61-A63 PolarHBondContact O-N 3.48Å; A63-H66 PolarHBondContact O-N 3.45Å; A63-S67 WeakPolarHBondContact O-CB 3.31Å; A63-S67 PolarHBondContact O-N 2.89Å; A63-S67 PolarHBondContact O-OG 3.5Å
64	T	90.7	Very high	85.7	Confident	81 Å²	81	109.8 Å²	109.8	50%	0.497	58%	0.577	S	S	.	*	H	α-helix	trans	-65.9	-48.4	177.1	-55.5	0	0	0	0	110.9	I60 E61 Q62 H66 S67 S68	I60-T64 WeakPolarHBondContact O-CB 3.47Å; I60-T64 PolarHBondContact O-N 3.36Å; I60-T64 PolarHBondContact O-OG1 3.43Å; E61-T64 WeakPolarHBondContact O-CB 3.48Å; E61-T64 PolarHBondContact O-N 3.41Å; E61-T64 VanDerWaalsContact O-N 3.15Å; Q62-T64 VanDerWaalsContact C-N 3.32Å; Q62-T64 PolarHBondContact O-N 2.82Å; T64-H66 VanDerWaalsContact C-N 3.34Å; T64-H66 PolarHBondContact O-N 3.45Å; T64-S67 PolarHBondContact O-N 2.7Å; T64-S67 PolarHBondContact O-OG 3.41Å; T64-S68 PolarHBondContact O-N 3.21Å; T64-S68 PolarHBondContact O-OG 3.39Å
65	V	89.8	Confident	85.5	Confident	66 Å²	66	111.3 Å²	111.3	40%	0.4	58%	0.581	S	S	.	*	H	α-helix	trans	-57.8	-48.1	176	170.8	0	0	0	0	110.5	E61 Q62 S67 S68 M69	E61-V65 WeakPolarHBondContact O-CG2 3.36Å; E61-V65 PolarHBondContact O-N 3.28Å; Q62-V65 PolarHBondContact O-N 3.44Å; V65-S67 VanDerWaalsContact C-N 3.33Å; V65-S67 PolarHBondContact O-N 3.44Å; V65-S68 WeakPolarHBondContact CA-OG 3.49Å; V65-S68 PolarHBondContact O-N 2.9Å; V65-S68 VanDerWaalsContact O-N 3.1Å; V65-S68 PolarHBondContact O-OG 3.1Å; V65-M69 HydrophobicContact CG1-CE 3.65Å; V65-M69 HydrophobicContact CG1-SD 4.36Å; V65-M69 WeakPolarHBondContact O-CG 3.47Å; V65-M69 PolarHBondContact O-N 3Å
66	H	87.1	Confident	85.2	Confident	138 Å²	138	116.1 Å²	116.1	64%	0.639	60%	0.595	S	S	*	*	H	α-helix	trans	-62.8	-39.2	178.7	-171	-165.7	0	0	0	112.1	Q62 A63 T64 S68 M69	Q62-H66 VanDerWaalsContact O-CB 3.31Å; Q62-H66 WeakPolarHBondContact O-CB 3.38Å; Q62-H66 PolarHBondContact O-N 2.71Å; A63-H66 PolarHBondContact O-N 3.45Å; T64-H66 VanDerWaalsContact C-N 3.34Å; T64-H66 PolarHBondContact O-N 3.45Å; H66-S68 VanDerWaalsContact C-N 3.27Å; H66-S68 PolarHBondContact O-N 2.88Å; H66-M69 PolarHBondContact O-N 2.98Å
67	S	85.7	Confident	84.7	Confident	93 Å²	93	118.3 Å²	118.3	65%	0.65	61%	0.606	S	S	*	*	H	α-helix	trans	-65.6	-29.7	175	75.4	0	0	0	0	113.3	A63 T64 V65	A63-S67 WeakPolarHBondContact O-CB 3.31Å; A63-S67 PolarHBondContact O-N 2.89Å; A63-S67 PolarHBondContact O-OG 3.5Å; T64-S67 PolarHBondContact O-N 2.7Å; T64-S67 PolarHBondContact O-OG 3.41Å; V65-S67 VanDerWaalsContact C-N 3.33Å; V65-S67 PolarHBondContact O-N 3.44Å
68	S	82.5	Confident	84.2	Confident	81 Å²	81	122.9 Å²	122.9	57%	0.566	62%	0.618	S	S	*	*	H	α-helix	trans	-84.1	-16.3	177.8	72.5	0	0	0	0	113.6	T64 V65 H66 I70	T64-S68 PolarHBondContact O-N 3.21Å; T64-S68 PolarHBondContact O-OG 3.39Å; V65-S68 WeakPolarHBondContact CA-OG 3.49Å; V65-S68 PolarHBondContact O-N 2.9Å; V65-S68 VanDerWaalsContact O-N 3.1Å; V65-S68 PolarHBondContact O-OG 3.1Å; H66-S68 VanDerWaalsContact C-N 3.27Å; H66-S68 PolarHBondContact O-N 2.88Å; S68-I70 PolarHBondContact O-N 2.98Å
69	M	79.4	Confident	83.6	Confident	126 Å²	126	120.8 Å²	120.8	62%	0.621	62%	0.621	S	S	*	*			trans	-77.2	79.6	170	-73.4	178.1	178.6	0	0	108.8	V65 H66	V65-M69 HydrophobicContact CG1-CE 3.65Å; V65-M69 HydrophobicContact CG1-SD 4.36Å; V65-M69 WeakPolarHBondContact O-CG 3.47Å; V65-M69 PolarHBondContact O-N 3Å; H66-M69 PolarHBondContact O-N 2.98Å
70	I	63.6	Low	82.9	Confident	156 Å²	156	116.8 Å²	116.8	80%	0.8	62%	0.618	S	S	*	*			trans	-72.1	122.5	167.5	-39.3	175.7	0	0	0	106.6	S68	S68-I70 PolarHBondContact O-N 2.98Å
71	F	55.5	Low	82.2	Confident	262 Å²	262	118.2 Å²	118.2	100%	1.149	63%	0.627	S	S	*	*			trans	-69.2	0	166.2	-81.7	-83	0	0	0	111

Retrieved 71 of 71 residues in 128.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).