A0A087WV79_HUMAN Loading...

Interferon alpha inducible protein 27

AlphaFold DB , UniProt , Accession A0A087WV79, Species HUMAN (Homo sapiens, Human), Gene IFI27, Length 65 aa.

						>A0A087WV79_HUMAN|A0A087WV79|IFI27
MEASALTSSAVTSVAKVVRVASGSAVVLPLARIATVVIGGVVAMAAVPMVLSAMGFTAAGIASSS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	52.1	Low	56.9	Low	222 Å²	222	98.7 Å²	98.7	100%	1.094	60%	0.604	S	S	*	*				0	11.3	0	-165.5	162.3	152.9	0	0	112.9
2	E	50.6	Low	58.2	Low	151 Å²	151	97.6 Å²	97.6	71%	0.706	60%	0.597	S	S	*	*			trans	-93.9	-35.5	-175.5	-63.3	-64.6	129.1	0	0	113.9	S4 A5 L6	E2-S4 VanDerWaalsContact C-N 3.33Å; E2-S4 PolarHBondContact O-N 3.26Å; E2-A5 PolarHBondContact O-N 3.23Å; E2-L6 PolarHBondContact O-N 3.32Å
3	A	44.2	Very low	59	Low	71 Å²	71	95.7 Å²	95.7	59%	0.587	59%	0.591	S	S	*	*	H	α-helix	trans	-63.7	-34	-176	0	0	0	0	0	113.5	T7	A3-T7 PolarHBondContact O-N 2.79Å; A3-T7 PolarHBondContact O-OG1 3.36Å
4	S	54.2	Low	59.5	Low	95 Å²	95	95.4 Å²	95.4	66%	0.664	59%	0.588	S	S	*	*	H	α-helix	trans	-70.7	-31.2	178.8	-57	0	0	0	0	112.9	E2 S8	E2-S4 VanDerWaalsContact C-N 3.33Å; E2-S4 PolarHBondContact O-N 3.26Å; S4-S8 VanDerWaalsContact O-CB 3.24Å; S4-S8 WeakPolarHBondContact O-CB 3.45Å; S4-S8 PolarHBondContact O-N 3.07Å
5	A	55.1	Low	60	Low	59 Å²	59	92.7 Å²	92.7	49%	0.488	58%	0.58	S	S	.	*	H	α-helix	trans	-72.8	-40.3	177	0	0	0	0	0	111.1	E2 S8 S9	E2-A5 PolarHBondContact O-N 3.23Å; A5-S8 PolarHBondContact O-N 3.37Å; A5-S9 WeakPolarHBondContact O-CB 3.4Å; A5-S9 PolarHBondContact O-N 2.9Å; A5-S9 PolarHBondContact O-OG 3.03Å
6	L	57.3	Low	60.3	Low	116 Å²	116	96.3 Å²	96.3	61%	0.607	58%	0.584	S	S	*	*	H	α-helix	trans	-61.1	-48.5	173.4	-76.9	154	0	0	0	111.3	E2 S8 S9 A10	E2-L6 PolarHBondContact O-N 3.32Å; L6-S8 VanDerWaalsContact C-N 3.35Å; L6-S8 PolarHBondContact O-N 2.99Å; L6-S9 PolarHBondContact O-N 3.32Å; L6-S9 PolarHBondContact O-OG 3.05Å; L6-A10 WeakPolarHBondContact O-CB 3.24Å; L6-A10 PolarHBondContact O-N 3.43Å
7	T	60.3	Low	60.4	Low	92 Å²	92	96.4 Å²	96.4	56%	0.564	59%	0.585	S	S	*	*	H	α-helix	trans	-61.6	-41.8	176	-57.2	0	0	0	0	111.9	A3 A10 V11	A3-T7 PolarHBondContact O-N 2.79Å; A3-T7 PolarHBondContact O-OG1 3.36Å; T7-A10 PolarHBondContact O-N 3.35Å; T7-V11 HydrophobicContact CG2-CG2 4.41Å; T7-V11 WeakPolarHBondContact O-CB 3.4Å; T7-V11 VanDerWaalsContact O-CG2 3.23Å; T7-V11 WeakPolarHBondContact O-CG2 3.36Å; T7-V11 PolarHBondContact O-N 2.98Å
8	S	62.8	Low	60.5	Low	71 Å²	71	96.1 Å²	96.1	50%	0.497	58%	0.583	S	S	.	*	H	α-helix	trans	-64.6	-41	178	-172	0	0	0	0	112.7	S4 A5 L6 V11 T12	S4-S8 VanDerWaalsContact O-CB 3.24Å; S4-S8 WeakPolarHBondContact O-CB 3.45Å; S4-S8 PolarHBondContact O-N 3.07Å; A5-S8 PolarHBondContact O-N 3.37Å; L6-S8 VanDerWaalsContact C-N 3.35Å; L6-S8 PolarHBondContact O-N 2.99Å; S8-V11 PolarHBondContact O-N 3.42Å; S8-T12 WeakPolarHBondContact O-CB 3.49Å; S8-T12 PolarHBondContact O-N 2.89Å; S8-T12 PolarHBondContact O-OG1 3.49Å
9	S	61.7	Low	60.5	Low	65 Å²	65	101.5 Å²	101.5	46%	0.455	59%	0.592	S	S	.	*	H	α-helix	trans	-67.4	-36.6	176.7	72.9	0	0	0	0	112.9	A5 L6 S13	A5-S9 WeakPolarHBondContact O-CB 3.4Å; A5-S9 PolarHBondContact O-N 2.9Å; A5-S9 PolarHBondContact O-OG 3.03Å; L6-S9 PolarHBondContact O-N 3.32Å; L6-S9 PolarHBondContact O-OG 3.05Å; S9-S13 WeakPolarHBondContact O-CB 3.34Å; S9-S13 PolarHBondContact O-N 3.5Å; S9-S13 PolarHBondContact O-OG 2.95Å; S9-S13 VanDerWaalsContact O-OG 3.07Å
10	A	63.6	Low	60.5	Low	52 Å²	52	101.9 Å²	101.9	43%	0.43	60%	0.595	S	S	.	*	H	α-helix	trans	-68.2	-46.5	175.9	0	0	0	0	0	111.2	L6 T7 T12 S13 V14	L6-A10 WeakPolarHBondContact O-CB 3.24Å; L6-A10 PolarHBondContact O-N 3.43Å; T7-A10 PolarHBondContact O-N 3.35Å; A10-T12 VanDerWaalsContact C-N 3.29Å; A10-T12 PolarHBondContact O-N 2.93Å; A10-S13 PolarHBondContact O-N 3.16Å; A10-S13 VanDerWaalsContact O-N 3.16Å; A10-V14 WeakPolarHBondContact O-CG2 3.49Å; A10-V14 PolarHBondContact O-N 3.49Å
11	V	64.1	Low	60.4	Low	92 Å²	92	99.6 Å²	99.6	56%	0.558	59%	0.588	S	S	*	*	H	α-helix	trans	-61.6	-40.1	177.2	172	0	0	0	0	111	T7 S8 S13 V14 A15	T7-V11 HydrophobicContact CG2-CG2 4.41Å; T7-V11 WeakPolarHBondContact O-CB 3.4Å; T7-V11 VanDerWaalsContact O-CG2 3.23Å; T7-V11 WeakPolarHBondContact O-CG2 3.36Å; T7-V11 PolarHBondContact O-N 2.98Å; S8-V11 PolarHBondContact O-N 3.42Å; V11-S13 PolarHBondContact O-N 3.01Å; V11-V14 PolarHBondContact O-N 2.76Å; V11-A15 WeakPolarHBondContact O-CB 3.38Å; V11-A15 PolarHBondContact O-N 2.97Å
12	T	72.8	Confident	60.7	Low	85 Å²	85	93.6 Å²	93.6	52%	0.521	57%	0.568	S	S	.	*	H	α-helix	trans	-65.8	-38.7	176.8	-55.7	0	0	0	0	111.7	S8 A10 K16	S8-T12 WeakPolarHBondContact O-CB 3.49Å; S8-T12 PolarHBondContact O-N 2.89Å; S8-T12 PolarHBondContact O-OG1 3.49Å; A10-T12 VanDerWaalsContact C-N 3.29Å; A10-T12 PolarHBondContact O-N 2.93Å; T12-K16 PolarHBondContact O-N 3.16Å
13	S	67.7	Low	61	Low	73 Å²	73	89.2 Å²	89.2	51%	0.51	56%	0.564	S	S	.	*	H	α-helix	trans	-67.7	-43.7	175.9	-67.2	0	0	0	0	112	S9 A10 V11 A15 K16 V17	S9-S13 WeakPolarHBondContact O-CB 3.34Å; S9-S13 PolarHBondContact O-N 3.5Å; S9-S13 PolarHBondContact O-OG 2.95Å; S9-S13 VanDerWaalsContact O-OG 3.07Å; A10-S13 PolarHBondContact O-N 3.16Å; A10-S13 VanDerWaalsContact O-N 3.16Å; V11-S13 PolarHBondContact O-N 3.01Å; S13-A15 PolarHBondContact O-N 3.06Å; S13-K16 WeakPolarHBondContact O-CB 3.23Å; S13-K16 PolarHBondContact O-N 3.38Å; S13-K16 VanDerWaalsContact O-N 3.16Å; S13-V17 WeakPolarHBondContact O-CG2 3.42Å; S13-V17 PolarHBondContact O-N 2.98Å
14	V	66.9	Low	61.5	Low	91 Å²	91	87.9 Å²	87.9	55%	0.552	55%	0.55	S	S	*	.	H	α-helix	trans	-62.7	-43.4	176.4	173	0	0	0	0	110.9	A10 V11 K16 V17 V18	A10-V14 WeakPolarHBondContact O-CG2 3.49Å; A10-V14 PolarHBondContact O-N 3.49Å; V11-V14 PolarHBondContact O-N 2.76Å; V14-K16 VanDerWaalsContact C-N 3.26Å; V14-K16 PolarHBondContact O-N 2.81Å; V14-V17 PolarHBondContact O-N 3.43Å; V14-V18 HydrophobicContact CG1-CG2 4.39Å; V14-V18 WeakPolarHBondContact O-CB 3.32Å; V14-V18 WeakPolarHBondContact O-CG2 3.35Å; V14-V18 PolarHBondContact O-N 2.92Å
15	A	67.2	Low	61.7	Low	56 Å²	56	87 Å²	87	46%	0.463	55%	0.548	S	S	.	.	H	α-helix	trans	-60.9	-36.7	175.3	0	0	0	0	0	112.1	V11 S13 R19	V11-A15 WeakPolarHBondContact O-CB 3.38Å; V11-A15 PolarHBondContact O-N 2.97Å; S13-A15 PolarHBondContact O-N 3.06Å; A15-R19 PolarHBondContact O-N 3.32Å
16	K	63.8	Low	61.8	Low	149 Å²	149	89.2 Å²	89.2	65%	0.648	56%	0.555	S	S	*	*	H	α-helix	trans	-65.8	-44.7	174	-119.6	175.1	-179.8	172.6	0	111.9	T12 S13 V14 R19 V20	T12-K16 PolarHBondContact O-N 3.16Å; S13-K16 WeakPolarHBondContact O-CB 3.23Å; S13-K16 PolarHBondContact O-N 3.38Å; S13-K16 VanDerWaalsContact O-N 3.16Å; V14-K16 VanDerWaalsContact C-N 3.26Å; V14-K16 PolarHBondContact O-N 2.81Å; K16-R19 PolarHBondContact O-N 2.99Å; K16-V20 WeakPolarHBondContact O-CG2 3.5Å; K16-V20 PolarHBondContact O-N 2.86Å
17	V	61.7	Low	61.8	Low	99 Å²	99	87.5 Å²	87.5	60%	0.6	55%	0.55	S	S	*	.	H	α-helix	trans	-63.1	-43.9	176.8	172.8	0	0	0	0	110.9	S13 V14 R19 V20 A21	S13-V17 WeakPolarHBondContact O-CG2 3.42Å; S13-V17 PolarHBondContact O-N 2.98Å; V14-V17 PolarHBondContact O-N 3.43Å; V17-R19 PolarHBondContact O-N 3.22Å; V17-V20 PolarHBondContact O-N 3.46Å; V17-A21 WeakPolarHBondContact O-CB 3.34Å; V17-A21 PolarHBondContact O-N 3.34Å
18	V	62.7	Low	61.9	Low	91 Å²	91	88.4 Å²	88.4	55%	0.552	55%	0.551	S	S	*	*	H	α-helix	trans	-62.2	-41.6	176.4	167.4	0	0	0	0	111.3	V14 A21 S22	V14-V18 HydrophobicContact CG1-CG2 4.39Å; V14-V18 WeakPolarHBondContact O-CB 3.32Å; V14-V18 WeakPolarHBondContact O-CG2 3.35Å; V14-V18 PolarHBondContact O-N 2.92Å; V18-A21 PolarHBondContact O-N 2.91Å; V18-S22 WeakPolarHBondContact O-CB 3.34Å; V18-S22 PolarHBondContact O-N 3.13Å
19	R	60.9	Low	62	Low	199 Å²	199	88 Å²	88	75%	0.751	55%	0.546	S	S	*	.	H	α-helix	trans	-63.9	-42.2	173.3	-95.5	-125.2	-137.1	101.8	1.7	112.8	A15 K16 V17 A21 S22 G23	A15-R19 PolarHBondContact O-N 3.32Å; K16-R19 PolarHBondContact O-N 2.99Å; V17-R19 PolarHBondContact O-N 3.22Å; R19-A21 VanDerWaalsContact C-N 3.35Å; R19-S22 PolarHBondContact O-N 2.89Å; R19-G23 PolarHBondContact O-N 2.92Å
20	V	60.3	Low	62.5	Low	109 Å²	109	90.5 Å²	90.5	66%	0.661	55%	0.554	S	S	*	*	H	α-helix	trans	-65.5	-40.8	177.5	167.7	0	0	0	0	110.7	K16 V17 S24	K16-V20 WeakPolarHBondContact O-CG2 3.5Å; K16-V20 PolarHBondContact O-N 2.86Å; V17-V20 PolarHBondContact O-N 3.46Å; V20-S24 WeakPolarHBondContact O-CB 3.38Å; V20-S24 PolarHBondContact O-N 3.19Å
21	A	58.3	Low	62.9	Low	54 Å²	54	90.6 Å²	90.6	45%	0.446	56%	0.555	S	S	.	*	H	α-helix	trans	-67.9	-40.9	175.8	0	0	0	0	0	111.9	V17 V18 R19 S24	V17-A21 WeakPolarHBondContact O-CB 3.34Å; V17-A21 PolarHBondContact O-N 3.34Å; V18-A21 PolarHBondContact O-N 2.91Å; R19-A21 VanDerWaalsContact C-N 3.35Å; A21-S24 WeakPolarHBondContact O-CB 3.42Å; A21-S24 PolarHBondContact O-N 2.93Å
22	S	58.1	Low	63.2	Low	95 Å²	95	95.4 Å²	95.4	66%	0.664	56%	0.563	S	S	*	*	H	α-helix	trans	-72.3	-29.7	178.2	-174	0	0	0	0	112.9	V18 R19	V18-S22 WeakPolarHBondContact O-CB 3.34Å; V18-S22 PolarHBondContact O-N 3.13Å; R19-S22 PolarHBondContact O-N 2.89Å
23	G	57	Low	63.4	Low	60 Å²	60	96.1 Å²	96.1	62%	0.619	56%	0.563	S	S	*	*	T	Hydrogen-bonded Turn	trans	-90.8	-0.5	174.1	0	0	0	0	0	113.7	R19 A25	R19-G23 PolarHBondContact O-N 2.92Å; G23-A25 PolarHBondContact O-N 3.34Å
24	S	55.7	Low	63.7	Low	42 Å²	42	94.9 Å²	94.9	29%	0.294	56%	0.557	S	S	.	*			trans	-69.2	100.2	177.1	-177.3	0	0	0	0	108.6	V20 A21 V26 V27	V20-S24 WeakPolarHBondContact O-CB 3.38Å; V20-S24 PolarHBondContact O-N 3.19Å; A21-S24 WeakPolarHBondContact O-CB 3.42Å; A21-S24 PolarHBondContact O-N 2.93Å; S24-V26 PolarHBondContact O-N 2.82Å; S24-V27 PolarHBondContact O-N 2.8Å
25	A	57.3	Low	64.1	Low	77 Å²	77	94.9 Å²	94.9	64%	0.636	56%	0.557	S	S	*	*	T	Hydrogen-bonded Turn	trans	-57.9	-5.1	175	0	0	0	0	0	113.3	G23 P29	G23-A25 PolarHBondContact O-N 3.34Å; A25-P29 WeakPolarHBondContact O-CD 3.01Å; A25-P29 WeakPolarHBondContact O-CG 2.79Å
26	V	58	Low	64.6	Low	105 Å²	105	97.2 Å²	97.2	64%	0.636	57%	0.565	S	S	*	*	T	Hydrogen-bonded Turn	trans	-87.6	-29.1	174	-176.7	0	0	0	0	111.8	S24 P29 L30	S24-V26 PolarHBondContact O-N 2.82Å; V26-P29 WeakPolarHBondContact O-CD 3.4Å; V26-L30 WeakPolarHBondContact O-CB 3.49Å; V26-L30 PolarHBondContact O-N 3.42Å; V26-L30 VanDerWaalsContact O-N 3.13Å
27	V	57.8	Low	65.6	Low	80 Å²	80	94.1 Å²	94.1	49%	0.485	56%	0.559	S	S	.	*	H	α-helix	trans	-73.1	-36.8	-178.2	-178.8	0	0	0	0	111.5	S24 L30 A31	S24-V27 PolarHBondContact O-N 2.8Å; V27-L30 PolarHBondContact O-N 3.49Å; V27-A31 VanDerWaalsContact O-CB 3.31Å; V27-A31 WeakPolarHBondContact O-CB 3.49Å; V27-A31 PolarHBondContact O-N 2.83Å
28	L	60.5	Low	66.7	Low	112 Å²	112	94.8 Å²	94.8	59%	0.586	56%	0.557	S	S	*	*	H	α-helix	trans	-63.7	-49.9	176.1	-82.3	118.5	0	0	0	113.1	L30 A31 R32	L28-L30 VanDerWaalsContact C-N 3.33Å; L28-L30 PolarHBondContact O-N 3.42Å; L28-A31 PolarHBondContact O-N 2.89Å; L28-R32 WeakPolarHBondContact O-CB 3.14Å; L28-R32 VanDerWaalsContact O-CG 3.22Å; L28-R32 WeakPolarHBondContact O-CG 3.47Å; L28-R32 PolarHBondContact O-N 3.47Å
29	P	66.7	Low	67.8	Low	63 Å²	63	92.4 Å²	92.4	41%	0.409	55%	0.551	S	S	.	*	H	α-helix	trans	-59.3	-42.2	172.3	-24.3	31.5	0	0	0	112.4	A25 V26 R32 I33	A25-P29 WeakPolarHBondContact O-CD 3.01Å; A25-P29 WeakPolarHBondContact O-CG 2.79Å; V26-P29 WeakPolarHBondContact O-CD 3.4Å; P29-R32 WeakPolarHBondContact O-CB 3.21Å; P29-R32 PolarHBondContact O-N 3.39Å; P29-I33 WeakPolarHBondContact O-CB 3.48Å; P29-I33 WeakPolarHBondContact O-CD1 3.27Å; P29-I33 WeakPolarHBondContact O-CG1 3.31Å; P29-I33 PolarHBondContact O-N 3.36Å
30	L	71.6	Confident	68.9	Low	117 Å²	117	84.5 Å²	84.5	61%	0.613	53%	0.532	S	S	*	.	H	α-helix	trans	-65.7	-42.4	-178.8	-156.1	76.7	0	0	0	111.7	V26 V27 L28 R32 I33 A34	V26-L30 WeakPolarHBondContact O-CB 3.49Å; V26-L30 PolarHBondContact O-N 3.42Å; V26-L30 VanDerWaalsContact O-N 3.13Å; V27-L30 PolarHBondContact O-N 3.49Å; L28-L30 VanDerWaalsContact C-N 3.33Å; L28-L30 PolarHBondContact O-N 3.42Å; L30-R32 VanDerWaalsContact C-N 3.34Å; L30-I33 PolarHBondContact O-N 3.24Å; L30-A34 WeakPolarHBondContact O-CB 3.4Å; L30-A34 PolarHBondContact O-N 2.9Å
31	A	71	Confident	69.9	Low	54 Å²	54	83.9 Å²	83.9	45%	0.446	53%	0.528	S	S	.	.	H	α-helix	trans	-62.1	-42	173.6	0	0	0	0	0	111.5	V27 L28 A34 T35	V27-A31 VanDerWaalsContact O-CB 3.31Å; V27-A31 WeakPolarHBondContact O-CB 3.49Å; V27-A31 PolarHBondContact O-N 2.83Å; L28-A31 PolarHBondContact O-N 2.89Å; A31-A34 PolarHBondContact O-N 3.31Å; A31-T35 WeakPolarHBondContact O-CG2 3.5Å; A31-T35 PolarHBondContact O-N 3.36Å; A31-T35 PolarHBondContact O-OG1 3.21Å
32	R	72.2	Confident	71.1	Confident	192 Å²	192	85.8 Å²	85.8	73%	0.725	53%	0.534	S	S	*	.	H	α-helix	trans	-61.6	-47.2	174.9	-71.9	-115.9	172.7	177.5	-3.4	111.8	L28 P29 L30 A34 T35 V36	L28-R32 WeakPolarHBondContact O-CB 3.14Å; L28-R32 VanDerWaalsContact O-CG 3.22Å; L28-R32 WeakPolarHBondContact O-CG 3.47Å; L28-R32 PolarHBondContact O-N 3.47Å; P29-R32 WeakPolarHBondContact O-CB 3.21Å; P29-R32 PolarHBondContact O-N 3.39Å; L30-R32 VanDerWaalsContact C-N 3.34Å; R32-A34 PolarHBondContact O-N 2.87Å; R32-T35 WeakPolarHBondContact CA-OG1 3.22Å; R32-T35 PolarHBondContact O-N 2.98Å; R32-T35 PolarHBondContact O-OG1 3.46Å; R32-V36 WeakPolarHBondContact O-CG2 3.26Å; R32-V36 PolarHBondContact O-N 2.97Å
33	I	76.8	Confident	72.1	Confident	101 Å²	101	83.6 Å²	83.6	52%	0.518	52%	0.522	S	S	.	.	H	α-helix	trans	-59.5	-47.6	177	-67.9	162	0	0	0	110.1	P29 L30 T35 V36 V37	P29-I33 WeakPolarHBondContact O-CB 3.48Å; P29-I33 WeakPolarHBondContact O-CD1 3.27Å; P29-I33 WeakPolarHBondContact O-CG1 3.31Å; P29-I33 PolarHBondContact O-N 3.36Å; L30-I33 PolarHBondContact O-N 3.24Å; I33-T35 VanDerWaalsContact C-N 3.34Å; I33-T35 PolarHBondContact O-N 2.9Å; I33-V36 PolarHBondContact O-N 3.47Å; I33-V37 HydrophobicContact CG2-CG2 4.19Å; I33-V37 WeakPolarHBondContact O-CB 3.48Å; I33-V37 VanDerWaalsContact O-CG2 3.26Å; I33-V37 WeakPolarHBondContact O-CG2 3.34Å; I33-V37 PolarHBondContact O-N 3.39Å
34	A	73	Confident	73.2	Confident	47 Å²	47	88 Å²	88	39%	0.388	53%	0.528	S	S	.	.	H	α-helix	trans	-58.5	-44.8	177.9	0	0	0	0	0	111.9	L30 A31 R32 V36 V37 I38	L30-A34 WeakPolarHBondContact O-CB 3.4Å; L30-A34 PolarHBondContact O-N 2.9Å; A31-A34 PolarHBondContact O-N 3.31Å; R32-A34 PolarHBondContact O-N 2.87Å; A34-V36 PolarHBondContact O-N 2.92Å; A34-V37 PolarHBondContact O-N 2.73Å; A34-I38 WeakPolarHBondContact O-CB 3.48Å; A34-I38 WeakPolarHBondContact O-CD1 3.18Å; A34-I38 WeakPolarHBondContact O-CG1 3.4Å; A34-I38 PolarHBondContact O-N 2.95Å
35	T	74.7	Confident	74.3	Confident	90 Å²	90	89 Å²	89	55%	0.552	54%	0.539	S	S	*	.	H	α-helix	trans	-64.4	-39.1	177.4	57.1	0	0	0	0	113.1	A31 R32 I33 G39	A31-T35 WeakPolarHBondContact O-CG2 3.5Å; A31-T35 PolarHBondContact O-N 3.36Å; A31-T35 PolarHBondContact O-OG1 3.21Å; R32-T35 WeakPolarHBondContact CA-OG1 3.22Å; R32-T35 PolarHBondContact O-N 2.98Å; R32-T35 PolarHBondContact O-OG1 3.46Å; I33-T35 VanDerWaalsContact C-N 3.34Å; I33-T35 PolarHBondContact O-N 2.9Å; T35-G39 PolarHBondContact O-N 2.87Å
36	V	79.5	Confident	75.3	Confident	105 Å²	105	87.3 Å²	87.3	64%	0.636	53%	0.525	S	S	*	.	H	α-helix	trans	-67.6	-41.2	176.8	171.2	0	0	0	0	110.9	R32 I33 A34 G40	R32-V36 WeakPolarHBondContact O-CG2 3.26Å; R32-V36 PolarHBondContact O-N 2.97Å; I33-V36 PolarHBondContact O-N 3.47Å; A34-V36 PolarHBondContact O-N 2.92Å; V36-G40 WeakPolarHBondContact O-CA 3.32Å; V36-G40 PolarHBondContact O-N 3.37Å
37	V	83.3	Confident	76.2	Confident	85 Å²	85	86.2 Å²	86.2	52%	0.515	52%	0.519	S	S	.	.	H	α-helix	trans	-65.3	-47.4	177.3	172.3	0	0	0	0	110.6	I33 A34 G40 V41	I33-V37 HydrophobicContact CG2-CG2 4.19Å; I33-V37 WeakPolarHBondContact O-CB 3.48Å; I33-V37 VanDerWaalsContact O-CG2 3.26Å; I33-V37 WeakPolarHBondContact O-CG2 3.34Å; I33-V37 PolarHBondContact O-N 3.39Å; A34-V37 PolarHBondContact O-N 2.73Å; V37-G40 PolarHBondContact O-N 3.27Å; V37-V41 HydrophobicContact CG1-CG2 4.45Å; V37-V41 WeakPolarHBondContact O-CB 3.37Å; V37-V41 VanDerWaalsContact O-CG2 3.27Å; V37-V41 WeakPolarHBondContact O-CG2 3.45Å; V37-V41 PolarHBondContact O-N 3.27Å
38	I	85.9	Confident	77	Confident	112 Å²	112	86.1 Å²	86.1	57%	0.574	52%	0.519	S	S	*	.	H	α-helix	trans	-62.4	-47.9	178.8	-65.6	163	0	0	0	110.3	A34 G40 V41 V42	A34-I38 WeakPolarHBondContact O-CB 3.48Å; A34-I38 WeakPolarHBondContact O-CD1 3.18Å; A34-I38 WeakPolarHBondContact O-CG1 3.4Å; A34-I38 PolarHBondContact O-N 2.95Å; I38-G40 VanDerWaalsContact C-N 3.33Å; I38-G40 PolarHBondContact O-N 3.3Å; I38-V41 PolarHBondContact O-N 2.96Å; I38-V42 WeakPolarHBondContact O-CG2 3.46Å; I38-V42 PolarHBondContact O-N 3.25Å
39	G	84.8	Confident	77.8	Confident	41 Å²	41	87.6 Å²	87.6	42%	0.423	53%	0.525	S	S	.	.	H	α-helix	trans	-62.4	-39.9	176.8	0	0	0	0	0	112.7	T35 V42 A43	T35-G39 PolarHBondContact O-N 2.87Å; G39-V42 PolarHBondContact O-N 2.81Å; G39-A43 WeakPolarHBondContact O-CB 3.44Å; G39-A43 PolarHBondContact O-N 3.47Å
40	G	83.6	Confident	78.3	Confident	34 Å²	34	88 Å²	88	35%	0.351	53%	0.527	S	S	.	.	H	α-helix	trans	-64.9	-41.7	177	0	0	0	0	0	112.8	V36 V37 I38 A43 M44	V36-G40 WeakPolarHBondContact O-CA 3.32Å; V36-G40 PolarHBondContact O-N 3.37Å; V37-G40 PolarHBondContact O-N 3.27Å; I38-G40 VanDerWaalsContact C-N 3.33Å; I38-G40 PolarHBondContact O-N 3.3Å; G40-A43 PolarHBondContact O-N 3.34Å; G40-M44 WeakPolarHBondContact O-CB 3.39Å; G40-M44 WeakPolarHBondContact O-CG 3.34Å; G40-M44 PolarHBondContact O-N 3.07Å
41	V	82.1	Confident	78.5	Confident	95 Å²	95	85.7 Å²	85.7	58%	0.576	51%	0.514	S	S	*	.	H	α-helix	trans	-64.7	-43.7	175.6	169.6	0	0	0	0	110.9	V37 I38 A43 M44 A45	V37-V41 HydrophobicContact CG1-CG2 4.45Å; V37-V41 WeakPolarHBondContact O-CB 3.37Å; V37-V41 VanDerWaalsContact O-CG2 3.27Å; V37-V41 WeakPolarHBondContact O-CG2 3.45Å; V37-V41 PolarHBondContact O-N 3.27Å; I38-V41 PolarHBondContact O-N 2.96Å; V41-A43 VanDerWaalsContact C-N 3.33Å; V41-A43 PolarHBondContact O-N 2.91Å; V41-M44 PolarHBondContact O-N 3.42Å; V41-A45 PolarHBondContact O-N 3.37Å
42	V	83.4	Confident	78.6	Confident	94 Å²	94	86 Å²	86	57%	0.57	51%	0.513	S	S	*	.	H	α-helix	trans	-61.3	-44.1	175.6	172.7	0	0	0	0	110.7	I38 G39 A45 A46	I38-V42 WeakPolarHBondContact O-CG2 3.46Å; I38-V42 PolarHBondContact O-N 3.25Å; G39-V42 PolarHBondContact O-N 2.81Å; V42-A45 PolarHBondContact O-N 2.79Å; V42-A46 WeakPolarHBondContact O-CB 2.88Å; V42-A46 PolarHBondContact O-N 3.23Å
43	A	79.5	Confident	78.6	Confident	49 Å²	49	81.2 Å²	81.2	41%	0.405	51%	0.514	S	S	.	.	H	α-helix	trans	-62.5	-43.2	175.4	0	0	0	0	0	111.7	G39 G40 V41 A45 A46 V47	G39-A43 WeakPolarHBondContact O-CB 3.44Å; G39-A43 PolarHBondContact O-N 3.47Å; G40-A43 PolarHBondContact O-N 3.34Å; V41-A43 VanDerWaalsContact C-N 3.33Å; V41-A43 PolarHBondContact O-N 2.91Å; A43-A45 VanDerWaalsContact C-N 3.29Å; A43-A45 PolarHBondContact O-N 3.45Å; A43-A46 PolarHBondContact O-N 3.36Å; A43-V47 WeakPolarHBondContact O-CB 3.35Å; A43-V47 WeakPolarHBondContact O-CG2 3.28Å; A43-V47 PolarHBondContact O-N 3.15Å
44	M	79.9	Confident	78.4	Confident	153 Å²	153	83.3 Å²	83.3	75%	0.754	52%	0.524	S	S	*	.	H	α-helix	trans	-64.9	-29.9	177.2	-77.5	-157.8	179.8	0	0	113.4	G40 V41 P48	G40-M44 WeakPolarHBondContact O-CB 3.39Å; G40-M44 WeakPolarHBondContact O-CG 3.34Å; G40-M44 PolarHBondContact O-N 3.07Å; V41-M44 PolarHBondContact O-N 3.42Å; M44-P48 WeakPolarHBondContact O-CD 3.19Å; M44-P48 WeakPolarHBondContact O-CG 3.36Å
45	A	78.6	Confident	78.3	Confident	62 Å²	62	84 Å²	84	51%	0.512	54%	0.536	S	S	.	.	H	α-helix	trans	-77.2	-36.7	173.3	0	0	0	0	0	112.1	V41 V42 A43	V41-A45 PolarHBondContact O-N 3.37Å; V42-A45 PolarHBondContact O-N 2.79Å; A43-A45 VanDerWaalsContact C-N 3.29Å; A43-A45 PolarHBondContact O-N 3.45Å
46	A	77.9	Confident	77.9	Confident	43 Å²	43	87.1 Å²	87.1	36%	0.355	54%	0.542	S	S	.	.	H	α-helix	trans	-76.1	-37	-178.6	0	0	0	0	0	113	V42 A43 M49 V50	V42-A46 WeakPolarHBondContact O-CB 2.88Å; V42-A46 PolarHBondContact O-N 3.23Å; A43-A46 PolarHBondContact O-N 3.36Å; A46-M49 PolarHBondContact O-N 3.25Å; A46-V50 WeakPolarHBondContact O-CB 3.32Å; A46-V50 VanDerWaalsContact O-CG2 3.28Å; A46-V50 WeakPolarHBondContact O-CG2 3.13Å; A46-V50 PolarHBondContact O-N 3.25Å
47	V	77.3	Confident	76.9	Confident	82 Å²	82	85.7 Å²	85.7	50%	0.497	53%	0.533	S	S	.	.	H	α-helix	trans	-57.9	-48.2	-176.4	165.2	0	0	0	0	112.4	A43 M49 V50 L51	A43-V47 WeakPolarHBondContact O-CB 3.35Å; A43-V47 WeakPolarHBondContact O-CG2 3.28Å; A43-V47 PolarHBondContact O-N 3.15Å; V47-M49 PolarHBondContact O-N 2.99Å; V47-V50 PolarHBondContact O-N 3.49Å; V47-L51 HydrophobicContact CG1-CD1 4.24Å; V47-L51 WeakPolarHBondContact O-CB 3.31Å; V47-L51 PolarHBondContact O-N 2.84Å
48	P	74.3	Confident	75.6	Confident	77 Å²	77	84.8 Å²	84.8	50%	0.5	54%	0.535	S	S	.	.	H	α-helix	trans	-62.7	-38.4	175.7	-23.5	33.6	0	0	0	113.4	M44 S52	M44-P48 WeakPolarHBondContact O-CD 3.19Å; M44-P48 WeakPolarHBondContact O-CG 3.36Å; P48-S52 WeakPolarHBondContact O-CB 3.42Å; P48-S52 PolarHBondContact O-N 2.96Å
49	M	77.9	Confident	74.1	Confident	143 Å²	143	82.3 Å²	82.3	70%	0.704	53%	0.531	S	S	*	.	H	α-helix	trans	-64.7	-43.8	175.8	-74.5	-170.6	-172	0	0	111.4	A46 V47 S52 A53	A46-M49 PolarHBondContact O-N 3.25Å; V47-M49 PolarHBondContact O-N 2.99Å; M49-S52 PolarHBondContact O-N 2.88Å; M49-A53 VanDerWaalsContact O-CB 3.31Å; M49-A53 WeakPolarHBondContact O-CB 3.4Å; M49-A53 PolarHBondContact O-N 3.19Å
50	V	77.4	Confident	72.5	Confident	73 Å²	73	83.2 Å²	83.2	44%	0.442	54%	0.541	S	S	.	.	H	α-helix	trans	-68.6	-41.4	180	169.9	0	0	0	0	111.2	A46 V47 A53 M54	A46-V50 WeakPolarHBondContact O-CB 3.32Å; A46-V50 VanDerWaalsContact O-CG2 3.28Å; A46-V50 WeakPolarHBondContact O-CG2 3.13Å; A46-V50 PolarHBondContact O-N 3.25Å; V47-V50 PolarHBondContact O-N 3.49Å; V50-A53 PolarHBondContact O-N 3.44Å; V50-M54 HydrophobicContact CG1-CE 3.25Å; V50-M54 WeakPolarHBondContact O-CB 3.35Å; V50-M54 PolarHBondContact O-N 3.04Å
51	L	75.9	Confident	71.1	Confident	67 Å²	67	88.1 Å²	88.1	35%	0.351	56%	0.557	S	S	.	*	H	α-helix	trans	-60.8	-46.6	171.5	-110.7	70.2	0	0	0	111.2	V47 A53 M54 G55 F56	V47-L51 HydrophobicContact CG1-CD1 4.24Å; V47-L51 WeakPolarHBondContact O-CB 3.31Å; V47-L51 PolarHBondContact O-N 2.84Å; L51-A53 VanDerWaalsContact C-N 3.32Å; L51-A53 PolarHBondContact O-N 2.88Å; L51-M54 CarbonylContact O-C 3.54Å; L51-M54 PolarHBondContact O-N 3.22Å; L51-G55 PolarHBondContact O-N 2.87Å; L51-F56 CarbonylContact C-O 3.58Å; L51-F56 HydrophobicContact CB-CB 4.14Å; L51-F56 HydrophobicContact CD2-CB 4.34Å; L51-F56 HydrophobicContact CD2-CD1 3.39Å; L51-F56 HydrophobicContact CD2-CE1 3.96Å; L51-F56 HydrophobicContact CD2-CG 4.1Å; L51-F56 HydrophobicContact CG-CB 3.86Å; L51-F56 HydrophobicContact CG-CD1 3.88Å; L51-F56 HydrophobicContact CG-CG 4.07Å; L51-F56 CarbonylContact O-C 3.51Å; L51-F56 WeakPolarHBondContact O-CA 3.36Å; L51-F56 WeakPolarHBondContact O-CB 3.49Å; L51-F56 PolarHBondContact O-N 3.31Å
52	S	72.2	Confident	69.8	Low	62 Å²	62	87.5 Å²	87.5	43%	0.434	56%	0.563	S	S	.	*	H	α-helix	trans	-62.4	-39.2	178.1	-173.3	0	0	0	0	111.9	P48 M49 G55	P48-S52 WeakPolarHBondContact O-CB 3.42Å; P48-S52 PolarHBondContact O-N 2.96Å; M49-S52 PolarHBondContact O-N 2.88Å; S52-G55 PolarHBondContact O-N 3.37Å; S52-G55 VanDerWaalsContact O-N 3.17Å
53	A	72.5	Confident	68.1	Low	90 Å²	90	88.1 Å²	88.1	74%	0.744	57%	0.571	S	S	*	*	H	α-helix	trans	-69.1	-32.6	176.1	0	0	0	0	0	112.5	M49 V50 L51 G55	M49-A53 VanDerWaalsContact O-CB 3.31Å; M49-A53 WeakPolarHBondContact O-CB 3.4Å; M49-A53 PolarHBondContact O-N 3.19Å; V50-A53 PolarHBondContact O-N 3.44Å; L51-A53 VanDerWaalsContact C-N 3.32Å; L51-A53 PolarHBondContact O-N 2.88Å; A53-G55 PolarHBondContact O-N 2.84Å
54	M	73.4	Confident	66.8	Low	146 Å²	146	90.9 Å²	90.9	72%	0.719	59%	0.587	S	S	*	*	T	Hydrogen-bonded Turn	trans	-77	4.1	171.5	-83.6	-170.9	-99.1	0	0	113.7	V50 L51 F56	V50-M54 HydrophobicContact CG1-CE 3.25Å; V50-M54 WeakPolarHBondContact O-CB 3.35Å; V50-M54 PolarHBondContact O-N 3.04Å; L51-M54 CarbonylContact O-C 3.54Å; L51-M54 PolarHBondContact O-N 3.22Å; M54-F56 VanDerWaalsContact C-N 3.25Å; M54-F56 PolarHBondContact O-N 3.46Å
55	G	69.3	Low	65.3	Low	62 Å²	62	91.9 Å²	91.9	64%	0.639	61%	0.609	S	S	*	*	T	Hydrogen-bonded Turn	trans	79.4	4.8	-179.7	0	0	0	0	0	114.2	L51 S52 A53 T57	L51-G55 PolarHBondContact O-N 2.87Å; S52-G55 PolarHBondContact O-N 3.37Å; S52-G55 VanDerWaalsContact O-N 3.17Å; A53-G55 PolarHBondContact O-N 2.84Å; G55-T57 PolarHBondContact O-N 2.84Å
56	F	66.7	Low	64.6	Low	155 Å²	155	93.4 Å²	93.4	68%	0.68	61%	0.614	S	S	*	*			trans	-83.4	62.6	171.1	-154	-81	0	0	0	109	L51 M54 A58	L51-F56 CarbonylContact C-O 3.58Å; L51-F56 HydrophobicContact CB-CB 4.14Å; L51-F56 HydrophobicContact CD2-CB 4.34Å; L51-F56 HydrophobicContact CD2-CD1 3.39Å; L51-F56 HydrophobicContact CD2-CE1 3.96Å; L51-F56 HydrophobicContact CD2-CG 4.1Å; L51-F56 HydrophobicContact CG-CB 3.86Å; L51-F56 HydrophobicContact CG-CD1 3.88Å; L51-F56 HydrophobicContact CG-CG 4.07Å; L51-F56 CarbonylContact O-C 3.51Å; L51-F56 WeakPolarHBondContact O-CA 3.36Å; L51-F56 WeakPolarHBondContact O-CB 3.49Å; L51-F56 PolarHBondContact O-N 3.31Å; M54-F56 VanDerWaalsContact C-N 3.25Å; M54-F56 PolarHBondContact O-N 3.46Å; F56-A58 PolarHBondContact O-N 3.43Å
57	T	60	Low	63.9	Low	74 Å²	74	96 Å²	96	45%	0.454	63%	0.628	S	S	.	*			trans	-84.4	113.2	-178.6	-56.8	0	0	0	0	109.1	G55 A59	G55-T57 PolarHBondContact O-N 2.84Å; T57-A59 HydrophobicContact CG2-CB 3.41Å; T57-A59 VanDerWaalsContact CG2-CB 3.41Å; T57-A59 PolarHBondContact O-N 3.26Å
58	A	56	Low	63.2	Low	66 Å²	66	96.8 Å²	96.8	55%	0.545	64%	0.635	S	S	.	*	T	Hydrogen-bonded Turn	trans	-63.4	10	171	0	0	0	0	0	114.4	F56 G60 I61 A62	F56-A58 PolarHBondContact O-N 3.43Å; A58-G60 PolarHBondContact O-N 2.84Å; A58-I61 PolarHBondContact O-N 3.33Å; A58-A62 PolarHBondContact O-N 3.44Å; A58-A62 VanDerWaalsContact O-N 3.15Å
59	A	53.6	Low	62.5	Low	60 Å²	60	97.9 Å²	97.9	50%	0.496	64%	0.643	S	S	.	*	H	α-helix	trans	-60.7	-25.7	173.4	0	0	0	0	0	112	T57 I61 S63	T57-A59 HydrophobicContact CG2-CB 3.41Å; T57-A59 VanDerWaalsContact CG2-CB 3.41Å; T57-A59 PolarHBondContact O-N 3.26Å; A59-I61 VanDerWaalsContact C-N 3.31Å; A59-I61 PolarHBondContact O-N 3.17Å; A59-S63 PolarHBondContact O-N 2.95Å
60	G	50.2	Low	61.6	Low	61 Å²	61	95.1 Å²	95.1	63%	0.629	64%	0.639	S	S	*	*	H	α-helix	trans	-67.2	-27.9	171.3	0	0	0	0	0	114	A58	A58-G60 PolarHBondContact O-N 2.84Å
61	I	54.1	Low	60.5	Low	136 Å²	136	96.6 Å²	96.6	70%	0.697	65%	0.652	S	S	*	*	H	α-helix	trans	-86.8	-37.4	178.5	-53.1	-174.6	0	0	0	110.4	A58 A59 S63 S64	A58-I61 PolarHBondContact O-N 3.33Å; A59-I61 VanDerWaalsContact C-N 3.31Å; A59-I61 PolarHBondContact O-N 3.17Å; I61-S63 VanDerWaalsContact C-N 3.27Å; I61-S63 PolarHBondContact O-N 3.2Å; I61-S64 PolarHBondContact O-N 3.38Å
62	A	55	Low	59.4	Low	83 Å²	83	98.7 Å²	98.7	69%	0.686	67%	0.674	S	S	*	*	H	α-helix	trans	-68.1	-23.1	177.7	0	0	0	0	0	113.9	A58 S64	A58-A62 PolarHBondContact O-N 3.44Å; A58-A62 VanDerWaalsContact O-N 3.15Å; A62-S64 VanDerWaalsContact C-N 3.3Å
63	S	49.2	Very low	58.4	Low	107 Å²	107	101.5 Å²	101.5	75%	0.748	69%	0.692	S	S	*	*	T	Hydrogen-bonded Turn	trans	-83.5	-2.6	176	-169.5	0	0	0	0	113.9	A59 I61	A59-S63 PolarHBondContact O-N 2.95Å; I61-S63 VanDerWaalsContact C-N 3.27Å; I61-S63 PolarHBondContact O-N 3.2Å
64	S	50.6	Low	57.3	Low	107 Å²	107	102.5 Å²	102.5	75%	0.748	69%	0.688	S	S	*	*			trans	-127.8	51.5	-179.5	-172.9	0	0	0	0	110.8	I61 A62	I61-S64 PolarHBondContact O-N 3.38Å; A62-S64 VanDerWaalsContact C-N 3.3Å
65	S	49.3	Very low	55.8	Low	173 Å²	173	98.5 Å²	98.5	100%	1.21	69%	0.685	S	S	*	*			trans	-107.7	0	160.3	-176.8	0	0	0	0	110.4

Retrieved 65 of 65 residues in 35.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).