A0A087WVG4_HUMAN Loading...

PHD finger protein 1

AlphaFold DB , UniProt , Accession A0A087WVG4, Species HUMAN (Homo sapiens, Human), Gene PHF1, Length 54 aa.

						>A0A087WVG4_HUMAN|A0A087WVG4|PHF1
MAQPPRLSRSGASSLWDPASPAPTSGPRPRLWEGQDVLARWTDGLLYLGTIKKC
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	45.7	Very low	61.4	Low	249 Å²	249	148 Å²	148	100%	1.227	81%	0.814	S	S	*	*				0	107.6	0	-66.1	173	-173.8	0	0	106.9
2	A	59.2	Low	61.4	Low	103 Å²	103	142.5 Å²	142.5	85%	0.851	80%	0.803	S	S	*	*	P	Polyproline II helix	trans	-86.1	125.4	-173.6	0	0	0	0	0	110
3	Q	61.5	Low	61.5	Low	153 Å²	153	140 Å²	140	72%	0.715	80%	0.8	S	S	*	*	P	Polyproline II helix	trans	-70.4	126.6	173.8	-178.6	173.8	-28.5	0	0	108.9
4	P	61.3	Low	61.9	Low	100 Å²	100	137.2 Å²	137.2	65%	0.649	79%	0.793	S	S	*	*	P	Polyproline II helix	trans	-66.9	142.7	179	25.7	-31.7	0	0	0	110.3	R6	P4-R6 PolarHBondContact O-N 2.79Å
5	P	65.8	Low	62	Low	116 Å²	116	139.1 Å²	139.1	75%	0.753	80%	0.799	S	S	*	*	P	Polyproline II helix	trans	-61.4	133.7	176.7	25.6	-31.9	0	0	0	109	L7	P5-L7 PolarHBondContact O-N 3.48Å
6	R	67.7	Low	62.5	Low	213 Å²	213	142.4 Å²	142.4	80%	0.804	79%	0.794	S	S	*	*			trans	-59.5	102.3	177.1	-72.6	-76.4	-153.1	-84.8	-3.3	108.4	P4 S8	P4-R6 PolarHBondContact O-N 2.79Å; R6-S8 PolarHBondContact O-N 3.3Å
7	L	62.5	Low	63	Low	162 Å²	162	142.9 Å²	142.9	85%	0.848	80%	0.795	S	S	*	*			trans	-58.3	120.1	172.8	-80.8	157.3	0	0	0	108.8	P5	P5-L7 PolarHBondContact O-N 3.48Å
8	S	65.1	Low	63.2	Low	96 Å²	96	138.8 Å²	138.8	67%	0.671	78%	0.775	S	S	*	*			trans	44.8	102.9	154.7	-55.2	0	0	0	0	116.2	R6 S10	R6-S8 PolarHBondContact O-N 3.3Å; S8-S10 PolarHBondContact O-N 2.85Å
9	R	65.8	Low	63.5	Low	252 Å²	252	137.4 Å²	137.4	95%	0.951	78%	0.783	S	S	*	*			trans	-51.4	103.7	159.1	176.6	171.6	147.4	-169.5	-6.5	107.5	G11	R9-G11 PolarHBondContact O-N 2.76Å
10	S	60.8	Low	63.6	Low	124 Å²	124	134.8 Å²	134.8	87%	0.867	77%	0.774	S	S	*	*			trans	-56.7	82.5	178.4	-74	0	0	0	0	110.7	S8	S8-S10 PolarHBondContact O-N 2.85Å
11	G	60.4	Low	63.6	Low	60 Å²	60	134.4 Å²	134.4	62%	0.619	78%	0.777	S	S	*	*			trans	-102.8	36.9	169.3	0	0	0	0	0	110.6	R9 S13	R9-G11 PolarHBondContact O-N 2.76Å; G11-S13 PolarHBondContact O-N 3.05Å
12	A	60.7	Low	64.8	Low	82 Å²	82	125.5 Å²	125.5	68%	0.678	74%	0.742	S	S	*	*			trans	-78.1	64	170.7	0	0	0	0	0	109.1	S14	A12-S14 VanDerWaalsContact C-N 3.31Å; A12-S14 PolarHBondContact O-N 3.32Å
13	S	63.4	Low	65.1	Low	110 Å²	110	126.6 Å²	126.6	77%	0.769	74%	0.741	S	S	*	*	S	Bend	trans	-76.8	90.3	168.8	-55	0	0	0	0	106.9	G11	G11-S13 PolarHBondContact O-N 3.05Å
14	S	66.3	Low	65.3	Low	101 Å²	101	125.5 Å²	125.5	71%	0.706	74%	0.744	S	S	*	*			trans	83.9	77.3	173.1	-44.8	0	0	0	0	115.9	A12	A12-S14 VanDerWaalsContact C-N 3.31Å; A12-S14 PolarHBondContact O-N 3.32Å
15	L	64.2	Low	65.5	Low	166 Å²	166	126.7 Å²	126.7	87%	0.869	76%	0.755	S	S	*	*			trans	-97.6	25	168.1	-163.1	74.3	0	0	0	112.4
16	W	70.2	Confident	65.6	Low	192 Å²	192	123.3 Å²	123.3	73%	0.727	74%	0.742	S	S	*	*			trans	-129.7	121.6	173	60.6	-90.1	0	0	0	108.3	P18	W16-P18 HydrophobicContact CZ3-CB 3.99Å
17	D	70.4	Confident	65.9	Low	150 Å²	150	119.1 Å²	119.1	80%	0.802	74%	0.742	S	S	*	*			trans	-83.4	124	176.4	-141.2	-58.3	0	0	0	107.7	A19	D17-A19 PolarHBondContact O-N 2.98Å
18	P	67.1	Low	66.5	Low	69 Å²	69	122.3 Å²	122.3	45%	0.448	74%	0.743	S	S	.	*			trans	-69.4	97.8	174.3	27.5	-31.5	0	0	0	109	W16 S20	W16-P18 HydrophobicContact CZ3-CB 3.99Å; P18-S20 PolarHBondContact O-N 2.8Å
19	A	68.3	Low	66.9	Low	112 Å²	112	122.8 Å²	122.8	93%	0.926	74%	0.744	S	S	*	*	S	Bend	trans	-65.1	7	173.9	0	0	0	0	0	114.2	D17	D17-A19 PolarHBondContact O-N 2.98Å
20	S	65.6	Low	67.8	Low	86 Å²	86	120.4 Å²	120.4	60%	0.601	74%	0.735	S	S	*	*	S	Bend	trans	-142.8	142.1	-177.6	-164.3	0	0	0	0	109.1	P18 A22	P18-S20 PolarHBondContact O-N 2.8Å; S20-A22 PolarHBondContact O-N 3.5Å
21	P	64.8	Low	69.1	Low	127 Å²	127	119.5 Å²	119.5	83%	0.825	72%	0.72	S	S	*	*			trans	-62.6	96.6	178.3	25.4	-33.1	0	0	0	109.5
22	A	70	Confident	70.6	Confident	61 Å²	61	124 Å²	124	50%	0.504	72%	0.718	S	S	.	*			trans	-64.7	138.1	173.4	0	0	0	0	0	108.3	S20 T24	S20-A22 PolarHBondContact O-N 3.5Å; A22-T24 PolarHBondContact O-N 2.81Å
23	P	64.8	Low	72.3	Confident	126 Å²	126	127.1 Å²	127.1	82%	0.818	72%	0.718	S	S	*	*			trans	-56	113.8	168.5	24.4	-31.8	0	0	0	107	S25	P23-S25 PolarHBondContact O-N 2.8Å
24	T	65.9	Low	73.7	Confident	130 Å²	130	124.2 Å²	124.2	80%	0.798	71%	0.706	S	S	*	*			trans	-58.9	116.7	178.9	54.4	0	0	0	0	106.9	A22 G26	A22-T24 PolarHBondContact O-N 2.81Å; T24-G26 PolarHBondContact O-N 2.9Å
25	S	66.6	Low	75.1	Confident	125 Å²	125	121 Å²	121	87%	0.874	68%	0.68	S	S	*	*			trans	-67.3	80.7	179.1	-178.9	0	0	0	0	108.4	P23	P23-S25 PolarHBondContact O-N 2.8Å
26	G	66.5	Low	76.5	Confident	46 Å²	46	118 Å²	118	47%	0.474	67%	0.665	S	S	.	*	S	Bend	trans	57.2	166.5	-176.2	0	0	0	0	0	114.9	T24 R28	T24-G26 PolarHBondContact O-N 2.9Å; G26-R28 PolarHBondContact O-N 2.72Å
27	P	73.8	Confident	77.7	Confident	125 Å²	125	111 Å²	111	81%	0.812	64%	0.643	S	S	*	*	P	Polyproline II helix	trans	-62.5	124	163.3	25.4	-30	0	0	0	108.6	P29	P27-P29 WeakPolarHBondContact O-CD 3.41Å; P27-P29 VanDerWaalsContact O-N 3.15Å
28	R	75.5	Confident	78.9	Confident	229 Å²	229	109.3 Å²	109.3	86%	0.864	63%	0.633	S	S	*	*	P	Polyproline II helix	trans	-55.3	120.9	169.4	-178.2	176.5	178.9	-161.4	-0.6	107.7	G26 R30	G26-R28 PolarHBondContact O-N 2.72Å; R28-R30 PolarHBondContact O-N 3.47Å; R28-R30 VanDerWaalsContact O-N 3.07Å
29	P	73.9	Confident	80.2	Confident	105 Å²	105	108.3 Å²	108.3	68%	0.682	63%	0.631	S	S	*	*	P	Polyproline II helix	trans	-58	120.1	-179.7	-22.9	32.3	0	0	0	109.1	P27	P27-P29 WeakPolarHBondContact O-CD 3.41Å; P27-P29 VanDerWaalsContact O-N 3.15Å
30	R	84	Confident	81.6	Confident	202 Å²	202	112.6 Å²	112.6	76%	0.762	62%	0.623	S	S	*	*	P	Polyproline II helix	trans	-77.3	136	172.5	-62.7	-173.8	85.5	171.6	5.5	107.3	R28 W32 Q35	R28-R30 PolarHBondContact O-N 3.47Å; R28-R30 VanDerWaalsContact O-N 3.07Å; R30-W32 HydrophobicContact CB-CE3 4.39Å; R30-Q35 PolarHBondContact O-OE1 2.89Å
31	L	89.3	Confident	83.2	Confident	106 Å²	106	116.4 Å²	116.4	56%	0.555	63%	0.625	S	S	*	*	P	Polyproline II helix	trans	-81.1	116.6	177.7	-153.9	75.9	0	0	0	109.1	Q35 V37 I51 C54	L31-Q35 VanDerWaalsContact CA-OE1 3.31Å; L31-V37 HydrophobicContact CD1-CG1 4.46Å; L31-I51 HydrophobicContact CD1-CD1 3.03Å; L31-I51 HydrophobicContact CG-CD1 3.26Å; L31-I51 HydrophobicContact CD2-CD1 4.06Å; L31-I51 HydrophobicContact CD1-CG1 4.42Å; L31-I51 HydrophobicContact CB-CD1 4.48Å; L31-C54 PolarHBondContact O-SG 2.79Å; L31-C54 HydrophobicContact CD2-CB 4.44Å
32	W	92.1	Very high	84.7	Confident	154 Å²	154	117 Å²	117	58%	0.583	63%	0.626	S	S	*	*			trans	-130.1	153.3	175.6	57.2	59.2	0	0	0	112.5	R30 G34 Q35 I51 C54	R30-W32 HydrophobicContact CB-CE3 4.39Å; W32-G34 PolarHBondContact O-N 3.23Å; W32-Q35 VanDerWaalsContact CD1-CB 3.4Å; W32-Q35 HydrophobicContact CG-CB 4.24Å; W32-Q35 VanDerWaalsContact N-OE1 3.16Å; W32-Q35 WeakPolarHBondContact O-CB 3.37Å; W32-Q35 PolarHBondContact O-N 3.4Å; W32-Q35 VanDerWaalsContact O-N 3.1Å; W32-I51 WeakPolarHBondContact O-CB 3.32Å; W32-C54 WeakPolarHBondContact CA-SG 3.33Å
33	E	95.4	Very high	86	Confident	147 Å²	147	118.2 Å²	118.2	69%	0.687	62%	0.624	S	S	*	*	T	Hydrogen-bonded Turn	trans	-60.7	136	172.1	-172.9	176.4	173.6	0	0	109.7	Q35 I51	E33-Q35 VanDerWaalsContact C-N 3.35Å; E33-I51 CarbonylContact C-O 3.52Å; E33-I51 WeakPolarHBondContact CA-O 3.5Å
34	G	93.7	Very high	87.6	Confident	50 Å²	50	114.3 Å²	114.3	52%	0.515	61%	0.607	S	S	.	*	T	Hydrogen-bonded Turn	trans	84.8	-0.6	-172.5	0	0	0	0	0	114.8	W32 I51	W32-G34 PolarHBondContact O-N 3.23Å; G34-I51 PolarHBondContact N-O 3.1Å
35	Q	94.9	Very high	89.1	Confident	33 Å²	33	113.1 Å²	113.1	15%	0.154	60%	0.595	C	S	.	*			trans	-75.3	133.1	174.8	-163	174.9	-3.2	0	0	111.5	R30 L31 W32 E33 V37 T50 I51	R30-Q35 PolarHBondContact O-OE1 2.89Å; L31-Q35 VanDerWaalsContact CA-OE1 3.31Å; W32-Q35 VanDerWaalsContact CD1-CB 3.4Å; W32-Q35 HydrophobicContact CG-CB 4.24Å; W32-Q35 VanDerWaalsContact N-OE1 3.16Å; W32-Q35 WeakPolarHBondContact O-CB 3.37Å; W32-Q35 PolarHBondContact O-N 3.4Å; W32-Q35 VanDerWaalsContact O-N 3.1Å; E33-Q35 VanDerWaalsContact C-N 3.35Å; Q35-V37 HydrophobicContact CG-CG1 4.15Å; Q35-T50 CarbonylContact O-C 3.57Å; Q35-T50 WeakPolarHBondContact O-CA 3.36Å; Q35-I51 WeakPolarHBondContact O-CG1 3.45Å; Q35-I51 PolarHBondContact O-N 2.94Å; Q35-I51 HydrophobicContact CB-CB 4.5Å; Q35-I51 HydrophobicContact CB-CD1 3.93Å; Q35-I51 HydrophobicContact CB-CG1 4.22Å
36	D	94.8	Very high	90.6	Very high	103 Å²	103	112.3 Å²	112.3	55%	0.551	58%	0.58	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-79.5	131.5	166.2	-67.3	-35	0	0	0	110.9	L48 G49 T50	D36-L48 HydrophobicContact CB-CD1 4.18Å; D36-G49 WeakPolarHBondContact CA-O 3.41Å; D36-T50 PolarHBondContact OD1-OG1 2.92Å
37	V	94.1	Very high	92.1	Very high	44 Å²	44	115 Å²	115	27%	0.267	58%	0.577	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-137.1	155.4	-177.9	-67.3	0	0	0	0	111.6	L31 Q35 L48 G49 I51	L31-V37 HydrophobicContact CD1-CG1 4.46Å; Q35-V37 HydrophobicContact CG-CG1 4.15Å; V37-L48 WeakPolarHBondContact O-CA 3.35Å; V37-G49 WeakPolarHBondContact CG2-O 3.39Å; V37-G49 PolarHBondContact N-O 2.73Å; V37-G49 PolarHBondContact O-N 3Å; V37-I51 HydrophobicContact CG2-CG1 3.79Å; V37-I51 HydrophobicContact CG2-CD1 4.25Å; V37-I51 HydrophobicContact CG1-CG1 4.03Å; V37-I51 HydrophobicContact CG1-CD1 3.71Å
38	L	95.8	Very high	93.2	Very high	115 Å²	115	115.3 Å²	115.3	60%	0.602	57%	0.571	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-98.8	103.9	171.1	-66.8	173.6	0	0	0	109.3	L46 Y47 L48	L38-L46 HydrophobicContact CB-CB 4.32Å; L38-L46 HydrophobicContact CB-CD1 4.41Å; L38-L46 HydrophobicContact CB-CD2 4.38Å; L38-L46 HydrophobicContact CD1-CD1 4.32Å; L38-Y47 CarbonylContact C-O 3.53Å; L38-Y47 WeakPolarHBondContact CA-O 3.39Å; L38-L48 HydrophobicContact CD2-CB 4.22Å; L38-L48 HydrophobicContact CD2-CD1 4.1Å
39	A	94.8	Very high	94.2	Very high	49 Å²	49	105.9 Å²	105.9	41%	0.405	55%	0.545	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-87.1	131.3	177.4	0	0	0	0	0	110.6	L46 Y47	A39-L46 WeakPolarHBondContact O-CA 3.5Å; A39-L46 CarbonylContact O-C 3.55Å; A39-Y47 PolarHBondContact N-O 3.07Å; A39-Y47 PolarHBondContact O-N 2.88Å
40	R	97.7	Very high	95.3	Very high	201 Å²	201	104.7 Å²	104.7	76%	0.758	54%	0.536	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-83.2	125.1	173.7	-177.8	174.6	170.5	177.8	-1.7	110.1	L45 L46	R40-L45 WeakPolarHBondContact CA-O 3.43Å; R40-L46 HydrophobicContact CB-CD2 3.91Å
41	W	98.1	Very high	95.8	Very high	167 Å²	167	95.9 Å²	95.9	63%	0.633	50%	0.504	S	S	*	.			trans	-97.4	174.2	175.6	-159.1	-112.9	0	0	0	112.2	D43 G44 L45 Y47	W41-D43 WeakPolarHBondContact CB-OD1 3.42Å; W41-D43 PolarHBondContact O-N 2.85Å; W41-G44 PolarHBondContact O-N 2.69Å; W41-L45 PolarHBondContact N-O 3.21Å; W41-Y47 HydrophobicContact CG-CD2 4.46Å; W41-Y47 HydrophobicContact CG-CE2 4.07Å; W41-Y47 HydrophobicContact CB-CE2 3.32Å; W41-Y47 HydrophobicContact CB-CD2 3.58Å
42	T	97.8	Very high	96	Very high	138 Å²	138	99.2 Å²	99.2	85%	0.847	51%	0.513	S	S	*	.	T	Hydrogen-bonded Turn	trans	-69	-19.4	-176	52.4	0	0	0	0	113.8	G44	T42-G44 PolarHBondContact O-N 2.79Å
43	D	97.3	Very high	95.8	Very high	87 Å²	87	100.6 Å²	100.6	47%	0.465	52%	0.524	S	S	.	.	T	Hydrogen-bonded Turn	trans	-77.6	-5.4	171.7	53.1	26.5	0	0	0	113.3	W41 L45 Y47	W41-D43 WeakPolarHBondContact CB-OD1 3.42Å; W41-D43 PolarHBondContact O-N 2.85Å; D43-L45 WeakPolarHBondContact OD1-CB 3.19Å; D43-L45 PolarHBondContact OD1-N 3.07Å; D43-Y47 PolarHBondContact OD2-OH 3.26Å
44	G	97.8	Very high	94.7	Very high	44 Å²	44	99 Å²	99	45%	0.454	53%	0.528	S	S	.	.	S	Bend	trans	86.9	-0.4	-179.5	0	0	0	0	0	114.7	W41 T42	W41-G44 PolarHBondContact O-N 2.69Å; T42-G44 PolarHBondContact O-N 2.79Å
45	L	98.3	Very high	94.8	Very high	105 Å²	105	101.5 Å²	101.5	55%	0.55	53%	0.529	S	S	.	.			trans	-86.4	158.3	177.6	-61.7	178.5	0	0	0	112	R40 W41 D43 Y47	R40-L45 WeakPolarHBondContact CA-O 3.43Å; W41-L45 PolarHBondContact N-O 3.21Å; D43-L45 WeakPolarHBondContact OD1-CB 3.19Å; D43-L45 PolarHBondContact OD1-N 3.07Å; L45-Y47 HydrophobicContact CB-CE2 3.73Å
46	L	98	Very high	94.8	Very high	108 Å²	108	105.1 Å²	105.1	57%	0.565	55%	0.548	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-99.4	132	173.7	-68.5	177.3	0	0	0	109.9	L38 A39 R40	L38-L46 HydrophobicContact CB-CB 4.32Å; L38-L46 HydrophobicContact CB-CD1 4.41Å; L38-L46 HydrophobicContact CB-CD2 4.38Å; L38-L46 HydrophobicContact CD1-CD1 4.32Å; A39-L46 WeakPolarHBondContact O-CA 3.5Å; A39-L46 CarbonylContact O-C 3.55Å; R40-L46 HydrophobicContact CB-CD2 3.91Å
47	Y	97.4	Very high	94.8	Very high	104 Å²	104	105.2 Å²	105.2	41%	0.408	55%	0.548	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.3	127.9	-179.2	-68	-93.6	0	0	0	109.5	L38 A39 W41 D43 L45 G49	L38-Y47 CarbonylContact C-O 3.53Å; L38-Y47 WeakPolarHBondContact CA-O 3.39Å; A39-Y47 PolarHBondContact N-O 3.07Å; A39-Y47 PolarHBondContact O-N 2.88Å; W41-Y47 HydrophobicContact CG-CD2 4.46Å; W41-Y47 HydrophobicContact CG-CE2 4.07Å; W41-Y47 HydrophobicContact CB-CE2 3.32Å; W41-Y47 HydrophobicContact CB-CD2 3.58Å; D43-Y47 PolarHBondContact OD2-OH 3.26Å; L45-Y47 HydrophobicContact CB-CE2 3.73Å; Y47-G49 PolarHBondContact O-N 2.91Å
48	L	97.4	Very high	94.8	Very high	131 Å²	131	108.8 Å²	108.8	69%	0.686	57%	0.565	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-72.3	127.7	171.2	-173.4	64.5	0	0	0	109.3	D36 V37 L38	D36-L48 HydrophobicContact CB-CD1 4.18Å; V37-L48 WeakPolarHBondContact O-CA 3.35Å; L38-L48 HydrophobicContact CD2-CB 4.22Å; L38-L48 HydrophobicContact CD2-CD1 4.1Å
49	G	95.8	Very high	94.7	Very high	30 Å²	30	108.4 Å²	108.4	31%	0.309	56%	0.562	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-150.2	155.5	175	0	0	0	0	0	111.5	D36 V37 Y47	D36-G49 WeakPolarHBondContact CA-O 3.41Å; V37-G49 WeakPolarHBondContact CG2-O 3.39Å; V37-G49 PolarHBondContact N-O 2.73Å; V37-G49 PolarHBondContact O-N 3Å; Y47-G49 PolarHBondContact O-N 2.91Å
50	T	96.6	Very high	94.7	Very high	80 Å²	80	112.4 Å²	112.4	49%	0.491	57%	0.573	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-100.3	135.3	177.2	-46.2	0	0	0	0	109.8	Q35 D36 K52	Q35-T50 CarbonylContact O-C 3.57Å; Q35-T50 WeakPolarHBondContact O-CA 3.36Å; D36-T50 PolarHBondContact OD1-OG1 2.92Å; T50-K52 PolarHBondContact O-N 2.9Å
51	I	94.1	Very high	94.5	Very high	18 Å²	18	106.1 Å²	106.1	9%	0.092	56%	0.559	C	S	.	*			trans	-72.1	120.9	179.9	-58.3	-175.1	0	0	0	109.5	L31 W32 E33 G34 Q35 V37 K53 C54	L31-I51 HydrophobicContact CD1-CD1 3.03Å; L31-I51 HydrophobicContact CG-CD1 3.26Å; L31-I51 HydrophobicContact CD2-CD1 4.06Å; L31-I51 HydrophobicContact CD1-CG1 4.42Å; L31-I51 HydrophobicContact CB-CD1 4.48Å; W32-I51 WeakPolarHBondContact O-CB 3.32Å; E33-I51 CarbonylContact C-O 3.52Å; E33-I51 WeakPolarHBondContact CA-O 3.5Å; G34-I51 PolarHBondContact N-O 3.1Å; Q35-I51 WeakPolarHBondContact O-CG1 3.45Å; Q35-I51 PolarHBondContact O-N 2.94Å; Q35-I51 HydrophobicContact CB-CB 4.5Å; Q35-I51 HydrophobicContact CB-CD1 3.93Å; Q35-I51 HydrophobicContact CB-CG1 4.22Å; V37-I51 HydrophobicContact CG2-CG1 3.79Å; V37-I51 HydrophobicContact CG2-CD1 4.25Å; V37-I51 HydrophobicContact CG1-CG1 4.03Å; V37-I51 HydrophobicContact CG1-CD1 3.71Å; I51-K53 WeakPolarHBondContact CG2-O 3.43Å; I51-C54 VanDerWaalsContact CG2-SG 3.55Å
52	K	94.4	Very high	94.3	Very high	175 Å²	175	101.4 Å²	101.4	76%	0.761	55%	0.554	S	S	*	*	S	Bend	trans	-97.6	-16.1	175	-60.6	-172.1	68.6	-178.2	0	113.2	T50	T50-K52 PolarHBondContact O-N 2.9Å
53	K	88.3	Confident	94	Very high	183 Å²	183	98.3 Å²	98.3	80%	0.796	53%	0.529	S	S	*	.			trans	-159.6	132.5	-179.1	-172.5	168	-177.5	173.5	0	109.5	I51	I51-K53 WeakPolarHBondContact CG2-O 3.43Å
54	C	72.3	Confident	93.7	Very high	115 Å²	115	99.4 Å²	99.4	78%	0.777	54%	0.535	S	S	*	.			trans	-102.6	0	173.4	-62.3	0	0	0	0	111.4	L31 W32 I51	L31-C54 PolarHBondContact O-SG 2.79Å; L31-C54 HydrophobicContact CD2-CB 4.44Å; W32-C54 WeakPolarHBondContact CA-SG 3.33Å; I51-C54 VanDerWaalsContact CG2-SG 3.55Å

Retrieved 54 of 54 residues in 37.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).