A0A087WV94_HUMAN Loading...

Atos homolog A

AlphaFold DB , UniProt , Accession A0A087WV94, Species HUMAN (Homo sapiens, Human), Gene ATOSA, Length 30 aa.

						>A0A087WV94_HUMAN|A0A087WV94|ATOSA
MKPDRETRSHSVAQPGLKLMSSSNLPVSAS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	53.3	Low	62.3	Low	244 Å²	244	157.5 Å²	157.5	100%	1.202	79%	0.788	S	S	*	*				0	100.8	0	-149.9	142.8	67.3	0	0	106.7
2	K	56.3	Low	62.8	Low	201 Å²	201	153.7 Å²	153.7	87%	0.874	78%	0.778	S	S	*	*			trans	-89	127.7	179.1	-71.1	174.9	178.1	162.2	0	106.5	D4	K2-D4 VanDerWaalsContact O-N 3.1Å; K2-D4 PolarHBondContact O-N 2.94Å
3	P	62.7	Low	63	Low	124 Å²	124	148.8 Å²	148.8	81%	0.805	78%	0.776	S	S	*	*			trans	-68.5	113.6	175.4	27.9	-29.6	0	0	0	107	R5	P3-R5 PolarHBondContact O-N 3.07Å
4	D	58.2	Low	63.7	Low	139 Å²	139	147.1 Å²	147.1	74%	0.743	76%	0.762	S	S	*	*			trans	-58.1	120.1	165.3	-174.8	-106.5	0	0	0	106.6	K2 E6	K2-D4 VanDerWaalsContact O-N 3.1Å; K2-D4 PolarHBondContact O-N 2.94Å; D4-E6 PolarHBondContact O-N 2.85Å
5	R	66.1	Low	63.7	Low	218 Å²	218	147.3 Å²	147.3	82%	0.823	78%	0.776	S	S	*	*			trans	-76.6	77.9	-173.9	-173.3	-178.4	175.6	154.9	-0.2	107.6	P3 T7	P3-R5 PolarHBondContact O-N 3.07Å; R5-T7 PolarHBondContact O-N 2.75Å
6	E	63.7	Low	63.7	Low	164 Å²	164	142.5 Å²	142.5	77%	0.766	77%	0.773	S	S	*	*			trans	-61.7	92.1	165	-67.1	-162.1	99.7	0	0	107.2	D4 R8	D4-E6 PolarHBondContact O-N 2.85Å; E6-R8 PolarHBondContact O-N 2.91Å
7	T	62.6	Low	63.9	Low	97 Å²	97	140.8 Å²	140.8	60%	0.595	76%	0.763	S	S	*	*			trans	-72.2	78.8	171.4	-58.1	0	0	0	0	106	R5 S9	R5-T7 PolarHBondContact O-N 2.75Å; T7-S9 VanDerWaalsContact C-N 3.3Å; T7-S9 PolarHBondContact O-N 3.28Å
8	R	61.2	Low	63.8	Low	191 Å²	191	143.6 Å²	143.6	72%	0.721	77%	0.767	S	S	*	*			trans	-62.9	97.5	171.3	179.6	175.7	-84.4	174.2	-5.9	106.5	E6 H10	E6-R8 PolarHBondContact O-N 2.91Å; R8-H10 WeakPolarHBondContact CD-CE1 3.3Å; R8-H10 PolarHBondContact O-CD2 2.93Å; R8-H10 PolarHBondContact O-N 2.89Å
9	S	67.1	Low	64	Low	103 Å²	103	143.8 Å²	143.8	72%	0.72	77%	0.767	S	S	*	*			trans	-67.3	96.4	176.7	-65.5	0	0	0	0	109	T7 S11	T7-S9 VanDerWaalsContact C-N 3.3Å; T7-S9 PolarHBondContact O-N 3.28Å; S9-S11 PolarHBondContact O-N 2.91Å
10	H	65.9	Low	63.8	Low	147 Å²	147	145.4 Å²	145.4	68%	0.681	77%	0.772	S	S	*	*			trans	-76.1	76.2	173.5	-65	-80.4	0	0	0	109.2	R8 V12	R8-H10 WeakPolarHBondContact CD-CE1 3.3Å; R8-H10 PolarHBondContact O-CD2 2.93Å; R8-H10 PolarHBondContact O-N 2.89Å; H10-V12 PolarHBondContact O-N 2.74Å
11	S	67.7	Low	63.7	Low	105 Å²	105	142.9 Å²	142.9	73%	0.734	77%	0.766	S	S	*	*			trans	-74.6	94.8	172.7	-170.3	0	0	0	0	108.9	S9 A13	S9-S11 PolarHBondContact O-N 2.91Å; S11-A13 PolarHBondContact O-N 3.45Å
12	V	68.4	Low	64.4	Low	111 Å²	111	134.9 Å²	134.9	67%	0.673	73%	0.734	S	S	*	*			trans	-77.7	103.5	169.7	-179.8	0	0	0	0	106.8	H10 Q14	H10-V12 PolarHBondContact O-N 2.74Å; V12-Q14 VanDerWaalsContact C-N 3.34Å; V12-Q14 HydrophobicContact CG1-CG 4.36Å; V12-Q14 PolarHBondContact O-N 3.04Å
13	A	65.9	Low	64.8	Low	91 Å²	91	129.7 Å²	129.7	75%	0.752	72%	0.723	S	S	*	*			trans	-66.7	96.6	170.4	0	0	0	0	0	108.4	S11	S11-A13 PolarHBondContact O-N 3.45Å
14	Q	72.6	Confident	65	Low	125 Å²	125	131.1 Å²	131.1	58%	0.584	72%	0.724	S	S	*	*			trans	-72.1	130.6	173.1	-68	-167.7	-37.7	0	0	108.9	V12 G16 L17	V12-Q14 VanDerWaalsContact C-N 3.34Å; V12-Q14 HydrophobicContact CG1-CG 4.36Å; V12-Q14 PolarHBondContact O-N 3.04Å; Q14-G16 PolarHBondContact O-N 2.95Å; Q14-L17 PolarHBondContact O-N 3.2Å; Q14-L17 HydrophobicContact CB-CB 4.07Å
15	P	63.2	Low	65.4	Low	149 Å²	149	131 Å²	131	97%	0.968	72%	0.722	S	S	*	*	T	Hydrogen-bonded Turn	trans	-67.2	6.6	-173.5	23.9	-32.5	0	0	0	115.7
16	G	64.4	Low	65.4	Low	71 Å²	71	126.2 Å²	126.2	73%	0.732	72%	0.72	S	S	*	*	T	Hydrogen-bonded Turn	trans	-121.7	-7.1	170.1	0	0	0	0	0	114.2	Q14 K18	Q14-G16 PolarHBondContact O-N 2.95Å; G16-K18 VanDerWaalsContact C-N 3.35Å; G16-K18 PolarHBondContact O-N 3.25Å
17	L	67.1	Low	65.5	Low	113 Å²	113	124.8 Å²	124.8	59%	0.592	72%	0.722	S	S	*	*			trans	-85	83.5	177.8	-168.8	67.1	0	0	0	107.8	Q14 L19	Q14-L17 PolarHBondContact O-N 3.2Å; Q14-L17 HydrophobicContact CB-CB 4.07Å; L17-L19 PolarHBondContact O-N 3.01Å
18	K	62.2	Low	65.6	Low	192 Å²	192	125.9 Å²	125.9	84%	0.835	73%	0.733	S	S	*	*			trans	-56.9	107.1	164.7	-83.5	-175	178.7	-171.1	0	106.5	G16 M20	G16-K18 VanDerWaalsContact C-N 3.35Å; G16-K18 PolarHBondContact O-N 3.25Å; K18-M20 PolarHBondContact O-N 2.93Å
19	L	67.4	Low	65.9	Low	147 Å²	147	121 Å²	121	77%	0.77	73%	0.734	S	S	*	*			trans	-61.5	88.9	171.6	-149.2	96.2	0	0	0	105.9	L17 S21	L17-L19 PolarHBondContact O-N 3.01Å; L19-S21 PolarHBondContact O-N 3.02Å
20	M	60.4	Low	65.7	Low	175 Å²	175	125 Å²	125	86%	0.862	76%	0.762	S	S	*	*			trans	-57.8	112	167.8	-82.8	-175.1	64.1	0	0	104.5	K18 S22	K18-M20 PolarHBondContact O-N 2.93Å; M20-S22 PolarHBondContact O-N 2.87Å
21	S	61	Low	65.7	Low	94 Å²	94	123.9 Å²	123.9	66%	0.657	77%	0.766	S	S	*	*			trans	-42.4	113.6	178.4	175.2	0	0	0	0	107.7	L19 S23	L19-S21 PolarHBondContact O-N 3.02Å; S21-S23 PolarHBondContact O-N 2.83Å; S21-S23 PolarHBondContact OG-OG 2.78Å; S21-S23 PolarHBondContact O-OG 2.98Å
22	S	67.6	Low	65.5	Low	76 Å²	76	124.9 Å²	124.9	53%	0.531	77%	0.768	S	S	.	*			trans	-70.3	76	179.3	173	0	0	0	0	107.9	M20 N24	M20-S22 PolarHBondContact O-N 2.87Å; S22-N24 PolarHBondContact O-N 2.79Å
23	S	66.3	Low	65.4	Low	92 Å²	92	125.7 Å²	125.7	64%	0.643	77%	0.773	S	S	*	*	T	Hydrogen-bonded Turn	trans	-81.1	10.9	-176.7	-64	0	0	0	0	113.3	S21	S21-S23 PolarHBondContact O-N 2.83Å; S21-S23 PolarHBondContact OG-OG 2.78Å; S21-S23 PolarHBondContact O-OG 2.98Å
24	N	65.5	Low	65.4	Low	153 Å²	153	127.7 Å²	127.7	82%	0.818	77%	0.774	S	S	*	*	T	Hydrogen-bonded Turn	trans	-140	60.6	171.3	-65.9	-58.8	0	0	0	109.2	S22	S22-N24 PolarHBondContact O-N 2.79Å
25	L	66.8	Low	64.9	Low	136 Å²	136	127.9 Å²	127.9	71%	0.712	79%	0.786	S	S	*	*	P	Polyproline II helix	trans	-62.3	125.5	159.9	-69.8	167.9	0	0	0	106.1	V27	L25-V27 PolarHBondContact O-N 2.82Å
26	P	65.8	Low	65	Low	118 Å²	118	126.5 Å²	126.5	77%	0.766	77%	0.774	S	S	*	*	P	Polyproline II helix	trans	-55.5	121.7	169.7	24.2	-30.8	0	0	0	105.8	S28	P26-S28 PolarHBondContact O-N 3.1Å
27	V	66.9	Low	65.1	Low	135 Å²	135	130.4 Å²	130.4	82%	0.818	78%	0.777	S	S	*	*	P	Polyproline II helix	trans	-54.5	119.8	173.2	92.6	0	0	0	0	104.9	L25 A29	L25-V27 PolarHBondContact O-N 2.82Å; V27-A29 VanDerWaalsContact C-N 3.29Å; V27-A29 PolarHBondContact O-N 3.31Å
28	S	65.1	Low	64.9	Low	119 Å²	119	131.8 Å²	131.8	83%	0.832	79%	0.791	S	S	*	*			trans	-63.7	100.3	177.2	-173.5	0	0	0	0	105.8	P26 S30	P26-S28 PolarHBondContact O-N 3.1Å; S28-S30 PolarHBondContact O-N 3.23Å
29	A	66.4	Low	65.1	Low	89 Å²	89	126.8 Å²	126.8	74%	0.736	79%	0.788	S	S	*	*			trans	-65.4	123.1	173.5	0	0	0	0	0	107.3	V27	V27-A29 VanDerWaalsContact C-N 3.29Å; V27-A29 PolarHBondContact O-N 3.31Å
30	S	62.5	Low	64.9	Low	187 Å²	187	124.9 Å²	124.9	100%	1.308	79%	0.789	S	S	*	*			trans	-81	0	172.7	-176.7	0	0	0	0	111.2	S28	S28-S30 PolarHBondContact O-N 3.23Å

Retrieved 30 of 30 residues in 59.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).