A0A087WVH1_HUMAN Loading...

DIX domain containing 1

AlphaFold DB , UniProt , Accession A0A087WVH1, Species HUMAN (Homo sapiens, Human), Gene DIXDC1, Length 77 aa.

						>A0A087WVH1_HUMAN|A0A087WVH1|DIXDC1
MEEAKKMISGLQALLLNGSLPEDEQERPLALCEPGVNPEEQLIIIQSRLDQSMEENQDLKKELLKCKQEARNLQGIK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	72.2	Confident	86.1	Confident	179 Å²	179	103.8 Å²	103.8	88%	0.882	53%	0.529	S	S	*	.				0	-47.1	0	-170.8	175.8	-97.1	0	0	111.1	E3 A4 K5	M1-E3 PolarHBondContact O-N 2.85Å; M1-A4 PolarHBondContact O-N 2.92Å; M1-K5 PolarHBondContact O-N 3.46Å; M1-K5 VanDerWaalsContact O-N 3.16Å
2	E	85.8	Confident	86.3	Confident	125 Å²	125	104.8 Å²	104.8	58%	0.584	53%	0.53	S	S	*	.	H	α-helix	trans	-64.1	-36.4	176.6	-67	-52.6	123.4	0	0	113.9	A4 K5 K6	E2-A4 VanDerWaalsContact C-N 3.33Å; E2-A4 PolarHBondContact O-N 3.24Å; E2-K5 PolarHBondContact O-N 3.21Å; E2-K5 IonicContact OE1-NZ 2.76Å; E2-K5 PolarHBondContact OE1-NZ 3.26Å; E2-K6 PolarHBondContact O-N 3.25Å
3	E	84	Confident	85.6	Confident	169 Å²	169	98 Å²	98	79%	0.79	50%	0.5	S	S	*	.	H	α-helix	trans	-61.3	-40.9	173.3	-72.1	171.3	170.9	0	0	112.7	M1 K5 K6 M7	M1-E3 PolarHBondContact O-N 2.85Å; E3-K5 VanDerWaalsContact C-N 3.32Å; E3-K5 PolarHBondContact O-N 3.15Å; E3-K6 PolarHBondContact O-N 3.31Å; E3-M7 WeakPolarHBondContact O-CB 3.41Å; E3-M7 PolarHBondContact O-N 2.96Å
4	A	89	Confident	85.5	Confident	46 Å²	46	96.1 Å²	96.1	38%	0.38	49%	0.491	S	S	.	.	H	α-helix	trans	-64.8	-38.8	176.8	0	0	0	0	0	111.2	M1 E2 M7 I8	M1-A4 PolarHBondContact O-N 2.92Å; E2-A4 VanDerWaalsContact C-N 3.33Å; E2-A4 PolarHBondContact O-N 3.24Å; A4-M7 PolarHBondContact O-N 3.15Å; A4-I8 WeakPolarHBondContact O-CD1 3.33Å; A4-I8 WeakPolarHBondContact O-CG1 3.44Å; A4-I8 PolarHBondContact O-N 3.35Å
5	K	86.3	Confident	85.6	Confident	101 Å²	101	99.7 Å²	99.7	44%	0.439	51%	0.51	S	S	.	.	H	α-helix	trans	-65.6	-45.6	174.5	-68	177.5	-174.4	166.2	0	111.7	M1 E2 E3 M7 I8 S9	M1-K5 PolarHBondContact O-N 3.46Å; M1-K5 VanDerWaalsContact O-N 3.16Å; E2-K5 PolarHBondContact O-N 3.21Å; E2-K5 IonicContact OE1-NZ 2.76Å; E2-K5 PolarHBondContact OE1-NZ 3.26Å; E3-K5 VanDerWaalsContact C-N 3.32Å; E3-K5 PolarHBondContact O-N 3.15Å; K5-M7 VanDerWaalsContact C-N 3.28Å; K5-M7 PolarHBondContact O-N 3.21Å; K5-I8 PolarHBondContact O-N 3Å; K5-S9 PolarHBondContact O-N 3.21Å; K5-S9 PolarHBondContact O-OG 2.91Å
6	K	84.8	Confident	85.3	Confident	137 Å²	137	102.5 Å²	102.5	60%	0.596	53%	0.526	S	S	*	.	H	α-helix	trans	-58.7	-42.4	176.3	-168.4	-177.3	177.2	-164.5	0	111	E2 E3 S9 G10 E22	E2-K6 PolarHBondContact O-N 3.25Å; E3-K6 PolarHBondContact O-N 3.31Å; K6-S9 PolarHBondContact O-N 3.07Å; K6-G10 PolarHBondContact O-N 3.39Å; K6-E22 IonicContact NZ-OE1 2.85Å; K6-E22 PolarHBondContact NZ-OE1 3.29Å
7	M	89.4	Confident	85	Confident	122 Å²	122	102.5 Å²	102.5	60%	0.601	53%	0.527	S	S	*	.	H	α-helix	trans	-64.4	-43.7	176.8	-171.8	179.6	65.7	0	0	112.2	E3 A4 K5 G10 L11	E3-M7 WeakPolarHBondContact O-CB 3.41Å; E3-M7 PolarHBondContact O-N 2.96Å; A4-M7 PolarHBondContact O-N 3.15Å; K5-M7 VanDerWaalsContact C-N 3.28Å; K5-M7 PolarHBondContact O-N 3.21Å; M7-G10 PolarHBondContact O-N 3.04Å; M7-L11 HydrophobicContact CG-CD1 4.26Å; M7-L11 WeakPolarHBondContact O-CG 3.48Å; M7-L11 PolarHBondContact O-N 3.19Å
8	I	92	Very high	84.2	Confident	91 Å²	91	100.3 Å²	100.3	47%	0.467	53%	0.533	S	S	.	.	H	α-helix	trans	-62.6	-46.6	177.3	-70.3	164.4	0	0	0	110.8	A4 K5 G10 L11 Q12	A4-I8 WeakPolarHBondContact O-CD1 3.33Å; A4-I8 WeakPolarHBondContact O-CG1 3.44Å; A4-I8 PolarHBondContact O-N 3.35Å; K5-I8 PolarHBondContact O-N 3Å; I8-G10 VanDerWaalsContact C-N 3.32Å; I8-G10 PolarHBondContact O-N 3.39Å; I8-L11 PolarHBondContact O-N 3.45Å; I8-Q12 WeakPolarHBondContact O-CG 3.46Å; I8-Q12 PolarHBondContact O-N 2.99Å
9	S	86	Confident	83.8	Confident	69 Å²	69	96.6 Å²	96.6	48%	0.483	52%	0.517	S	S	.	.	H	α-helix	trans	-62.4	-39.7	177.1	-60.1	0	0	0	0	112	K5 K6 Q12 A13	K5-S9 PolarHBondContact O-N 3.21Å; K5-S9 PolarHBondContact O-OG 2.91Å; K6-S9 PolarHBondContact O-N 3.07Å; S9-Q12 PolarHBondContact O-N 3.43Å; S9-A13 PolarHBondContact O-N 3.29Å
10	G	86.2	Confident	83.4	Confident	12 Å²	12	95.4 Å²	95.4	12%	0.124	51%	0.509	C	S	.	.	H	α-helix	trans	-62.6	-43.9	174.7	0	0	0	0	0	112.7	K6 M7 I8 A13 L14	K6-G10 PolarHBondContact O-N 3.39Å; M7-G10 PolarHBondContact O-N 3.04Å; I8-G10 VanDerWaalsContact C-N 3.32Å; I8-G10 PolarHBondContact O-N 3.39Å; G10-A13 PolarHBondContact O-N 2.93Å; G10-L14 WeakPolarHBondContact O-CB 3.41Å; G10-L14 PolarHBondContact O-N 3.46Å
11	L	91.5	Very high	82.5	Confident	91 Å²	91	93.9 Å²	93.9	48%	0.476	51%	0.505	S	S	.	.	H	α-helix	trans	-65.2	-39.7	175.8	-72.3	170.2	0	0	0	112.2	M7 I8 L14 L15	M7-L11 HydrophobicContact CG-CD1 4.26Å; M7-L11 WeakPolarHBondContact O-CG 3.48Å; M7-L11 PolarHBondContact O-N 3.19Å; I8-L11 PolarHBondContact O-N 3.45Å; L11-L14 PolarHBondContact O-N 3.38Å; L11-L15 WeakPolarHBondContact O-CB 3.36Å; L11-L15 VanDerWaalsContact O-CG 3.32Å; L11-L15 WeakPolarHBondContact O-CG 3.5Å; L11-L15 PolarHBondContact O-N 2.97Å
12	Q	88.5	Confident	82.1	Confident	116 Å²	116	91.7 Å²	91.7	54%	0.542	49%	0.493	S	S	.	.	H	α-helix	trans	-62.1	-45.8	175.5	-77.9	-179.4	-39.7	0	0	111.7	I8 S9 L15 L16	I8-Q12 WeakPolarHBondContact O-CG 3.46Å; I8-Q12 PolarHBondContact O-N 2.99Å; S9-Q12 PolarHBondContact O-N 3.43Å; Q12-L15 PolarHBondContact O-N 2.93Å; Q12-L16 WeakPolarHBondContact O-CB 3.39Å; Q12-L16 VanDerWaalsContact O-CG 3.28Å; Q12-L16 WeakPolarHBondContact O-CG 3.36Å; Q12-L16 PolarHBondContact O-N 2.75Å
13	A	77.8	Confident	80.9	Confident	16 Å²	16	89 Å²	89	13%	0.132	48%	0.482	C	S	.	.	H	α-helix	trans	-62.4	-43.3	176.3	0	0	0	0	0	111.7	S9 G10 L15 L16 N17 S19 P21	S9-A13 PolarHBondContact O-N 3.29Å; G10-A13 PolarHBondContact O-N 2.93Å; A13-L15 VanDerWaalsContact C-N 3.35Å; A13-L15 PolarHBondContact O-N 3.07Å; A13-L16 PolarHBondContact O-N 2.81Å; A13-N17 WeakPolarHBondContact O-CA 3.41Å; A13-N17 VanDerWaalsContact O-CB 3.29Å; A13-N17 WeakPolarHBondContact O-CB 3.42Å; A13-N17 PolarHBondContact O-N 3.44Å; A13-S19 CarbonylContact C-O 3.57Å; A13-P21 HydrophobicContact CB-CG 3.86Å
14	L	84	Confident	79.5	Confident	72 Å²	72	86.5 Å²	86.5	38%	0.377	47%	0.471	S	S	.	.	H	α-helix	trans	-61.3	-42.1	177.7	-177.5	63.6	0	0	0	112.4	G10 L11 G18 S19 L20	G10-L14 WeakPolarHBondContact O-CB 3.41Å; G10-L14 PolarHBondContact O-N 3.46Å; L11-L14 PolarHBondContact O-N 3.38Å; L14-G18 WeakPolarHBondContact O-CA 3.46Å; L14-G18 PolarHBondContact O-N 3.32Å; L14-S19 WeakPolarHBondContact CA-O 3.19Å; L14-L20 HydrophobicContact CB-CD2 4.41Å
15	L	86.8	Confident	77.7	Confident	150 Å²	150	92.1 Å²	92.1	79%	0.785	49%	0.489	S	S	*	.	H	α-helix	trans	-71.5	-33.7	179.7	-71.8	170.4	0	0	0	113	L11 Q12 A13	L11-L15 WeakPolarHBondContact O-CB 3.36Å; L11-L15 VanDerWaalsContact O-CG 3.32Å; L11-L15 WeakPolarHBondContact O-CG 3.5Å; L11-L15 PolarHBondContact O-N 2.97Å; Q12-L15 PolarHBondContact O-N 2.93Å; A13-L15 VanDerWaalsContact C-N 3.35Å; A13-L15 PolarHBondContact O-N 3.07Å
16	L	81.1	Confident	75.9	Confident	144 Å²	144	95.6 Å²	95.6	75%	0.754	51%	0.507	S	S	*	.	H	α-helix	trans	-84.4	-42.9	-178.4	-70.1	170.8	0	0	0	112.6	Q12 A13	Q12-L16 WeakPolarHBondContact O-CB 3.39Å; Q12-L16 VanDerWaalsContact O-CG 3.28Å; Q12-L16 WeakPolarHBondContact O-CG 3.36Å; Q12-L16 PolarHBondContact O-N 2.75Å; A13-L16 PolarHBondContact O-N 2.81Å
17	N	78.9	Confident	74.3	Confident	103 Å²	103	98.1 Å²	98.1	55%	0.551	51%	0.513	S	S	*	.	H	α-helix	trans	-108.3	-12.8	-169.4	-55.8	-16.8	0	0	0	112.8	A13 S19	A13-N17 WeakPolarHBondContact O-CA 3.41Å; A13-N17 VanDerWaalsContact O-CB 3.29Å; A13-N17 WeakPolarHBondContact O-CB 3.42Å; A13-N17 PolarHBondContact O-N 3.44Å; N17-S19 VanDerWaalsContact C-N 3.28Å; N17-S19 PolarHBondContact O-N 3.09Å
18	G	72.1	Confident	72.5	Confident	62 Å²	62	97.4 Å²	97.4	64%	0.639	52%	0.517	S	S	*	.	S	Bend	trans	78.4	5.8	-179	0	0	0	0	0	115	L14	L14-G18 WeakPolarHBondContact O-CA 3.46Å; L14-G18 PolarHBondContact O-N 3.32Å
19	S	75.2	Confident	70.7	Confident	31 Å²	31	98.6 Å²	98.6	22%	0.217	52%	0.524	C	S	.	.	S	Bend	trans	-145.7	155.2	178.7	54.1	0	0	0	0	111.7	A13 L14 N17	A13-S19 CarbonylContact C-O 3.57Å; L14-S19 WeakPolarHBondContact CA-O 3.19Å; N17-S19 VanDerWaalsContact C-N 3.28Å; N17-S19 PolarHBondContact O-N 3.09Å
20	L	76.3	Confident	69.4	Low	71 Å²	71	97.8 Å²	97.8	37%	0.372	52%	0.522	S	S	.	.			trans	-75.7	152.4	170.4	-72.2	161.8	0	0	0	109.8	L14 E22 D23 E24	L14-L20 HydrophobicContact CB-CD2 4.41Å; L20-E22 PolarHBondContact O-N 3.29Å; L20-E22 VanDerWaalsContact O-N 3.17Å; L20-D23 WeakPolarHBondContact CB-OD2 3.37Å; L20-D23 PolarHBondContact N-OD2 3.06Å; L20-D23 WeakPolarHBondContact O-CA 3.36Å; L20-D23 VanDerWaalsContact O-CB 3.3Å; L20-D23 WeakPolarHBondContact O-CB 3.45Å; L20-D23 PolarHBondContact O-N 3.07Å; L20-E24 PolarHBondContact O-N 3.41Å
21	P	64.6	Low	68	Low	64 Å²	64	99.8 Å²	99.8	42%	0.416	53%	0.529	S	S	.	.	G	3₁₀ helix	trans	-59.2	-28.1	176.3	-21.6	31.7	0	0	0	113.3	A13 D23 E24	A13-P21 HydrophobicContact CB-CG 3.86Å; P21-D23 PolarHBondContact O-N 3.42Å; P21-E24 PolarHBondContact O-N 2.96Å
22	E	63.8	Low	66.5	Low	134 Å²	134	100.4 Å²	100.4	63%	0.626	54%	0.54	S	S	*	.	G	3₁₀ helix	trans	-74.3	-16.2	176.3	-57.4	-178	-178.6	0	0	111.8	K6 L20	K6-E22 IonicContact NZ-OE1 2.85Å; K6-E22 PolarHBondContact NZ-OE1 3.29Å; L20-E22 PolarHBondContact O-N 3.29Å; L20-E22 VanDerWaalsContact O-N 3.17Å
23	D	59.7	Low	65.5	Low	68 Å²	68	100.6 Å²	100.6	36%	0.364	54%	0.541	S	S	.	.	G	3₁₀ helix	trans	-88.6	-10.7	172.4	-60.9	-47.7	0	0	0	113	L20 P21 Q25	L20-D23 WeakPolarHBondContact CB-OD2 3.37Å; L20-D23 PolarHBondContact N-OD2 3.06Å; L20-D23 WeakPolarHBondContact O-CA 3.36Å; L20-D23 VanDerWaalsContact O-CB 3.3Å; L20-D23 WeakPolarHBondContact O-CB 3.45Å; L20-D23 PolarHBondContact O-N 3.07Å; P21-D23 PolarHBondContact O-N 3.42Å; D23-Q25 VanDerWaalsContact C-N 3.34Å
24	E	55.3	Low	64.8	Low	117 Å²	117	106.4 Å²	106.4	55%	0.547	58%	0.577	S	S	.	*	S	Bend	trans	-81.6	-16.1	177.5	-64.8	-175.8	162.7	0	0	112.3	L20 P21 E26	L20-E24 PolarHBondContact O-N 3.41Å; P21-E24 PolarHBondContact O-N 2.96Å; E24-E26 PolarHBondContact O-N 3.09Å
25	Q	52.2	Low	64.2	Low	163 Å²	163	107.1 Å²	107.1	76%	0.762	60%	0.602	S	S	*	*	S	Bend	trans	-78.1	91.5	179.6	-157.5	172.6	1	0	0	109.5	D23	D23-Q25 VanDerWaalsContact C-N 3.34Å
26	E	48.8	Very low	63.5	Low	174 Å²	174	102.6 Å²	102.6	81%	0.813	58%	0.58	S	S	*	*			trans	57.7	62.7	173.9	-57.1	-177	177.4	0	0	113.6	E24 P28	E24-E26 PolarHBondContact O-N 3.09Å; E26-P28 WeakPolarHBondContact O-CD 3.47Å
27	R	49.8	Very low	63.6	Low	190 Å²	190	98.6 Å²	98.6	72%	0.717	56%	0.56	S	S	*	*			trans	-69	113	140.8	-78	-167	-175.5	-177.7	4.3	105.6	L29	R27-L29 PolarHBondContact O-N 3.33Å
28	P	52.1	Low	63.7	Low	108 Å²	108	98.4 Å²	98.4	70%	0.701	56%	0.564	S	S	*	*			trans	-50.2	135.9	159.7	-16	30.9	0	0	0	105.3	E26 A30	E26-P28 WeakPolarHBondContact O-CD 3.47Å; P28-A30 PolarHBondContact O-N 2.9Å
29	L	54.3	Low	64.5	Low	115 Å²	115	102.1 Å²	102.1	60%	0.602	57%	0.565	S	S	*	*			trans	-48.3	115.7	162.6	-60.1	168.6	0	0	0	103.7	R27 L31	R27-L29 PolarHBondContact O-N 3.33Å; L29-L31 HydrophobicContact CB-CD1 3.77Å; L29-L31 HydrophobicContact CB-CG 3.78Å; L29-L31 HydrophobicContact CD1-CD1 4.04Å; L29-L31 PolarHBondContact O-N 3.45Å
30	A	57.7	Low	64.8	Low	53 Å²	53	106.1 Å²	106.1	44%	0.438	58%	0.58	S	S	.	*			trans	-65.8	26.3	-174	0	0	0	0	0	112.9	P28 C32 E33	P28-A30 PolarHBondContact O-N 2.9Å; A30-C32 PolarHBondContact O-N 3.35Å; A30-E33 HydrophobicContact CB-CG 4.06Å
31	L	56.9	Low	65.1	Low	53 Å²	53	103.6 Å²	103.6	28%	0.277	57%	0.566	S	S	.	*	T	Hydrogen-bonded Turn	trans	-60.8	122.8	162.9	-53.7	177	0	0	0	106.6	L29 I45	L29-L31 HydrophobicContact CB-CD1 3.77Å; L29-L31 HydrophobicContact CB-CG 3.78Å; L29-L31 HydrophobicContact CD1-CD1 4.04Å; L29-L31 PolarHBondContact O-N 3.45Å; L31-I45 HydrophobicContact CD1-CD1 4.04Å; L31-I45 HydrophobicContact CD1-CG1 3.73Å; L31-I45 HydrophobicContact CD2-CD1 3.85Å; L31-I45 HydrophobicContact CD2-CG1 3.42Å; L31-I45 VanDerWaalsContact CD2-CG1 3.42Å; L31-I45 HydrophobicContact CG-CD1 4.36Å; L31-I45 HydrophobicContact CG-CG1 4.15Å
32	C	61.2	Low	66.1	Low	105 Å²	105	105.9 Å²	105.9	71%	0.709	58%	0.575	S	S	*	*	T	Hydrogen-bonded Turn	trans	76	24.5	176.2	-49.1	0	0	0	0	115.5	A30	A30-C32 PolarHBondContact O-N 3.35Å
33	E	67.5	Low	67.2	Low	119 Å²	119	105.1 Å²	105.1	56%	0.556	57%	0.574	S	S	*	*			trans	-59.1	137.3	164.1	-74.4	-167.1	152.7	0	0	110.4	A30 G35 V36	A30-E33 HydrophobicContact CB-CG 4.06Å; E33-G35 PolarHBondContact O-N 2.9Å; E33-G35 VanDerWaalsContact O-N 3.15Å; E33-V36 HydrophobicContact CB-CG2 3.79Å; E33-V36 WeakPolarHBondContact O-CG2 3.29Å; E33-V36 PolarHBondContact O-N 3.47Å
34	P	63	Low	68.3	Low	139 Å²	139	105.6 Å²	105.6	90%	0.903	58%	0.575	S	S	*	*	T	Hydrogen-bonded Turn	trans	-57.2	120.9	178	-22.2	31.5	0	0	0	111.1
35	G	69.9	Low	69.7	Low	87 Å²	87	103.3 Å²	103.3	90%	0.897	57%	0.566	S	S	*	*	T	Hydrogen-bonded Turn	trans	103.2	-3.5	179.5	0	0	0	0	0	115.3	E33	E33-G35 PolarHBondContact O-N 2.9Å; E33-G35 VanDerWaalsContact O-N 3.15Å
36	V	72.3	Confident	71.5	Confident	54 Å²	54	99.8 Å²	99.8	33%	0.327	55%	0.55	S	S	.	.			trans	-84.7	132.7	175.5	-175.6	0	0	0	0	110.4	E33 P38 Q41	E33-V36 HydrophobicContact CB-CG2 3.79Å; E33-V36 WeakPolarHBondContact O-CG2 3.29Å; E33-V36 PolarHBondContact O-N 3.47Å; V36-P38 WeakPolarHBondContact O-CD 3.31Å; V36-Q41 HydrophobicContact CB-CG 4.23Å; V36-Q41 VanDerWaalsContact CB-NE2 3.29Å; V36-Q41 HydrophobicContact CG1-CG 3.34Å; V36-Q41 PolarHBondContact O-NE2 3.5Å
37	N	83.1	Confident	73.5	Confident	61 Å²	61	94.8 Å²	94.8	33%	0.326	53%	0.534	S	S	.	.			trans	-60.6	120.9	178.9	-178.8	-9.8	0	0	0	111.1	E39 E40 Q41	N37-E39 PolarHBondContact O-N 2.88Å; N37-E39 PolarHBondContact OD1-N 2.98Å; N37-E40 HydrophobicContact CB-CB 4.16Å; N37-E40 HydrophobicContact CB-CG 4Å; N37-E40 PolarHBondContact O-N 3.49Å; N37-Q41 WeakPolarHBondContact O-CG 3.4Å; N37-Q41 PolarHBondContact O-N 3.28Å; N37-Q41 VanDerWaalsContact O-N 3.08Å
38	P	82.7	Confident	75.4	Confident	98 Å²	98	91.1 Å²	91.1	64%	0.636	52%	0.52	S	S	*	.	H	α-helix	trans	-54.9	-33.6	178.6	-27.2	35	0	0	0	114.7	V36 L42	V36-P38 WeakPolarHBondContact O-CD 3.31Å; P38-L42 PolarHBondContact O-N 3.05Å
39	E	87.3	Confident	77.3	Confident	141 Å²	141	90.3 Å²	90.3	66%	0.659	51%	0.51	S	S	*	.	H	α-helix	trans	-71.1	-43.3	-179.4	-65.7	172.3	172.7	0	0	111.4	N37 Q41 L42 I43	N37-E39 PolarHBondContact O-N 2.88Å; N37-E39 PolarHBondContact OD1-N 2.98Å; E39-Q41 VanDerWaalsContact C-N 3.32Å; E39-Q41 PolarHBondContact O-N 3.25Å; E39-L42 WeakPolarHBondContact O-CB 3.5Å; E39-L42 PolarHBondContact O-N 2.95Å; E39-I43 WeakPolarHBondContact O-CG1 3.48Å; E39-I43 PolarHBondContact O-N 2.9Å
40	E	82.5	Confident	79.2	Confident	115 Å²	115	88.8 Å²	88.8	54%	0.537	50%	0.502	S	S	.	.	H	α-helix	trans	-65	-38.6	176.2	-67.5	174.1	171.7	0	0	111.2	N37 L42 I43 I44	N37-E40 HydrophobicContact CB-CB 4.16Å; N37-E40 HydrophobicContact CB-CG 4Å; N37-E40 PolarHBondContact O-N 3.49Å; E40-L42 VanDerWaalsContact C-N 3.34Å; E40-L42 PolarHBondContact O-N 2.9Å; E40-I43 PolarHBondContact O-N 3.29Å; E40-I44 WeakPolarHBondContact O-CG1 3.44Å; E40-I44 PolarHBondContact O-N 3.02Å; E40-I44 VanDerWaalsContact O-N 3.14Å
41	Q	82.9	Confident	81	Confident	17 Å²	17	91.1 Å²	91.1	8%	0.079	50%	0.504	C	S	.	.	H	α-helix	trans	-63.1	-41.1	174	-67.9	-175.1	48.2	0	0	112.4	V36 N37 E39 I43 I44 I45	V36-Q41 HydrophobicContact CB-CG 4.23Å; V36-Q41 VanDerWaalsContact CB-NE2 3.29Å; V36-Q41 HydrophobicContact CG1-CG 3.34Å; V36-Q41 PolarHBondContact O-NE2 3.5Å; N37-Q41 WeakPolarHBondContact O-CG 3.4Å; N37-Q41 PolarHBondContact O-N 3.28Å; N37-Q41 VanDerWaalsContact O-N 3.08Å; E39-Q41 VanDerWaalsContact C-N 3.32Å; E39-Q41 PolarHBondContact O-N 3.25Å; Q41-I43 VanDerWaalsContact C-N 3.27Å; Q41-I43 PolarHBondContact O-N 3.16Å; Q41-I44 PolarHBondContact O-N 3.16Å; Q41-I45 WeakPolarHBondContact O-CB 3.35Å; Q41-I45 VanDerWaalsContact O-CG1 3.25Å; Q41-I45 WeakPolarHBondContact O-CG1 3.48Å; Q41-I45 PolarHBondContact O-N 3.12Å
42	L	85.3	Confident	82.7	Confident	113 Å²	113	91.2 Å²	91.2	59%	0.592	51%	0.509	S	S	*	.	H	α-helix	trans	-60.8	-40.6	178.6	-175.8	63.7	0	0	0	111.1	P38 E39 E40 I45 Q46	P38-L42 PolarHBondContact O-N 3.05Å; E39-L42 WeakPolarHBondContact O-CB 3.5Å; E39-L42 PolarHBondContact O-N 2.95Å; E40-L42 VanDerWaalsContact C-N 3.34Å; E40-L42 PolarHBondContact O-N 2.9Å; L42-I45 PolarHBondContact O-N 3.03Å; L42-Q46 WeakPolarHBondContact O-CB 3.41Å; L42-Q46 PolarHBondContact O-N 2.93Å
43	I	85.8	Confident	84.4	Confident	118 Å²	118	90.8 Å²	90.8	61%	0.605	50%	0.498	S	S	*	.	H	α-helix	trans	-60.9	-46.5	175.6	-65.3	166.6	0	0	0	110.7	E39 E40 Q41 Q46 S47	E39-I43 WeakPolarHBondContact O-CG1 3.48Å; E39-I43 PolarHBondContact O-N 2.9Å; E40-I43 PolarHBondContact O-N 3.29Å; Q41-I43 VanDerWaalsContact C-N 3.27Å; Q41-I43 PolarHBondContact O-N 3.16Å; I43-Q46 PolarHBondContact O-N 3.34Å; I43-S47 WeakPolarHBondContact O-CB 3.44Å; I43-S47 PolarHBondContact O-N 3.38Å
44	I	83.7	Confident	85.8	Confident	77 Å²	77	91 Å²	91	40%	0.395	50%	0.499	S	S	.	.	H	α-helix	trans	-63.4	-43.8	178.9	-66	167	0	0	0	110.9	E40 Q41 S47 R48	E40-I44 WeakPolarHBondContact O-CG1 3.44Å; E40-I44 PolarHBondContact O-N 3.02Å; E40-I44 VanDerWaalsContact O-N 3.14Å; Q41-I44 PolarHBondContact O-N 3.16Å; I44-S47 PolarHBondContact O-N 3.48Å; I44-R48 WeakPolarHBondContact O-CB 3.45Å; I44-R48 VanDerWaalsContact O-CG 3.3Å; I44-R48 WeakPolarHBondContact O-CG 3.32Å; I44-R48 PolarHBondContact O-N 3.31Å
45	I	84.9	Confident	87.4	Confident	69 Å²	69	89 Å²	89	35%	0.354	48%	0.477	S	S	.	.	H	α-helix	trans	-61.3	-47.4	177.8	-69.5	167.8	0	0	0	110.2	L31 Q41 L42 R48 L49	L31-I45 HydrophobicContact CD1-CD1 4.04Å; L31-I45 HydrophobicContact CD1-CG1 3.73Å; L31-I45 HydrophobicContact CD2-CD1 3.85Å; L31-I45 HydrophobicContact CD2-CG1 3.42Å; L31-I45 VanDerWaalsContact CD2-CG1 3.42Å; L31-I45 HydrophobicContact CG-CD1 4.36Å; L31-I45 HydrophobicContact CG-CG1 4.15Å; Q41-I45 WeakPolarHBondContact O-CB 3.35Å; Q41-I45 VanDerWaalsContact O-CG1 3.25Å; Q41-I45 WeakPolarHBondContact O-CG1 3.48Å; Q41-I45 PolarHBondContact O-N 3.12Å; L42-I45 PolarHBondContact O-N 3.03Å; I45-R48 PolarHBondContact O-N 2.92Å; I45-L49 WeakPolarHBondContact O-CB 3.43Å; I45-L49 PolarHBondContact O-N 2.96Å
46	Q	90.3	Very high	88.7	Confident	89 Å²	89	88.6 Å²	88.6	42%	0.416	46%	0.455	S	S	.	.	H	α-helix	trans	-61.4	-47.9	179.9	-173.4	61.5	57.4	0	0	111.2	L42 I43 R48 L49 D50	L42-Q46 WeakPolarHBondContact O-CB 3.41Å; L42-Q46 PolarHBondContact O-N 2.93Å; I43-Q46 PolarHBondContact O-N 3.34Å; Q46-R48 VanDerWaalsContact C-N 3.31Å; Q46-R48 PolarHBondContact O-N 2.94Å; Q46-L49 WeakPolarHBondContact O-CB 3.44Å; Q46-L49 PolarHBondContact O-N 3.48Å; Q46-L49 VanDerWaalsContact O-N 3.16Å; Q46-D50 PolarHBondContact NE2-OD1 3.33Å; Q46-D50 PolarHBondContact NE2-OD2 3.37Å; Q46-D50 VanDerWaalsContact O-CG 3.23Å; Q46-D50 PolarHBondContact O-N 3.4Å
47	S	89.9	Confident	90	Very high	70 Å²	70	91.1 Å²	91.1	49%	0.49	46%	0.463	S	S	.	.	H	α-helix	trans	-59	-41.4	178.2	174.3	0	0	0	0	112.5	I43 I44 D50 Q51	I43-S47 WeakPolarHBondContact O-CB 3.44Å; I43-S47 PolarHBondContact O-N 3.38Å; I44-S47 PolarHBondContact O-N 3.48Å; S47-D50 PolarHBondContact O-N 2.88Å; S47-Q51 WeakPolarHBondContact O-CB 3.32Å; S47-Q51 PolarHBondContact O-N 2.86Å
48	R	89.6	Confident	90.7	Very high	113 Å²	113	92 Å²	92	43%	0.426	47%	0.468	S	S	.	.	H	α-helix	trans	-67.7	-38.4	177.2	-73.7	173.9	177.8	176.6	0.2	112.3	I44 I45 Q46 S52	I44-R48 WeakPolarHBondContact O-CB 3.45Å; I44-R48 VanDerWaalsContact O-CG 3.3Å; I44-R48 WeakPolarHBondContact O-CG 3.32Å; I44-R48 PolarHBondContact O-N 3.31Å; I45-R48 PolarHBondContact O-N 2.92Å; Q46-R48 VanDerWaalsContact C-N 3.31Å; Q46-R48 PolarHBondContact O-N 2.94Å; R48-S52 WeakPolarHBondContact O-CB 3.5Å; R48-S52 PolarHBondContact O-N 3.49Å
49	L	92.4	Very high	91.4	Very high	91 Å²	91	93 Å²	93	48%	0.476	47%	0.467	S	S	.	.	H	α-helix	trans	-63.9	-46.6	176.2	179.4	61.7	0	0	0	110.6	I45 Q46 Q51 S52 M53	I45-L49 WeakPolarHBondContact O-CB 3.43Å; I45-L49 PolarHBondContact O-N 2.96Å; Q46-L49 WeakPolarHBondContact O-CB 3.44Å; Q46-L49 PolarHBondContact O-N 3.48Å; Q46-L49 VanDerWaalsContact O-N 3.16Å; L49-Q51 PolarHBondContact O-N 3.03Å; L49-S52 PolarHBondContact O-N 3.33Å; L49-M53 HydrophobicContact CD1-CG 4.45Å; L49-M53 HydrophobicContact CG-SD 4.37Å; L49-M53 WeakPolarHBondContact O-CB 3.39Å; L49-M53 WeakPolarHBondContact O-CG 3.38Å; L49-M53 PolarHBondContact O-N 3.17Å
50	D	95.3	Very high	92	Very high	82 Å²	82	92.5 Å²	92.5	44%	0.439	46%	0.463	S	S	.	.	H	α-helix	trans	-60.6	-46.4	178.4	-65.5	-21.4	0	0	0	110.9	Q46 S47 M53 E54	Q46-D50 PolarHBondContact NE2-OD1 3.33Å; Q46-D50 PolarHBondContact NE2-OD2 3.37Å; Q46-D50 VanDerWaalsContact O-CG 3.23Å; Q46-D50 PolarHBondContact O-N 3.4Å; S47-D50 PolarHBondContact O-N 2.88Å; D50-M53 WeakPolarHBondContact O-CB 3.39Å; D50-M53 PolarHBondContact O-N 2.89Å; D50-E54 PolarHBondContact O-N 2.95Å
51	Q	94.7	Very high	92.7	Very high	103 Å²	103	92.9 Å²	92.9	48%	0.481	46%	0.462	S	S	.	.	H	α-helix	trans	-58.4	-50	174.9	-178.5	-177.8	-5.1	0	0	111.8	S47 L49 M53 E54 E55	S47-Q51 WeakPolarHBondContact O-CB 3.32Å; S47-Q51 PolarHBondContact O-N 2.86Å; L49-Q51 PolarHBondContact O-N 3.03Å; Q51-M53 VanDerWaalsContact C-N 3.25Å; Q51-M53 PolarHBondContact O-N 3.48Å; Q51-E54 PolarHBondContact O-N 3.23Å; Q51-E54 VanDerWaalsContact O-N 3.16Å; Q51-E55 WeakPolarHBondContact CG-OE1 3.36Å; Q51-E55 PolarHBondContact NE2-OE1 3.19Å; Q51-E55 WeakPolarHBondContact O-CG 3.48Å; Q51-E55 PolarHBondContact O-N 2.97Å
52	S	92.3	Very high	93.5	Very high	55 Å²	55	96.5 Å²	96.5	39%	0.385	48%	0.479	S	S	.	.	H	α-helix	trans	-63.9	-32.4	-179.3	-174.3	0	0	0	0	112.5	R48 L49 N56	R48-S52 WeakPolarHBondContact O-CB 3.5Å; R48-S52 PolarHBondContact O-N 3.49Å; L49-S52 PolarHBondContact O-N 3.33Å; S52-N56 WeakPolarHBondContact O-CB 3.3Å; S52-N56 PolarHBondContact O-N 3.24Å; S52-N56 PolarHBondContact O-ND2 3.04Å; S52-N56 VanDerWaalsContact O-ND2 3.12Å
53	M	96.9	Very high	94.1	Very high	96 Å²	96	95.7 Å²	95.7	47%	0.473	48%	0.475	S	S	.	.	H	α-helix	trans	-67.2	-43.1	173.8	-80.2	-176.2	42.3	0	0	112.1	L49 D50 Q51 N56 Q57	L49-M53 HydrophobicContact CD1-CG 4.45Å; L49-M53 HydrophobicContact CG-SD 4.37Å; L49-M53 WeakPolarHBondContact O-CB 3.39Å; L49-M53 WeakPolarHBondContact O-CG 3.38Å; L49-M53 PolarHBondContact O-N 3.17Å; D50-M53 WeakPolarHBondContact O-CB 3.39Å; D50-M53 PolarHBondContact O-N 2.89Å; Q51-M53 VanDerWaalsContact C-N 3.25Å; Q51-M53 PolarHBondContact O-N 3.48Å; M53-N56 PolarHBondContact O-N 3.08Å; M53-Q57 WeakPolarHBondContact O-CG 3.49Å; M53-Q57 PolarHBondContact O-N 3.14Å; M53-Q57 VanDerWaalsContact O-N 3.09Å
54	E	97.3	Very high	94.7	Very high	123 Å²	123	95.5 Å²	95.5	58%	0.575	47%	0.474	S	S	*	.	H	α-helix	trans	-62.5	-51.2	175.9	-176.9	172	-155.2	0	0	111.2	D50 Q51 N56 Q57 D58	D50-E54 PolarHBondContact O-N 2.95Å; Q51-E54 PolarHBondContact O-N 3.23Å; Q51-E54 VanDerWaalsContact O-N 3.16Å; E54-N56 VanDerWaalsContact C-N 3.26Å; E54-N56 PolarHBondContact O-N 3.2Å; E54-Q57 WeakPolarHBondContact O-CA 3.44Å; E54-Q57 WeakPolarHBondContact O-CB 3.4Å; E54-Q57 PolarHBondContact O-N 3.19Å; E54-D58 PolarHBondContact O-N 3.17Å
55	E	96.6	Very high	95.4	Very high	98 Å²	98	96.5 Å²	96.5	46%	0.458	48%	0.476	S	S	.	.	H	α-helix	trans	-55.5	-42.2	176.4	-70.5	172.5	-174.2	0	0	111.6	Q51 Q57 D58 L59	Q51-E55 WeakPolarHBondContact CG-OE1 3.36Å; Q51-E55 PolarHBondContact NE2-OE1 3.19Å; Q51-E55 WeakPolarHBondContact O-CG 3.48Å; Q51-E55 PolarHBondContact O-N 2.97Å; E55-Q57 VanDerWaalsContact C-N 3.33Å; E55-Q57 PolarHBondContact O-N 2.65Å; E55-D58 PolarHBondContact O-N 2.98Å; E55-L59 VanDerWaalsContact O-CG 3.32Å; E55-L59 WeakPolarHBondContact O-CG 3.25Å; E55-L59 PolarHBondContact O-N 3.15Å
56	N	97.3	Very high	96	Very high	78 Å²	78	96.2 Å²	96.2	42%	0.417	48%	0.48	S	S	.	.	H	α-helix	trans	-62.6	-37.1	175.6	-104	-77	0	0	0	113.3	S52 M53 E54 K60	S52-N56 WeakPolarHBondContact O-CB 3.3Å; S52-N56 PolarHBondContact O-N 3.24Å; S52-N56 PolarHBondContact O-ND2 3.04Å; S52-N56 VanDerWaalsContact O-ND2 3.12Å; M53-N56 PolarHBondContact O-N 3.08Å; E54-N56 VanDerWaalsContact C-N 3.26Å; E54-N56 PolarHBondContact O-N 3.2Å; N56-K60 VanDerWaalsContact O-CG 3.29Å; N56-K60 WeakPolarHBondContact O-CG 3.48Å; N56-K60 PolarHBondContact O-N 3.42Å
57	Q	98.4	Very high	96.3	Very high	107 Å²	107	97.6 Å²	97.6	50%	0.5	48%	0.484	S	S	.	.	H	α-helix	trans	-67.1	-41.3	177.2	-72	177.7	21	0	0	110.9	M53 E54 E55 K60 K61	M53-Q57 WeakPolarHBondContact O-CG 3.49Å; M53-Q57 PolarHBondContact O-N 3.14Å; M53-Q57 VanDerWaalsContact O-N 3.09Å; E54-Q57 WeakPolarHBondContact O-CA 3.44Å; E54-Q57 WeakPolarHBondContact O-CB 3.4Å; E54-Q57 PolarHBondContact O-N 3.19Å; E55-Q57 VanDerWaalsContact C-N 3.33Å; E55-Q57 PolarHBondContact O-N 2.65Å; Q57-K60 WeakPolarHBondContact O-CB 3.28Å; Q57-K60 PolarHBondContact O-N 2.83Å; Q57-K61 WeakPolarHBondContact O-CG 3.29Å; Q57-K61 PolarHBondContact O-N 3.23Å
58	D	98.2	Very high	96.7	Very high	80 Å²	80	98.1 Å²	98.1	43%	0.428	48%	0.479	S	S	.	.	H	α-helix	trans	-67.7	-42.1	178.1	-73.1	-15.8	0	0	0	112.2	E54 E55 K60 K61 E62	E54-D58 PolarHBondContact O-N 3.17Å; E55-D58 PolarHBondContact O-N 2.98Å; D58-K60 VanDerWaalsContact C-N 3.28Å; D58-K60 PolarHBondContact O-N 3.03Å; D58-K61 WeakPolarHBondContact O-CB 3.48Å; D58-K61 PolarHBondContact O-N 3.44Å; D58-K61 VanDerWaalsContact O-N 3.09Å; D58-K61 IonicContact OD1-NZ 2.75Å; D58-K61 PolarHBondContact OD1-NZ 2.79Å; D58-E62 PolarHBondContact O-N 3.48Å
59	L	98.3	Very high	97	Very high	118 Å²	118	97 Å²	97	62%	0.618	48%	0.478	S	S	*	.	H	α-helix	trans	-58.5	-39.8	172.1	-71.9	173.1	0	0	0	112.3	E55 E62 L63	E55-L59 VanDerWaalsContact O-CG 3.32Å; E55-L59 WeakPolarHBondContact O-CG 3.25Å; E55-L59 PolarHBondContact O-N 3.15Å; L59-E62 PolarHBondContact O-N 3.31Å; L59-L63 VanDerWaalsContact O-CB 3.31Å; L59-L63 WeakPolarHBondContact O-CB 3.39Å; L59-L63 PolarHBondContact O-N 3.33Å
60	K	98.6	Very high	97.2	Very high	131 Å²	131	94.9 Å²	94.9	57%	0.57	47%	0.474	S	S	*	.	H	α-helix	trans	-63.1	-40.6	174.9	-77.4	171.6	-175.7	173.3	0	112	N56 Q57 D58 L64	N56-K60 VanDerWaalsContact O-CG 3.29Å; N56-K60 WeakPolarHBondContact O-CG 3.48Å; N56-K60 PolarHBondContact O-N 3.42Å; Q57-K60 WeakPolarHBondContact O-CB 3.28Å; Q57-K60 PolarHBondContact O-N 2.83Å; D58-K60 VanDerWaalsContact C-N 3.28Å; D58-K60 PolarHBondContact O-N 3.03Å; K60-L64 WeakPolarHBondContact O-CG 3.48Å; K60-L64 PolarHBondContact O-N 3.41Å; K60-L64 VanDerWaalsContact O-N 3.07Å
61	K	98.7	Very high	97.2	Very high	123 Å²	123	97.7 Å²	97.7	54%	0.535	48%	0.478	S	S	.	.	H	α-helix	trans	-62.5	-48.2	176.2	-67.1	169	-163.6	157.6	0	110.6	Q57 D58 L63 L64 K65	Q57-K61 WeakPolarHBondContact O-CG 3.29Å; Q57-K61 PolarHBondContact O-N 3.23Å; D58-K61 WeakPolarHBondContact O-CB 3.48Å; D58-K61 PolarHBondContact O-N 3.44Å; D58-K61 VanDerWaalsContact O-N 3.09Å; D58-K61 IonicContact OD1-NZ 2.75Å; D58-K61 PolarHBondContact OD1-NZ 2.79Å; K61-L63 VanDerWaalsContact C-N 3.34Å; K61-L63 PolarHBondContact O-N 3Å; K61-L64 PolarHBondContact O-N 3.39Å; K61-K65 PolarHBondContact O-N 3.01Å
62	E	98.6	Very high	97.2	Very high	93 Å²	93	97 Å²	97	44%	0.435	48%	0.478	S	S	.	.	H	α-helix	trans	-65.5	-39	-179.3	-157.9	61.6	-153.4	0	0	111.4	D58 L59 L64 K65 C66	D58-E62 PolarHBondContact O-N 3.48Å; L59-E62 PolarHBondContact O-N 3.31Å; E62-L64 VanDerWaalsContact C-N 3.34Å; E62-L64 PolarHBondContact O-N 3.4Å; E62-K65 WeakPolarHBondContact O-CB 3.45Å; E62-K65 PolarHBondContact O-N 3.39Å; E62-K65 IonicContact OE1-NZ 2.81Å; E62-K65 PolarHBondContact OE1-NZ 2.93Å; E62-K65 IonicContact OE2-NZ 3.83Å; E62-C66 PolarHBondContact O-N 2.88Å; E62-C66 PolarHBondContact O-SG 3.17Å; E62-C66 VanDerWaalsContact O-SG 3.35Å
63	L	98.4	Very high	97.3	Very high	95 Å²	95	100.5 Å²	100.5	50%	0.497	49%	0.492	S	S	.	.	H	α-helix	trans	-59.3	-43	173.9	178.3	63.4	0	0	0	112.3	L59 K61 K65 C66 K67	L59-L63 VanDerWaalsContact O-CB 3.31Å; L59-L63 WeakPolarHBondContact O-CB 3.39Å; L59-L63 PolarHBondContact O-N 3.33Å; K61-L63 VanDerWaalsContact C-N 3.34Å; K61-L63 PolarHBondContact O-N 3Å; L63-K65 VanDerWaalsContact C-N 3.33Å; L63-C66 PolarHBondContact O-N 2.91Å; L63-K67 WeakPolarHBondContact O-CB 3.3Å; L63-K67 WeakPolarHBondContact O-CG 3.12Å; L63-K67 PolarHBondContact O-N 3.44Å
64	L	98.4	Very high	96.9	Very high	114 Å²	114	103.3 Å²	103.3	60%	0.597	50%	0.504	S	S	*	.	H	α-helix	trans	-64.5	-40.4	177.6	-73.7	172.8	0	0	0	111.7	K60 K61 E62 K67 Q68	K60-L64 WeakPolarHBondContact O-CG 3.48Å; K60-L64 PolarHBondContact O-N 3.41Å; K60-L64 VanDerWaalsContact O-N 3.07Å; K61-L64 PolarHBondContact O-N 3.39Å; E62-L64 VanDerWaalsContact C-N 3.34Å; E62-L64 PolarHBondContact O-N 3.4Å; L64-K67 PolarHBondContact O-N 2.97Å; L64-Q68 PolarHBondContact O-N 3.42Å
65	K	98.3	Very high	96	Very high	99 Å²	99	100.6 Å²	100.6	43%	0.43	51%	0.508	S	S	.	.	H	α-helix	trans	-61.1	-50.9	174.8	178.8	178.9	157.1	-144.5	0	111.2	K61 E62 L63 K67 Q68 E69	K61-K65 PolarHBondContact O-N 3.01Å; E62-K65 WeakPolarHBondContact O-CB 3.45Å; E62-K65 PolarHBondContact O-N 3.39Å; E62-K65 IonicContact OE1-NZ 2.81Å; E62-K65 PolarHBondContact OE1-NZ 2.93Å; E62-K65 IonicContact OE2-NZ 3.83Å; L63-K65 VanDerWaalsContact C-N 3.33Å; K65-K67 VanDerWaalsContact C-N 3.3Å; K65-K67 PolarHBondContact O-N 2.9Å; K65-Q68 WeakPolarHBondContact O-CB 3.16Å; K65-Q68 PolarHBondContact O-N 3.47Å; K65-E69 WeakPolarHBondContact CE-OE1 3.44Å; K65-E69 WeakPolarHBondContact CG-OE1 3.49Å; K65-E69 WeakPolarHBondContact O-CG 3.32Å; K65-E69 PolarHBondContact O-N 2.85Å
66	C	97.8	Very high	94.3	Very high	63 Å²	63	102.4 Å²	102.4	43%	0.426	52%	0.52	S	S	.	.	H	α-helix	trans	-56.4	-41.8	175.3	-69.6	0	0	0	0	112.4	E62 L63 Q68 E69 A70	E62-C66 PolarHBondContact O-N 2.88Å; E62-C66 PolarHBondContact O-SG 3.17Å; E62-C66 VanDerWaalsContact O-SG 3.35Å; L63-C66 PolarHBondContact O-N 2.91Å; C66-Q68 VanDerWaalsContact C-N 3.32Å; C66-Q68 PolarHBondContact O-N 2.94Å; C66-E69 PolarHBondContact O-N 3.22Å; C66-A70 WeakPolarHBondContact O-CB 3.43Å; C66-A70 PolarHBondContact O-N 3.28Å
67	K	97.4	Very high	92.3	Very high	118 Å²	118	111.3 Å²	111.3	51%	0.513	56%	0.555	S	S	.	*	H	α-helix	trans	-64.4	-34	175.6	-77.3	-179.2	177.6	-178.9	0	113	L63 L64 K65 R71	L63-K67 WeakPolarHBondContact O-CB 3.3Å; L63-K67 WeakPolarHBondContact O-CG 3.12Å; L63-K67 PolarHBondContact O-N 3.44Å; L64-K67 PolarHBondContact O-N 2.97Å; K65-K67 VanDerWaalsContact C-N 3.3Å; K65-K67 PolarHBondContact O-N 2.9Å; K67-R71 WeakPolarHBondContact O-CG 3.41Å; K67-R71 PolarHBondContact O-N 3.17Å; K67-R71 PolarHBondContact O-NE 2.9Å
68	Q	97.1	Very high	92	Very high	80 Å²	80	111.5 Å²	111.5	37%	0.374	56%	0.558	S	S	.	*	H	α-helix	trans	-72.5	-44.6	175.7	-175.1	60.7	59.2	0	0	111	L64 K65 C66 A70 R71 N72	L64-Q68 PolarHBondContact O-N 3.42Å; K65-Q68 WeakPolarHBondContact O-CB 3.16Å; K65-Q68 PolarHBondContact O-N 3.47Å; C66-Q68 VanDerWaalsContact C-N 3.32Å; C66-Q68 PolarHBondContact O-N 2.94Å; Q68-A70 VanDerWaalsContact C-N 3.34Å; Q68-A70 PolarHBondContact O-N 3.19Å; Q68-R71 PolarHBondContact O-N 3.48Å; Q68-R71 VanDerWaalsContact OE1-CZ 3.25Å; Q68-N72 PolarHBondContact NE2-OD1 2.93Å; Q68-N72 PolarHBondContact O-N 3.33Å; Q68-N72 PolarHBondContact O-OD1 3.2Å
69	E	96.6	Very high	91.6	Very high	90 Å²	90	113.2 Å²	113.2	42%	0.421	56%	0.564	S	S	.	*	H	α-helix	trans	-58.8	-44.7	176	-70.5	173.6	-172.3	0	0	111.7	K65 C66 R71 N72 L73	K65-E69 WeakPolarHBondContact CE-OE1 3.44Å; K65-E69 WeakPolarHBondContact CG-OE1 3.49Å; K65-E69 WeakPolarHBondContact O-CG 3.32Å; K65-E69 PolarHBondContact O-N 2.85Å; C66-E69 PolarHBondContact O-N 3.22Å; E69-R71 VanDerWaalsContact C-N 3.33Å; E69-R71 PolarHBondContact O-N 2.95Å; E69-N72 WeakPolarHBondContact O-CB 3.33Å; E69-N72 PolarHBondContact O-N 2.89Å; E69-N72 VanDerWaalsContact O-N 3.15Å; E69-L73 WeakPolarHBondContact O-CG 3.19Å; E69-L73 PolarHBondContact O-N 2.76Å
70	A	96	Very high	91.3	Very high	46 Å²	46	112.9 Å²	112.9	38%	0.38	56%	0.561	S	S	.	*	H	α-helix	trans	-59	-42.1	175.8	0	0	0	0	0	112.6	C66 Q68 L73 Q74	C66-A70 WeakPolarHBondContact O-CB 3.43Å; C66-A70 PolarHBondContact O-N 3.28Å; Q68-A70 VanDerWaalsContact C-N 3.34Å; Q68-A70 PolarHBondContact O-N 3.19Å; A70-L73 PolarHBondContact O-N 3.42Å; A70-Q74 WeakPolarHBondContact O-CG 3.43Å; A70-Q74 PolarHBondContact O-N 3.33Å
71	R	95.3	Very high	90.9	Very high	141 Å²	141	111.8 Å²	111.8	53%	0.532	56%	0.561	S	S	.	*	H	α-helix	trans	-65.3	-41.1	175	-77.4	-177.4	-72.8	155.5	-0.3	112	K67 Q68 E69 L73 Q74 G75	K67-R71 WeakPolarHBondContact O-CG 3.41Å; K67-R71 PolarHBondContact O-N 3.17Å; K67-R71 PolarHBondContact O-NE 2.9Å; Q68-R71 PolarHBondContact O-N 3.48Å; Q68-R71 VanDerWaalsContact OE1-CZ 3.25Å; E69-R71 VanDerWaalsContact C-N 3.33Å; E69-R71 PolarHBondContact O-N 2.95Å; R71-L73 VanDerWaalsContact C-N 3.35Å; R71-Q74 PolarHBondContact O-N 3.38Å; R71-G75 PolarHBondContact O-N 3.44Å
72	N	94.1	Very high	90.4	Very high	89 Å²	89	111.1 Å²	111.1	48%	0.476	56%	0.563	S	S	.	*	H	α-helix	trans	-61.3	-45.1	177.4	-65.9	-9.3	0	0	0	110.8	Q68 E69 Q74 G75 I76	Q68-N72 PolarHBondContact NE2-OD1 2.93Å; Q68-N72 PolarHBondContact O-N 3.33Å; Q68-N72 PolarHBondContact O-OD1 3.2Å; E69-N72 WeakPolarHBondContact O-CB 3.33Å; E69-N72 PolarHBondContact O-N 2.89Å; E69-N72 VanDerWaalsContact O-N 3.15Å; N72-Q74 PolarHBondContact O-N 3.47Å; N72-G75 PolarHBondContact O-N 3.16Å; N72-I76 WeakPolarHBondContact O-CG1 3.36Å; N72-I76 PolarHBondContact O-N 3.48Å
73	L	94.3	Very high	89.8	Confident	129 Å²	129	112.3 Å²	112.3	68%	0.675	57%	0.571	S	S	*	*	H	α-helix	trans	-62.8	-39.4	177.1	-69.8	172.3	0	0	0	112.5	E69 A70 R71 G75	E69-L73 WeakPolarHBondContact O-CG 3.19Å; E69-L73 PolarHBondContact O-N 2.76Å; A70-L73 PolarHBondContact O-N 3.42Å; R71-L73 VanDerWaalsContact C-N 3.35Å; L73-G75 VanDerWaalsContact C-N 3.32Å
74	Q	89.1	Confident	89.2	Confident	155 Å²	155	113.6 Å²	113.6	72%	0.724	58%	0.576	S	S	*	*	H	α-helix	trans	-71.2	-25.6	176.2	-72.7	177.6	-6.7	0	0	113.6	A70 R71 N72	A70-Q74 WeakPolarHBondContact O-CG 3.43Å; A70-Q74 PolarHBondContact O-N 3.33Å; R71-Q74 PolarHBondContact O-N 3.38Å; N72-Q74 PolarHBondContact O-N 3.47Å
75	G	79.4	Confident	88.5	Confident	65 Å²	65	113.5 Å²	113.5	67%	0.67	58%	0.575	S	S	*	*	H	α-helix	trans	-86.6	-11.3	-179.4	0	0	0	0	0	115	R71 N72 L73 K77	R71-G75 PolarHBondContact O-N 3.44Å; N72-G75 PolarHBondContact O-N 3.16Å; L73-G75 VanDerWaalsContact C-N 3.32Å; G75-K77 PolarHBondContact O-N 3.27Å; G75-K77 VanDerWaalsContact O-N 3.15Å
76	I	60.7	Low	87.7	Confident	137 Å²	137	114.8 Å²	114.8	70%	0.703	59%	0.587	S	S	*	*			trans	-77.5	95.4	169	-62.6	166	0	0	0	107.1	N72	N72-I76 WeakPolarHBondContact O-CG1 3.36Å; N72-I76 PolarHBondContact O-N 3.48Å
77	K	54.4	Low	86.8	Confident	264 Å²	264	119.5 Å²	119.5	100%	1.148	60%	0.601	S	S	*	*			trans	-112	0	163.5	-80.1	-173	179.3	179.9	0	109.5	G75	G75-K77 PolarHBondContact O-N 3.27Å; G75-K77 VanDerWaalsContact O-N 3.15Å

Retrieved 77 of 77 residues in 63.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).