A0A087WVE4_HUMAN Loading...

Sorting nexin 9

AlphaFold DB , UniProt , Accession A0A087WVE4, Species HUMAN (Homo sapiens, Human), Gene SNX9, Length 63 aa.

						>A0A087WVE4_HUMAN|A0A087WVE4|SNX9
MYDFAAEPGNNELTVNEGEIITITNPDVGGGWLEGRNIKGERGLVPTDYVEILPSDGKDQFSC
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	51.7	Low	64.1	Low	151 Å²	151	103.4 Å²	103.4	74%	0.744	59%	0.586	S	S	*	*				0	154	0	-78.3	125.1	125.5	0	0	108	E17	M1-E17 VanDerWaalsContact CA-OE2 3.26Å; M1-E17 WeakPolarHBondContact CA-OE2 3.48Å; M1-E17 HydrophobicContact CB-CB 4.21Å; M1-E17 HydrophobicContact CB-CG 3.93Å; M1-E17 WeakPolarHBondContact CB-OE2 3.45Å; M1-E17 PolarHBondContact N-OE2 3.07Å
2	Y	52.1	Low	65.6	Low	187 Å²	187	98.7 Å²	98.7	73%	0.733	56%	0.555	S	S	*	*			trans	-104.6	149.2	-173.5	-66.8	-87.9	0	0	0	110.2	F4	Y2-F4 PolarHBondContact O-N 3.38Å
3	D	60.4	Low	66.9	Low	121 Å²	121	91.2 Å²	91.2	65%	0.647	51%	0.513	S	S	*	.			trans	-67.1	122.5	171.7	-52.4	-75	0	0	0	109.7
4	F	68.8	Low	68	Low	32 Å²	32	88.5 Å²	88.5	14%	0.14	50%	0.5	C	S	.	.	B	Isolated β-bridge	trans	-101.9	107.1	172	179.5	-96.2	0	0	0	108	Y2 E12 L13 T14 V15 W32 P46 Y49	Y2-F4 PolarHBondContact O-N 3.38Å; F4-E12 HydrophobicContact CE1-CB 4.2Å; F4-E12 HydrophobicContact CZ-CB 4.4Å; F4-E12 HydrophobicContact CZ-CG 4.46Å; F4-L13 VanDerWaalsContact CD1-O 3.25Å; F4-L13 WeakPolarHBondContact CD1-O 3.26Å; F4-L13 WeakPolarHBondContact CE1-O 3.33Å; F4-T14 CarbonylContact O-C 3.54Å; F4-T14 VanDerWaalsContact O-CA 3.22Å; F4-T14 WeakPolarHBondContact O-CA 3.36Å; F4-T14 WeakPolarHBondContact O-CG2 3.22Å; F4-V15 HydrophobicContact CB-CG2 3.68Å; F4-V15 HydrophobicContact CD1-CG2 4.2Å; F4-V15 HydrophobicContact CG-CG2 4.34Å; F4-V15 PolarHBondContact N-O 3.15Å; F4-V15 PolarHBondContact O-N 2.65Å; F4-W32 HydrophobicContact CZ-CZ3 4.38Å; F4-P46 HydrophobicContact CE2-CG 4.37Å; F4-Y49 HydrophobicContact CB-CD1 4.21Å
5	A	70.4	Confident	68.6	Low	77 Å²	77	83.3 Å²	83.3	64%	0.636	47%	0.471	S	S	*	.			trans	-91	114.6	175.3	0	0	0	0	0	109.2
6	A	68.7	Low	69.3	Low	21 Å²	21	83.1 Å²	83.1	17%	0.174	47%	0.468	C	S	.	.			trans	-69.4	141.2	174.4	0	0	0	0	0	111.7	E12 L13 T14	A6-E12 HydrophobicContact CB-CB 3.44Å; A6-E12 VanDerWaalsContact CB-CB 3.44Å; A6-E12 WeakPolarHBondContact CB-O 3.27Å; A6-L13 VanDerWaalsContact CB-C 3.46Å; A6-T14 VanDerWaalsContact CB-N 3.28Å; A6-T14 WeakPolarHBondContact CB-OG1 3.49Å; A6-T14 PolarHBondContact N-OG1 3.23Å
7	E	67.8	Low	69.7	Low	124 Å²	124	85.5 Å²	85.5	58%	0.579	48%	0.475	S	S	*	.			trans	-80.1	131.8	172.2	-65.4	-166.1	98.8	0	0	110.8	G9 N10	E7-G9 PolarHBondContact O-N 3.03Å; E7-N10 HydrophobicContact CB-CB 4.46Å; E7-N10 PolarHBondContact O-N 2.94Å; E7-N10 PolarHBondContact OE2-ND2 3.26Å
8	P	59.3	Low	70	Confident	135 Å²	135	84.9 Å²	84.9	88%	0.877	49%	0.492	S	S	*	.	T	Hydrogen-bonded Turn	trans	-63	114.7	177.9	24	-31.1	0	0	0	110.4
9	G	62.1	Low	70.6	Confident	74 Å²	74	83.5 Å²	83.5	76%	0.763	48%	0.48	S	S	*	.	T	Hydrogen-bonded Turn	trans	109.9	-7.5	176.3	0	0	0	0	0	115.7	E7	E7-G9 PolarHBondContact O-N 3.03Å
10	N	68.1	Low	71.3	Confident	90 Å²	90	85.9 Å²	85.9	48%	0.481	49%	0.49	S	S	.	.	T	Hydrogen-bonded Turn	trans	-95.9	7.9	179.4	-78.1	-30.8	0	0	0	114.3	E7 E12	E7-N10 HydrophobicContact CB-CB 4.46Å; E7-N10 PolarHBondContact O-N 2.94Å; E7-N10 PolarHBondContact OE2-ND2 3.26Å; N10-E12 HydrophobicContact CB-CG 4.09Å; N10-E12 WeakPolarHBondContact CB-OE2 3.47Å; N10-E12 PolarHBondContact O-N 3.4Å
11	N	75.4	Confident	72	Confident	125 Å²	125	83 Å²	83	67%	0.668	47%	0.472	S	S	*	.	T	Hydrogen-bonded Turn	trans	58.7	23.7	-172.4	-52	-67.2	0	0	0	113.5	G43 L44	N11-G43 CarbonylContact O-C 3.36Å; N11-G43 WeakPolarHBondContact O-CA 3.32Å; N11-L44 PolarHBondContact O-N 2.77Å
12	E	82.8	Confident	73.7	Confident	47 Å²	47	80.5 Å²	80.5	22%	0.22	47%	0.466	C	S	.	.	B	Isolated β-bridge	trans	-85.4	151.4	175.8	-66.9	169.6	104.6	0	0	110.2	F4 A6 N10	F4-E12 HydrophobicContact CE1-CB 4.2Å; F4-E12 HydrophobicContact CZ-CB 4.4Å; F4-E12 HydrophobicContact CZ-CG 4.46Å; A6-E12 HydrophobicContact CB-CB 3.44Å; A6-E12 VanDerWaalsContact CB-CB 3.44Å; A6-E12 WeakPolarHBondContact CB-O 3.27Å; N10-E12 HydrophobicContact CB-CG 4.09Å; N10-E12 WeakPolarHBondContact CB-OE2 3.47Å; N10-E12 PolarHBondContact O-N 3.4Å
13	L	82.3	Confident	75.4	Confident	2 Å²	2	74.5 Å²	74.5	1%	0.01	45%	0.446	C	S	.	.			trans	-109.6	124.3	175.6	-177.4	70.4	0	0	0	111	F4 A6 V15 I21 N37 E41 L44 V45	F4-L13 VanDerWaalsContact CD1-O 3.25Å; F4-L13 WeakPolarHBondContact CD1-O 3.26Å; F4-L13 WeakPolarHBondContact CE1-O 3.33Å; A6-L13 VanDerWaalsContact CB-C 3.46Å; L13-V15 HydrophobicContact CD2-CG1 4.2Å; L13-V15 HydrophobicContact CG-CG1 4.27Å; L13-V15 PolarHBondContact O-N 3.12Å; L13-I21 HydrophobicContact CD2-CB 4.44Å; L13-I21 HydrophobicContact CD2-CD1 4.29Å; L13-I21 HydrophobicContact CD2-CG2 4.05Å; L13-N37 HydrophobicContact CD1-CB 4.09Å; L13-N37 HydrophobicContact CD2-CB 4.3Å; L13-E41 HydrophobicContact CD1-CB 3.84Å; L13-E41 VanDerWaalsContact CD1-O 3.32Å; L13-E41 WeakPolarHBondContact CD1-O 3.25Å; L13-L44 PolarHBondContact N-O 3.03Å; L13-V45 HydrophobicContact CB-CG2 3.69Å; L13-V45 HydrophobicContact CD2-CG2 3.96Å; L13-V45 HydrophobicContact CG-CG2 4.29Å
14	T	82.3	Confident	76.7	Confident	53 Å²	53	72 Å²	72	33%	0.325	44%	0.435	S	S	.	.			trans	-66.1	123.6	173	-61.9	0	0	0	0	109.2	F4 A6	F4-T14 CarbonylContact O-C 3.54Å; F4-T14 VanDerWaalsContact O-CA 3.22Å; F4-T14 WeakPolarHBondContact O-CA 3.36Å; F4-T14 WeakPolarHBondContact O-CG2 3.22Å; A6-T14 VanDerWaalsContact CB-N 3.28Å; A6-T14 WeakPolarHBondContact CB-OG1 3.49Å; A6-T14 PolarHBondContact N-OG1 3.23Å
15	V	77	Confident	77.5	Confident	11 Å²	11	73.5 Å²	73.5	7%	0.067	44%	0.444	C	S	.	.	B	Isolated β-bridge	trans	-126.1	132.2	176.5	-63	0	0	0	0	110.1	F4 L13 I21 V45	F4-V15 HydrophobicContact CB-CG2 3.68Å; F4-V15 HydrophobicContact CD1-CG2 4.2Å; F4-V15 HydrophobicContact CG-CG2 4.34Å; F4-V15 PolarHBondContact N-O 3.15Å; F4-V15 PolarHBondContact O-N 2.65Å; L13-V15 HydrophobicContact CD2-CG1 4.2Å; L13-V15 HydrophobicContact CG-CG1 4.27Å; L13-V15 PolarHBondContact O-N 3.12Å; V15-I21 HydrophobicContact CG1-CD1 4.08Å; V15-I21 HydrophobicContact CG1-CG2 3.87Å; V15-V45 HydrophobicContact CG1-CG1 4.13Å; V15-V45 HydrophobicContact CG1-CG2 3.84Å; V15-V45 HydrophobicContact CG2-CG1 3.92Å
16	N	79.1	Confident	78.1	Confident	80 Å²	80	73.1 Å²	73.1	43%	0.428	44%	0.436	S	S	.	.			trans	-101.3	154.8	176.8	-57.4	-89.9	0	0	0	110.1	G18 E19	N16-G18 PolarHBondContact O-N 3.35Å; N16-E19 HydrophobicContact CB-CB 4.3Å; N16-E19 PolarHBondContact N-OE1 3.48Å; N16-E19 PolarHBondContact ND2-OE1 2.86Å; N16-E19 VanDerWaalsContact O-CB 3.27Å; N16-E19 WeakPolarHBondContact O-CB 3.34Å; N16-E19 PolarHBondContact O-N 2.97Å
17	E	76.1	Confident	78.7	Confident	123 Å²	123	78.8 Å²	78.8	58%	0.575	46%	0.463	S	S	*	.	T	Hydrogen-bonded Turn	trans	-56.9	126.6	172.3	177.5	178.3	114.7	0	0	110.4	M1 E19	M1-E17 VanDerWaalsContact CA-OE2 3.26Å; M1-E17 WeakPolarHBondContact CA-OE2 3.48Å; M1-E17 HydrophobicContact CB-CB 4.21Å; M1-E17 HydrophobicContact CB-CG 3.93Å; M1-E17 WeakPolarHBondContact CB-OE2 3.45Å; M1-E17 PolarHBondContact N-OE2 3.07Å; E17-E19 VanDerWaalsContact C-N 3.32Å
18	G	76.4	Confident	79.4	Confident	76 Å²	76	75.7 Å²	75.7	78%	0.784	45%	0.452	S	S	*	.	T	Hydrogen-bonded Turn	trans	82.3	3.3	-179	0	0	0	0	0	115	N16	N16-G18 PolarHBondContact O-N 3.35Å
19	E	81.8	Confident	80.3	Confident	58 Å²	58	71.4 Å²	71.4	27%	0.271	43%	0.433	S	S	.	.			trans	-78.9	128.9	173.8	-171.9	159.3	48	0	0	111.5	N16 E17 I21	N16-E19 HydrophobicContact CB-CB 4.3Å; N16-E19 PolarHBondContact N-OE1 3.48Å; N16-E19 PolarHBondContact ND2-OE1 2.86Å; N16-E19 VanDerWaalsContact O-CB 3.27Å; N16-E19 WeakPolarHBondContact O-CB 3.34Å; N16-E19 PolarHBondContact O-N 2.97Å; E17-E19 VanDerWaalsContact C-N 3.32Å; E19-I21 HydrophobicContact CG-CG2 4.41Å
20	I	83.9	Confident	81.2	Confident	131 Å²	131	71.6 Å²	71.6	67%	0.672	44%	0.435	S	S	*	.			trans	-88.4	116.4	173.8	-57.4	-75.1	0	0	0	108.6
21	I	85.3	Confident	82.1	Confident	25 Å²	25	69 Å²	69	13%	0.128	43%	0.43	C	S	.	.			trans	-105.3	148.4	170.9	67.2	173.6	0	0	0	110.7	L13 V15 E19 L33 N37 V45 V50	L13-I21 HydrophobicContact CD2-CB 4.44Å; L13-I21 HydrophobicContact CD2-CD1 4.29Å; L13-I21 HydrophobicContact CD2-CG2 4.05Å; V15-I21 HydrophobicContact CG1-CD1 4.08Å; V15-I21 HydrophobicContact CG1-CG2 3.87Å; E19-I21 HydrophobicContact CG-CG2 4.41Å; I21-L33 HydrophobicContact CD1-CD1 4.43Å; I21-N37 HydrophobicContact CG2-CB 4.28Å; I21-V45 HydrophobicContact CD1-CB 4.37Å; I21-V45 HydrophobicContact CD1-CG2 3.85Å; I21-V50 HydrophobicContact CD1-CG1 3.84Å
22	T	88.3	Confident	82.6	Confident	98 Å²	98	67.5 Å²	67.5	60%	0.601	42%	0.415	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-89.9	114.2	173.7	-55.5	0	0	0	0	109.1	T24 G35 R36	T22-T24 PolarHBondContact O-N 2.99Å; T22-T24 PolarHBondContact O-OG1 3.01Å; T22-G35 CarbonylContact O-C 3.47Å; T22-G35 WeakPolarHBondContact O-CA 3.07Å; T22-R36 PolarHBondContact N-O 3.02Å; T22-R36 PolarHBondContact O-N 3.49Å
23	I	86.7	Confident	82.9	Confident	62 Å²	62	65.3 Å²	65.3	32%	0.318	40%	0.404	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-66.2	118.5	174.9	-56.1	177	0	0	0	108.2	P26 L33 I52	I23-P26 HydrophobicContact CG2-CB 3.96Å; I23-P26 HydrophobicContact CG2-CG 4.35Å; I23-L33 HydrophobicContact CD1-CD2 4.31Å; I23-L33 HydrophobicContact CG1-CD1 4.31Å; I23-I52 HydrophobicContact CD1-CD1 4.46Å; I23-I52 HydrophobicContact CD1-CG1 3.91Å; I23-I52 HydrophobicContact CD1-CG2 4.43Å
24	T	88.1	Confident	83.2	Confident	68 Å²	68	68.2 Å²	68.2	42%	0.417	42%	0.418	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-97.4	-35.6	178.6	-46.2	0	0	0	0	110.5	T22 E34	T22-T24 PolarHBondContact O-N 2.99Å; T22-T24 PolarHBondContact O-OG1 3.01Å; T24-E34 PolarHBondContact N-O 2.76Å
25	N	86.7	Confident	83.5	Confident	63 Å²	63	65.7 Å²	65.7	34%	0.337	40%	0.402	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-144.9	104.8	174.8	-174.1	2.9	0	0	0	111.2	D27 V28 L33 E34	N25-D27 VanDerWaalsContact C-N 3.31Å; N25-D27 PolarHBondContact OD1-N 3.07Å; N25-V28 HydrophobicContact CB-CG2 4.33Å; N25-L33 CarbonylContact O-C 3.58Å; N25-L33 WeakPolarHBondContact O-CA 3.47Å; N25-E34 HydrophobicContact CB-CB 3.89Å; N25-E34 PolarHBondContact N-O 3.4Å; N25-E34 PolarHBondContact O-N 2.89Å
26	P	82.9	Confident	84	Confident	70 Å²	70	70.3 Å²	70.3	46%	0.455	42%	0.419	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-76.8	-14.1	175.8	29.4	-30.9	0	0	0	114	I23	I23-P26 HydrophobicContact CG2-CB 3.96Å; I23-P26 HydrophobicContact CG2-CG 4.35Å
27	D	81.3	Confident	84.4	Confident	140 Å²	140	66.9 Å²	66.9	75%	0.749	40%	0.4	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-106.5	43.2	-171.6	-68.9	-80.3	0	0	0	112.2	N25 G29	N25-D27 VanDerWaalsContact C-N 3.31Å; N25-D27 PolarHBondContact OD1-N 3.07Å; D27-G29 PolarHBondContact O-N 3.22Å
28	V	81.9	Confident	84.7	Confident	58 Å²	58	68.2 Å²	68.2	35%	0.352	41%	0.41	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-70.7	-26.6	173.4	-174.8	0	0	0	0	110.9	N25 W32 E34 L44	N25-V28 HydrophobicContact CB-CG2 4.33Å; V28-W32 HydrophobicContact CB-CB 4.37Å; V28-W32 WeakPolarHBondContact CB-O 3.44Å; V28-W32 HydrophobicContact CG1-CB 4.46Å; V28-E34 HydrophobicContact CG2-CB 3.88Å; V28-L44 HydrophobicContact CB-CD2 4.24Å; V28-L44 HydrophobicContact CG1-CD1 4.48Å; V28-L44 HydrophobicContact CG1-CD2 3.68Å; V28-L44 HydrophobicContact CG2-CD2 3.84Å
29	G	78.4	Confident	85	Confident	45 Å²	45	72.1 Å²	72.1	46%	0.464	41%	0.405	S	S	.	.	E	Extended strand (participates in β ladder)	trans	92.6	157.7	178.4	0	0	0	0	0	112.9	D27 G31 W32	D27-G29 PolarHBondContact O-N 3.22Å; G29-G31 VanDerWaalsContact C-N 3.32Å; G29-G31 PolarHBondContact O-N 2.93Å; G29-W32 PolarHBondContact O-N 3.31Å
30	G	81.6	Confident	85.1	Confident	79 Å²	79	70.6 Å²	70.6	81%	0.814	41%	0.405	S	S	*	.	T	Hydrogen-bonded Turn	trans	69.4	22	176.7	0	0	0	0	0	115.5	W32	G30-W32 VanDerWaalsContact O-CD1 3.32Å
31	G	85.2	Confident	85.1	Confident	36 Å²	36	69.2 Å²	69.2	37%	0.371	40%	0.396	S	S	.	.	T	Hydrogen-bonded Turn	trans	83	19	-178.4	0	0	0	0	0	114.1	G29 T47	G29-G31 VanDerWaalsContact C-N 3.32Å; G29-G31 PolarHBondContact O-N 2.93Å; G31-T47 PolarHBondContact O-N 2.81Å; G31-T47 PolarHBondContact O-OG1 3.42Å
32	W	87	Confident	85.1	Confident	93 Å²	93	74.9 Å²	74.9	35%	0.352	42%	0.416	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.9	145.3	176.2	-63.8	85.1	0	0	0	110.7	F4 V28 G29 G30 L44 P46	F4-W32 HydrophobicContact CZ-CZ3 4.38Å; V28-W32 HydrophobicContact CB-CB 4.37Å; V28-W32 WeakPolarHBondContact CB-O 3.44Å; V28-W32 HydrophobicContact CG1-CB 4.46Å; G29-W32 PolarHBondContact O-N 3.31Å; G30-W32 VanDerWaalsContact O-CD1 3.32Å; W32-L44 HydrophobicContact CE3-CB 3.8Å; W32-L44 HydrophobicContact CZ3-CB 4.32Å; W32-P46 HydrophobicContact CE3-CB 4.25Å; W32-P46 HydrophobicContact CH2-CB 4.43Å; W32-P46 HydrophobicContact CZ3-CB 4.2Å; W32-P46 HydrophobicContact CZ3-CG 4.2Å
33	L	88.2	Confident	85	Confident	1 Å²	1	70.3 Å²	70.3	1%	0.005	39%	0.388	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.7	146.9	169.6	58.3	84.4	0	0	0	110.2	I21 I23 N25 L44 V45 T47 V50	I21-L33 HydrophobicContact CD1-CD1 4.43Å; I23-L33 HydrophobicContact CD1-CD2 4.31Å; I23-L33 HydrophobicContact CG1-CD1 4.31Å; N25-L33 CarbonylContact O-C 3.58Å; N25-L33 WeakPolarHBondContact O-CA 3.47Å; L33-L44 CarbonylContact O-C 3.53Å; L33-L44 WeakPolarHBondContact O-CA 3.11Å; L33-V45 HydrophobicContact CD1-CB 4.01Å; L33-V45 WeakPolarHBondContact CG-O 3.38Å; L33-V45 PolarHBondContact N-O 2.99Å; L33-V45 PolarHBondContact O-N 3.06Å; L33-T47 HydrophobicContact CD2-CG2 3.67Å; L33-T47 HydrophobicContact CG-CG2 4.26Å; L33-V50 HydrophobicContact CD1-CG2 4Å; L33-V50 HydrophobicContact CD2-CG2 3.29Å; L33-V50 HydrophobicContact CG-CG2 3.94Å
34	E	88.8	Confident	85.1	Confident	62 Å²	62	69.3 Å²	69.3	29%	0.29	38%	0.383	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.8	119.2	172.7	-164.3	-179	85.2	0	0	109.1	T24 N25 V28 G43 L44	T24-E34 PolarHBondContact N-O 2.76Å; N25-E34 HydrophobicContact CB-CB 3.89Å; N25-E34 PolarHBondContact N-O 3.4Å; N25-E34 PolarHBondContact O-N 2.89Å; V28-E34 HydrophobicContact CG2-CB 3.88Å; E34-G43 WeakPolarHBondContact CA-O 3.4Å; E34-L44 HydrophobicContact CB-CD2 4.11Å; E34-L44 HydrophobicContact CG-CD2 4.39Å
35	G	88.6	Confident	85	Confident	0 Å²	0	66 Å²	66	0%	0	36%	0.363	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.2	166.2	175.8	0	0	0	0	0	112.1	T22 R42 G43	T22-G35 CarbonylContact O-C 3.47Å; T22-G35 WeakPolarHBondContact O-CA 3.07Å; G35-R42 VanDerWaalsContact O-CA 3.25Å; G35-R42 WeakPolarHBondContact O-CA 3.32Å; G35-G43 PolarHBondContact N-O 2.89Å; G35-G43 PolarHBondContact O-N 3.36Å
36	R	88.5	Confident	84.9	Confident	108 Å²	108	63.8 Å²	63.8	41%	0.408	35%	0.352	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.1	126.7	168.2	-171.4	177.5	-171.7	-148.8	-9.2	109.9	T22 G40 E41 R42	T22-R36 PolarHBondContact N-O 3.02Å; T22-R36 PolarHBondContact O-N 3.49Å; R36-G40 PolarHBondContact NE-O 3.02Å; R36-E41 CarbonylContact C-O 3.56Å; R36-E41 VanDerWaalsContact CA-O 3.25Å; R36-E41 WeakPolarHBondContact CA-O 3.25Å; R36-E41 WeakPolarHBondContact CG-O 3.34Å; R36-R42 HydrophobicContact CB-CG 3.91Å; R36-R42 HydrophobicContact CG-CG 3.69Å
37	N	86.2	Confident	84.9	Confident	8 Å²	8	63.1 Å²	63.1	4%	0.043	35%	0.347	C	S	.	.			trans	-81.6	173.1	175.3	72.3	9.6	0	0	0	111.8	L13 I21 K39 G40 E41	L13-N37 HydrophobicContact CD1-CB 4.09Å; L13-N37 HydrophobicContact CD2-CB 4.3Å; I21-N37 HydrophobicContact CG2-CB 4.28Å; N37-K39 PolarHBondContact O-N 2.95Å; N37-K39 WeakPolarHBondContact OD1-CA 3.37Å; N37-K39 WeakPolarHBondContact OD1-CB 2.99Å; N37-K39 PolarHBondContact OD1-N 2.83Å; N37-K39 VanDerWaalsContact OD1-N 3.08Å; N37-G40 PolarHBondContact O-N 3.29Å; N37-G40 PolarHBondContact OD1-N 3.07Å; N37-E41 PolarHBondContact N-O 2.99Å; N37-E41 PolarHBondContact ND2-OE2 2.71Å; N37-E41 WeakPolarHBondContact OD1-CB 3.46Å; N37-E41 PolarHBondContact OD1-N 3.35Å; N37-E41 PolarHBondContact OD1-O 2.87Å
38	I	83	Confident	85	Confident	151 Å²	151	63.6 Å²	63.6	77%	0.774	35%	0.349	S	S	*	.	T	Hydrogen-bonded Turn	trans	-66.1	-25	177.8	-166.6	162.3	0	0	0	113.3	G40	I38-G40 PolarHBondContact O-N 2.95Å
39	K	82.9	Confident	84.8	Confident	159 Å²	159	66 Å²	66	69%	0.691	35%	0.353	S	S	*	.	T	Hydrogen-bonded Turn	trans	-69.5	-11.9	173.4	-69.1	159.6	131.8	-83.4	0	112.2	N37 E41	N37-K39 PolarHBondContact O-N 2.95Å; N37-K39 WeakPolarHBondContact OD1-CA 3.37Å; N37-K39 WeakPolarHBondContact OD1-CB 2.99Å; N37-K39 PolarHBondContact OD1-N 2.83Å; N37-K39 VanDerWaalsContact OD1-N 3.08Å; K39-E41 HydrophobicContact CB-CG 4.35Å
40	G	83.2	Confident	84.7	Confident	26 Å²	26	65.4 Å²	65.4	27%	0.268	34%	0.34	S	S	.	.	S	Bend	trans	90.3	1.6	178.7	0	0	0	0	0	114	R36 N37 I38	R36-G40 PolarHBondContact NE-O 3.02Å; N37-G40 PolarHBondContact O-N 3.29Å; N37-G40 PolarHBondContact OD1-N 3.07Å; I38-G40 PolarHBondContact O-N 2.95Å
41	E	83.4	Confident	84.6	Confident	102 Å²	102	68.4 Å²	68.4	48%	0.477	33%	0.332	S	S	.	.			trans	-73.3	143	175.3	-58.3	168	117.5	0	0	109.3	L13 R36 N37 K39	L13-E41 HydrophobicContact CD1-CB 3.84Å; L13-E41 VanDerWaalsContact CD1-O 3.32Å; L13-E41 WeakPolarHBondContact CD1-O 3.25Å; R36-E41 CarbonylContact C-O 3.56Å; R36-E41 VanDerWaalsContact CA-O 3.25Å; R36-E41 WeakPolarHBondContact CA-O 3.25Å; R36-E41 WeakPolarHBondContact CG-O 3.34Å; N37-E41 PolarHBondContact N-O 2.99Å; N37-E41 PolarHBondContact ND2-OE2 2.71Å; N37-E41 WeakPolarHBondContact OD1-CB 3.46Å; N37-E41 PolarHBondContact OD1-N 3.35Å; N37-E41 PolarHBondContact OD1-O 2.87Å; K39-E41 HydrophobicContact CB-CG 4.35Å
42	R	86.3	Confident	84.2	Confident	144 Å²	144	71.6 Å²	71.6	54%	0.543	34%	0.34	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.6	146.8	179.9	-60.2	-178.6	-168.4	-170.5	1	109.3	G35 R36	G35-R42 VanDerWaalsContact O-CA 3.25Å; G35-R42 WeakPolarHBondContact O-CA 3.32Å; R36-R42 HydrophobicContact CB-CG 3.91Å; R36-R42 HydrophobicContact CG-CG 3.69Å
43	G	87.1	Confident	83.6	Confident	2 Å²	2	72.7 Å²	72.7	2%	0.021	35%	0.352	C	S	.	.	E	Extended strand (participates in β ladder)	trans	177.7	177.1	174	0	0	0	0	0	112.9	N11 E34 G35	N11-G43 CarbonylContact O-C 3.36Å; N11-G43 WeakPolarHBondContact O-CA 3.32Å; E34-G43 WeakPolarHBondContact CA-O 3.4Å; G35-G43 PolarHBondContact N-O 2.89Å; G35-G43 PolarHBondContact O-N 3.36Å
44	L	87.8	Confident	82.4	Confident	40 Å²	40	78 Å²	78	21%	0.209	39%	0.387	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-77.7	131.8	-179.8	-57.8	-176.7	0	0	0	109.4	N11 L13 V28 W32 L33 E34	N11-L44 PolarHBondContact O-N 2.77Å; L13-L44 PolarHBondContact N-O 3.03Å; V28-L44 HydrophobicContact CB-CD2 4.24Å; V28-L44 HydrophobicContact CG1-CD1 4.48Å; V28-L44 HydrophobicContact CG1-CD2 3.68Å; V28-L44 HydrophobicContact CG2-CD2 3.84Å; W32-L44 HydrophobicContact CE3-CB 3.8Å; W32-L44 HydrophobicContact CZ3-CB 4.32Å; L33-L44 CarbonylContact O-C 3.53Å; L33-L44 WeakPolarHBondContact O-CA 3.11Å; E34-L44 HydrophobicContact CB-CD2 4.11Å; E34-L44 HydrophobicContact CG-CD2 4.39Å
45	V	85.2	Confident	80.9	Confident	0 Å²	0	80.7 Å²	80.7	0%	0	41%	0.412	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.7	131.9	174.8	-170	0	0	0	0	106.9	L13 V15 I21 L33 V50	L13-V45 HydrophobicContact CB-CG2 3.69Å; L13-V45 HydrophobicContact CD2-CG2 3.96Å; L13-V45 HydrophobicContact CG-CG2 4.29Å; V15-V45 HydrophobicContact CG1-CG1 4.13Å; V15-V45 HydrophobicContact CG1-CG2 3.84Å; V15-V45 HydrophobicContact CG2-CG1 3.92Å; I21-V45 HydrophobicContact CD1-CB 4.37Å; I21-V45 HydrophobicContact CD1-CG2 3.85Å; L33-V45 HydrophobicContact CD1-CB 4.01Å; L33-V45 WeakPolarHBondContact CG-O 3.38Å; L33-V45 PolarHBondContact N-O 2.99Å; L33-V45 PolarHBondContact O-N 3.06Å; V45-V50 HydrophobicContact CB-CG1 4.3Å; V45-V50 HydrophobicContact CG1-CG1 3.42Å; V45-V50 VanDerWaalsContact CG1-CG1 3.42Å
46	P	85.1	Confident	79.5	Confident	15 Å²	15	88.6 Å²	88.6	10%	0.097	46%	0.455	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-67.1	137.8	175.5	24.4	-30.2	0	0	0	110.1	F4 W32 D48 Y49	F4-P46 HydrophobicContact CE2-CG 4.37Å; W32-P46 HydrophobicContact CE3-CB 4.25Å; W32-P46 HydrophobicContact CH2-CB 4.43Å; W32-P46 HydrophobicContact CZ3-CB 4.2Å; W32-P46 HydrophobicContact CZ3-CG 4.2Å; P46-D48 PolarHBondContact O-N 3.19Å; P46-D48 VanDerWaalsContact O-N 3.12Å; P46-Y49 HydrophobicContact CB-CD2 4.1Å; P46-Y49 HydrophobicContact CG-CD2 3.4Å; P46-Y49 VanDerWaalsContact CG-CD2 3.4Å; P46-Y49 HydrophobicContact CG-CE2 4.07Å; P46-Y49 HydrophobicContact CG-CG 3.95Å; P46-Y49 PolarHBondContact O-N 2.76Å
47	T	83.9	Confident	78.1	Confident	57 Å²	57	86 Å²	86	35%	0.35	46%	0.462	S	S	.	.	G	3₁₀ helix	trans	-58.8	-24.7	178.4	48	0	0	0	0	112.9	G31 L33 Y49 V50	G31-T47 PolarHBondContact O-N 2.81Å; G31-T47 PolarHBondContact O-OG1 3.42Å; L33-T47 HydrophobicContact CD2-CG2 3.67Å; L33-T47 HydrophobicContact CG-CG2 4.26Å; T47-Y49 PolarHBondContact O-N 2.89Å; T47-V50 PolarHBondContact O-N 3.33Å
48	D	82.9	Confident	76.4	Confident	149 Å²	149	93.7 Å²	93.7	80%	0.797	50%	0.495	S	S	*	.	G	3₁₀ helix	trans	-66.4	-21.6	174.9	-78.8	-96.2	0	0	0	114	P46	P46-D48 PolarHBondContact O-N 3.19Å; P46-D48 VanDerWaalsContact O-N 3.12Å
49	Y	78	Confident	75.3	Confident	110 Å²	110	93.5 Å²	93.5	43%	0.431	50%	0.495	S	S	.	.	G	3₁₀ helix	trans	-101.6	-5.4	-176.9	-75.6	-108.1	0	0	0	113.1	F4 P46 T47	F4-Y49 HydrophobicContact CB-CD1 4.21Å; P46-Y49 HydrophobicContact CB-CD2 4.1Å; P46-Y49 HydrophobicContact CG-CD2 3.4Å; P46-Y49 VanDerWaalsContact CG-CD2 3.4Å; P46-Y49 HydrophobicContact CG-CE2 4.07Å; P46-Y49 HydrophobicContact CG-CG 3.95Å; P46-Y49 PolarHBondContact O-N 2.76Å; T47-Y49 PolarHBondContact O-N 2.89Å
50	V	76.8	Confident	74.1	Confident	31 Å²	31	93.2 Å²	93.2	19%	0.188	50%	0.496	C	S	.	.			trans	-127.6	135.8	-178.9	-67.2	0	0	0	0	110.4	I21 L33 V45 T47	I21-V50 HydrophobicContact CD1-CG1 3.84Å; L33-V50 HydrophobicContact CD1-CG2 4Å; L33-V50 HydrophobicContact CD2-CG2 3.29Å; L33-V50 HydrophobicContact CG-CG2 3.94Å; V45-V50 HydrophobicContact CB-CG1 4.3Å; V45-V50 HydrophobicContact CG1-CG1 3.42Å; V45-V50 VanDerWaalsContact CG1-CG1 3.42Å; T47-V50 PolarHBondContact O-N 3.33Å
51	E	79.6	Confident	72.9	Confident	142 Å²	142	101.9 Å²	101.9	66%	0.664	53%	0.527	S	S	*	.			trans	-98	115.7	173.3	-165.8	173.3	142.8	0	0	108.2	L53	E51-L53 PolarHBondContact O-N 3.08Å
52	I	76.4	Confident	71.3	Confident	104 Å²	104	102.7 Å²	102.7	53%	0.533	54%	0.544	S	S	.	.			trans	-71.4	103.5	172	-55.9	177.6	0	0	0	106.4	I23 P54	I23-I52 HydrophobicContact CD1-CD1 4.46Å; I23-I52 HydrophobicContact CD1-CG1 3.91Å; I23-I52 HydrophobicContact CD1-CG2 4.43Å; I52-P54 WeakPolarHBondContact O-CD 3.25Å
53	L	72.9	Confident	69.6	Low	116 Å²	116	105 Å²	105	61%	0.607	58%	0.58	S	S	*	*			trans	-61.4	120.6	175	-64.6	176.6	0	0	0	108.4	E51 S55	E51-L53 PolarHBondContact O-N 3.08Å; L53-S55 PolarHBondContact O-N 3.26Å
54	P	64.8	Low	68.7	Low	113 Å²	113	110.2 Å²	110.2	73%	0.734	61%	0.608	S	S	*	*			trans	-63	116.4	173.9	24.4	-30.2	0	0	0	107.8	I52 D56	I52-P54 WeakPolarHBondContact O-CD 3.25Å; P54-D56 VanDerWaalsContact C-N 3.32Å; P54-D56 PolarHBondContact O-N 3.06Å
55	S	55.4	Low	67.7	Low	118 Å²	118	113.9 Å²	113.9	83%	0.825	63%	0.629	S	S	*	*			trans	-63.6	101.2	163.6	-57.5	0	0	0	0	106.5	L53 G57	L53-S55 PolarHBondContact O-N 3.26Å; S55-G57 PolarHBondContact O-N 3.3Å
56	D	61	Low	66.7	Low	166 Å²	166	120.2 Å²	120.2	89%	0.888	66%	0.664	S	S	*	*	S	Bend	trans	-22.6	116.2	176	-168.1	-107	0	0	0	113.3	P54	P54-D56 VanDerWaalsContact C-N 3.32Å; P54-D56 PolarHBondContact O-N 3.06Å
57	G	57.2	Low	65.6	Low	54 Å²	54	126.4 Å²	126.4	56%	0.557	70%	0.698	S	S	*	*			trans	126.7	83.3	170.9	0	0	0	0	0	114.5	S55	S55-G57 PolarHBondContact O-N 3.3Å
58	K	52.3	Low	64.5	Low	168 Å²	168	130.8 Å²	130.8	73%	0.73	72%	0.719	S	S	*	*			trans	175.1	58.2	130.2	-77	-115	-175.1	79.4	0	111.3	Q60	K58-Q60 HydrophobicContact CD-CG 4.28Å; K58-Q60 PolarHBondContact O-N 3.07Å; K58-Q60 VanDerWaalsContact O-N 3.15Å
59	D	58.1	Low	63.3	Low	147 Å²	147	129.5 Å²	129.5	79%	0.786	71%	0.714	S	S	*	*			trans	-81	66.9	152.7	22.3	-95.5	0	0	0	108.5	F61	D59-F61 PolarHBondContact O-N 3.29Å
60	Q	57.7	Low	62.2	Low	153 Å²	153	130.9 Å²	130.9	72%	0.715	73%	0.734	S	S	*	*			trans	-85.8	19.3	173.3	-71.8	-167.3	18.2	0	0	113.4	K58	K58-Q60 HydrophobicContact CD-CG 4.28Å; K58-Q60 PolarHBondContact O-N 3.07Å; K58-Q60 VanDerWaalsContact O-N 3.15Å
61	F	58	Low	61.1	Low	209 Å²	209	138.6 Å²	138.6	92%	0.917	78%	0.776	S	S	*	*			trans	-103.8	59.3	168.4	-67.6	-81	0	0	0	110	D59	D59-F61 PolarHBondContact O-N 3.29Å
62	S	51.8	Low	59.6	Low	119 Å²	119	138.3 Å²	138.3	83%	0.832	79%	0.786	S	S	*	*			trans	-90.8	105.5	151	-163.1	0	0	0	0	106.3
63	C	48.9	Very low	58	Low	193 Å²	193	141.5 Å²	141.5	100%	1.304	81%	0.809	S	S	*	*			trans	-68	0	-179.1	-161.7	0	0	0	0	112.7

Retrieved 63 of 63 residues in 120.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).