A0A087WVN5_HUMAN Loading...

RNA polymerase II, I and III subunit E

AlphaFold DB , UniProt , Accession A0A087WVN5, Species HUMAN (Homo sapiens, Human), Gene POLR2E, Length 83 aa.

						>A0A087WVN5_HUMAN|A0A087WVN5|POLR2E
PASASQSARITEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVDMAPKYILEQFLQQELLINITEHESLSTSS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	P	37.2	Very low	58.2	Low	183 Å²	183	92.9 Å²	92.9	100%	1.188	58%	0.584	S	S	*	*				0	130.2	0	-4	24.7	0	0	0	109.2
2	A	42.5	Very low	59.1	Low	101 Å²	101	100.3 Å²	100.3	84%	0.835	61%	0.606	S	S	*	*			trans	-34.7	127.9	-158.9	0	0	0	0	0	116.3	A4	A2-A4 PolarHBondContact O-N 2.97Å
3	S	48.8	Very low	60.3	Low	106 Å²	106	99.5 Å²	99.5	74%	0.741	59%	0.592	S	S	*	*			trans	-47.3	99.8	172.2	-179.2	0	0	0	0	110.8	S5	S3-S5 VanDerWaalsContact C-N 3.33Å; S3-S5 PolarHBondContact O-N 3.21Å
4	A	52.9	Low	61.2	Low	61 Å²	61	97.4 Å²	97.4	50%	0.504	58%	0.582	S	S	.	*			trans	-67.9	96.8	167.8	0	0	0	0	0	107	A2 Q6 T34	A2-A4 PolarHBondContact O-N 2.97Å; A4-Q6 PolarHBondContact O-N 2.71Å; A4-T34 WeakPolarHBondContact CB-OG1 3.49Å
5	S	63.3	Low	62.6	Low	61 Å²	61	99.1 Å²	99.1	43%	0.427	58%	0.578	S	S	.	*			trans	-70.2	113.7	174.8	-66.1	0	0	0	0	107.2	S3 I33	S3-S5 VanDerWaalsContact C-N 3.33Å; S3-S5 PolarHBondContact O-N 3.21Å; S5-I33 VanDerWaalsContact O-CG2 3.32Å; S5-I33 WeakPolarHBondContact O-CG2 3.15Å
6	Q	60.3	Low	64.1	Low	127 Å²	127	92.9 Å²	92.9	59%	0.593	54%	0.542	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-93.7	126.4	-179.8	-158.5	170.2	2.5	0	0	108	A4 R35	A4-Q6 PolarHBondContact O-N 2.71Å; Q6-R35 WeakPolarHBondContact CA-O 3.39Å; Q6-R35 HydrophobicContact CG-CB 4.03Å
7	S	67.3	Low	65.6	Low	46 Å²	46	88.7 Å²	88.7	32%	0.322	52%	0.524	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-120	123.2	-177.6	177.5	0	0	0	0	110.8	R35 A36 L37	S7-R35 PolarHBondContact N-O 3.25Å; S7-A36 WeakPolarHBondContact O-CA 3.4Å; S7-A36 VanDerWaalsContact O-CB 3.27Å; S7-A36 WeakPolarHBondContact O-CB 3.49Å; S7-L37 PolarHBondContact O-N 2.88Å
8	A	63.7	Low	66.8	Low	79 Å²	79	87.1 Å²	87.1	65%	0.653	51%	0.511	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-105.1	129.9	174.1	0	0	0	0	0	110	L37	A8-L37 HydrophobicContact CB-CB 4.11Å; A8-L37 HydrophobicContact CB-CD1 4.42Å
9	R	69.3	Low	68	Low	128 Å²	128	91.7 Å²	91.7	48%	0.483	53%	0.525	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-138.2	138.3	179	-144.9	166.2	-177	-129.1	4.1	111.9	Y24 L37 V39	R9-Y24 HydrophobicContact CB-CE1 4.17Å; R9-Y24 WeakPolarHBondContact CD-OH 3.45Å; R9-Y24 HydrophobicContact CG-CE1 4.46Å; R9-Y24 PolarHBondContact NH1-OH 3.16Å; R9-L37 PolarHBondContact N-O 3.27Å; R9-V39 PolarHBondContact O-N 2.98Å
10	I	63.3	Low	69	Low	122 Å²	122	88.5 Å²	88.5	63%	0.626	51%	0.507	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-95.6	129.2	-179.6	-55.2	171.6	0	0	0	107.9	V39	I10-V39 HydrophobicContact CG1-CB 4.42Å; I10-V39 HydrophobicContact CG1-CG2 4.17Å; I10-V39 HydrophobicContact CG2-CB 4.28Å
11	T	71.9	Confident	69.9	Low	8 Å²	8	84.2 Å²	84.2	5%	0.049	48%	0.483	C	S	.	.			trans	-101.6	131	172.9	61.4	0	0	0	0	110.2	E13 V16 Y24 I38 V39	T11-E13 VanDerWaalsContact C-N 3.25Å; T11-V16 WeakPolarHBondContact OG1-CG2 3.49Å; T11-Y24 HydrophobicContact CG2-CE2 4.04Å; T11-I38 HydrophobicContact CG2-CD1 3.77Å; T11-I38 HydrophobicContact CG2-CG1 3.88Å; T11-V39 PolarHBondContact N-O 3.31Å; T11-V39 VanDerWaalsContact N-O 3.16Å; T11-V39 PolarHBondContact OG1-O 2.87Å
12	E	69.1	Low	72.3	Confident	182 Å²	182	81.7 Å²	81.7	85%	0.85	45%	0.453	S	S	*	.			trans	-82.4	-6.6	174.8	-61.1	-178.5	98.4	0	0	112.1
13	E	74.6	Confident	74.5	Confident	90 Å²	90	81 Å²	81	42%	0.421	44%	0.438	S	S	.	.			trans	-71	127.2	176.4	-66.6	-171.3	90.8	0	0	110.2	T11 K15 T20	T11-E13 VanDerWaalsContact C-N 3.25Å; E13-K15 PolarHBondContact O-N 2.83Å; E13-T20 WeakPolarHBondContact OE2-CG2 3.47Å; E13-T20 PolarHBondContact OE2-OG1 3.5Å
14	P	73.3	Confident	76.2	Confident	70 Å²	70	77.6 Å²	77.6	46%	0.455	41%	0.409	S	S	.	.	S	Bend	trans	-61.8	-35.2	-179.7	21.7	-31.3	0	0	0	111.6	Q42	P14-Q42 WeakPolarHBondContact O-CA 3.26Å; P14-Q42 VanDerWaalsContact O-CB 3.25Å; P14-Q42 WeakPolarHBondContact O-CB 3.48Å; P14-Q42 PolarHBondContact O-N 2.97Å
15	K	81.5	Confident	77.7	Confident	122 Å²	122	75 Å²	75	53%	0.53	39%	0.387	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.8	119.2	-179.9	-169.6	177	-168.3	175.6	0	110.8	E13 G43 T45	E13-K15 PolarHBondContact O-N 2.83Å; K15-G43 WeakPolarHBondContact CA-O 3.33Å; K15-T45 HydrophobicContact CD-CG2 4.24Å; K15-T45 HydrophobicContact CG-CG2 4.25Å
16	V	86.6	Confident	78.9	Confident	0 Å²	0	77.3 Å²	77.3	0%	0	39%	0.391	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-84.5	125.5	-178	176.9	0	0	0	0	111.3	T11 T20 I21 I38 V40 G43 M44 T45	T11-V16 WeakPolarHBondContact OG1-CG2 3.49Å; V16-T20 HydrophobicContact CG1-CG2 3.96Å; V16-I21 HydrophobicContact CG1-CD1 3.93Å; V16-I21 HydrophobicContact CG1-CG1 4.13Å; V16-I38 HydrophobicContact CG1-CD1 4.31Å; V16-V40 HydrophobicContact CB-CG1 4.11Å; V16-V40 HydrophobicContact CG2-CB 4.31Å; V16-V40 HydrophobicContact CG2-CG1 3.44Å; V16-V40 VanDerWaalsContact CG2-CG1 3.44Å; V16-G43 PolarHBondContact N-O 2.84Å; V16-G43 VanDerWaalsContact N-O 3.08Å; V16-M44 HydrophobicContact CB-CE 4.35Å; V16-M44 HydrophobicContact CB-CG 4.16Å; V16-M44 HydrophobicContact CG1-CE 4.06Å; V16-T45 PolarHBondContact O-N 2.87Å; V16-T45 PolarHBondContact O-OG1 3.1Å
17	G	89.6	Confident	80.1	Confident	22 Å²	22	77.3 Å²	77.3	23%	0.227	39%	0.386	C	S	.	.			trans	-94.1	168	177.6	0	0	0	0	0	113.7	K19 T20 I21	G17-K19 PolarHBondContact O-N 3.25Å; G17-T20 PolarHBondContact O-N 3.22Å; G17-I21 PolarHBondContact O-N 3.23Å
18	I	87.8	Confident	81	Confident	59 Å²	59	75.3 Å²	75.3	30%	0.303	37%	0.371	S	S	.	.	H	α-helix	trans	-60.7	-31.6	178	-170	167.3	0	0	0	113.2	I21 K22 S51	I18-I21 PolarHBondContact O-N 3.34Å; I18-K22 HydrophobicContact CG1-CD 4.41Å; I18-K22 HydrophobicContact CG1-CG 4.34Å; I18-K22 WeakPolarHBondContact O-CG 3.45Å; I18-K22 PolarHBondContact O-N 2.97Å; I18-S51 WeakPolarHBondContact CD1-OG 3.4Å
19	K	88.7	Confident	82	Confident	175 Å²	175	76.3 Å²	76.3	76%	0.761	36%	0.362	S	S	*	.	H	α-helix	trans	-60.5	-48.3	177.7	-68.5	-175.9	-180	179.6	0	110.7	G17 I21 K22 V23	G17-K19 PolarHBondContact O-N 3.25Å; K19-I21 PolarHBondContact O-N 3.41Å; K19-K22 PolarHBondContact O-N 3.19Å; K19-V23 WeakPolarHBondContact O-CG2 3.45Å; K19-V23 PolarHBondContact O-N 3.31Å; K19-V23 VanDerWaalsContact O-N 3.15Å
20	T	87.7	Confident	82.9	Confident	27 Å²	27	75.9 Å²	75.9	17%	0.166	37%	0.366	C	S	.	.	H	α-helix	trans	-59.7	-47.2	177.4	-50.2	0	0	0	0	110.6	E13 V16 G17 K22 V23 Y24	E13-T20 WeakPolarHBondContact OE2-CG2 3.47Å; E13-T20 PolarHBondContact OE2-OG1 3.5Å; V16-T20 HydrophobicContact CG1-CG2 3.96Å; G17-T20 PolarHBondContact O-N 3.22Å; T20-K22 PolarHBondContact O-N 3.46Å; T20-V23 PolarHBondContact O-N 3.33Å; T20-Y24 HydrophobicContact CG2-CD2 3.82Å; T20-Y24 HydrophobicContact CG2-CE2 3.72Å; T20-Y24 VanDerWaalsContact O-CD2 3.26Å; T20-Y24 WeakPolarHBondContact O-CD2 3.25Å; T20-Y24 PolarHBondContact O-N 2.86Å
21	I	88.1	Confident	83.9	Confident	0 Å²	0	76.5 Å²	76.5	0%	0	37%	0.366	C	S	.	.	H	α-helix	trans	-59.7	-45.1	177.2	-64.4	-55.8	0	0	0	112.6	V16 G17 I18 K19 V23 Y24 C25 I38 M44 A48 L52 M55 L61	V16-I21 HydrophobicContact CG1-CD1 3.93Å; V16-I21 HydrophobicContact CG1-CG1 4.13Å; G17-I21 PolarHBondContact O-N 3.23Å; I18-I21 PolarHBondContact O-N 3.34Å; K19-I21 PolarHBondContact O-N 3.41Å; I21-V23 VanDerWaalsContact C-N 3.33Å; I21-V23 PolarHBondContact O-N 3.5Å; I21-Y24 WeakPolarHBondContact O-CB 3.3Å; I21-Y24 PolarHBondContact O-N 3.47Å; I21-Y24 VanDerWaalsContact O-N 3.15Å; I21-C25 WeakPolarHBondContact O-CB 3.43Å; I21-C25 PolarHBondContact O-N 2.87Å; I21-C25 PolarHBondContact O-SG 3.23Å; I21-I38 HydrophobicContact CD1-CD1 4.26Å; I21-M44 HydrophobicContact CD1-CE 3.36Å; I21-M44 HydrophobicContact CD1-SD 4.11Å; I21-M44 HydrophobicContact CG1-CE 4.36Å; I21-A48 HydrophobicContact CG1-CB 3.68Å; I21-L52 HydrophobicContact CD1-CD2 4.05Å; I21-L52 HydrophobicContact CG1-CD2 4.49Å; I21-L52 HydrophobicContact CG2-CD2 3.91Å; I21-M55 HydrophobicContact CG2-CE 3.96Å; I21-L61 HydrophobicContact CD1-CD2 3.76Å
22	K	87.8	Confident	84.4	Confident	130 Å²	130	81.9 Å²	81.9	57%	0.565	40%	0.395	S	S	*	.	H	α-helix	trans	-59.3	-44.4	179.1	-76.6	-176.8	176.3	-172.2	0	112.2	I18 K19 T20 Y24 C25 Q26	I18-K22 HydrophobicContact CG1-CD 4.41Å; I18-K22 HydrophobicContact CG1-CG 4.34Å; I18-K22 WeakPolarHBondContact O-CG 3.45Å; I18-K22 PolarHBondContact O-N 2.97Å; K19-K22 PolarHBondContact O-N 3.19Å; T20-K22 PolarHBondContact O-N 3.46Å; K22-Y24 VanDerWaalsContact C-N 3.32Å; K22-Y24 PolarHBondContact O-N 2.93Å; K22-C25 PolarHBondContact O-N 3.15Å; K22-Q26 PolarHBondContact O-N 3.4Å
23	V	88.4	Confident	85.1	Confident	86 Å²	86	73.8 Å²	73.8	52%	0.521	36%	0.357	S	S	.	.	H	α-helix	trans	-61.6	-43.4	176.2	173.5	0	0	0	0	110.8	K19 T20 I21 Q26 R27	K19-V23 WeakPolarHBondContact O-CG2 3.45Å; K19-V23 PolarHBondContact O-N 3.31Å; K19-V23 VanDerWaalsContact O-N 3.15Å; T20-V23 PolarHBondContact O-N 3.33Å; I21-V23 VanDerWaalsContact C-N 3.33Å; I21-V23 PolarHBondContact O-N 3.5Å; V23-Q26 PolarHBondContact O-N 3.23Å; V23-R27 PolarHBondContact O-N 3.48Å; V23-R27 VanDerWaalsContact O-N 3.13Å
24	Y	85.1	Confident	85.6	Confident	35 Å²	35	72.2 Å²	72.2	14%	0.137	35%	0.354	C	S	.	.	H	α-helix	trans	-60.6	-46.2	176.6	-93	-70.3	0	0	0	112.5	R9 T11 T20 I21 K22 Q26 R27 M28 I38	R9-Y24 HydrophobicContact CB-CE1 4.17Å; R9-Y24 WeakPolarHBondContact CD-OH 3.45Å; R9-Y24 HydrophobicContact CG-CE1 4.46Å; R9-Y24 PolarHBondContact NH1-OH 3.16Å; T11-Y24 HydrophobicContact CG2-CE2 4.04Å; T20-Y24 HydrophobicContact CG2-CD2 3.82Å; T20-Y24 HydrophobicContact CG2-CE2 3.72Å; T20-Y24 VanDerWaalsContact O-CD2 3.26Å; T20-Y24 WeakPolarHBondContact O-CD2 3.25Å; T20-Y24 PolarHBondContact O-N 2.86Å; I21-Y24 WeakPolarHBondContact O-CB 3.3Å; I21-Y24 PolarHBondContact O-N 3.47Å; I21-Y24 VanDerWaalsContact O-N 3.15Å; K22-Y24 VanDerWaalsContact C-N 3.32Å; K22-Y24 PolarHBondContact O-N 2.93Å; Y24-Q26 VanDerWaalsContact C-N 3.35Å; Y24-Q26 PolarHBondContact O-N 3.35Å; Y24-R27 WeakPolarHBondContact O-CB 3.49Å; Y24-R27 PolarHBondContact O-N 3.15Å; Y24-M28 WeakPolarHBondContact O-CG 3.44Å; Y24-M28 PolarHBondContact O-N 3.43Å; Y24-I38 HydrophobicContact CD2-CD1 4.25Å; Y24-I38 HydrophobicContact CE2-CD1 4.16Å
25	C	85.2	Confident	86.1	Confident	5 Å²	5	74.4 Å²	74.4	3%	0.034	35%	0.353	C	S	.	.	H	α-helix	trans	-70.5	-33.3	-177.2	-68	0	0	0	0	112.8	I21 K22 R27 M28 Q29 M55	I21-C25 WeakPolarHBondContact O-CB 3.43Å; I21-C25 PolarHBondContact O-N 2.87Å; I21-C25 PolarHBondContact O-SG 3.23Å; K22-C25 PolarHBondContact O-N 3.15Å; C25-R27 VanDerWaalsContact C-N 3.34Å; C25-M28 PolarHBondContact O-N 2.94Å; C25-Q29 WeakPolarHBondContact O-CG 3.39Å; C25-Q29 PolarHBondContact O-N 3.27Å; C25-M55 HydrophobicContact CB-CE 3.66Å; C25-M55 HydrophobicContact CB-SD 3.26Å; C25-M55 WeakPolarHBondContact CB-SD 3.43Å; C25-M55 WeakPolarHBondContact SG-CE 3.32Å; C25-M55 PolarHBondContact SG-SD 3.41Å
26	Q	88.1	Confident	86.2	Confident	111 Å²	111	68.9 Å²	68.9	52%	0.519	33%	0.33	S	S	.	.	H	α-helix	trans	-60.9	-45.5	170.3	-175.5	178.5	-21	0	0	110.9	K22 V23 Y24 M28 Q29 E30	K22-Q26 PolarHBondContact O-N 3.4Å; V23-Q26 PolarHBondContact O-N 3.23Å; Y24-Q26 VanDerWaalsContact C-N 3.35Å; Y24-Q26 PolarHBondContact O-N 3.35Å; Q26-M28 VanDerWaalsContact C-N 3.35Å; Q26-M28 PolarHBondContact O-N 3.32Å; Q26-Q29 WeakPolarHBondContact O-CB 3.49Å; Q26-Q29 PolarHBondContact O-N 3.2Å; Q26-Q29 VanDerWaalsContact O-N 3.14Å; Q26-E30 WeakPolarHBondContact CG-OE1 3.26Å; Q26-E30 PolarHBondContact NE2-OE1 3.25Å; Q26-E30 WeakPolarHBondContact O-CG 3.43Å; Q26-E30 PolarHBondContact O-N 3.13Å
27	R	85.9	Confident	86	Confident	126 Å²	126	71.2 Å²	71.2	48%	0.475	34%	0.343	S	S	.	.	H	α-helix	trans	-63.1	-39.9	175.6	-73.5	-168.2	165.6	-169.3	-4.1	113	V23 Y24 C25 Q29 E30 E31	V23-R27 PolarHBondContact O-N 3.48Å; V23-R27 VanDerWaalsContact O-N 3.13Å; Y24-R27 WeakPolarHBondContact O-CB 3.49Å; Y24-R27 PolarHBondContact O-N 3.15Å; C25-R27 VanDerWaalsContact C-N 3.34Å; R27-Q29 PolarHBondContact O-N 3.01Å; R27-E30 PolarHBondContact O-N 3.46Å; R27-E31 WeakPolarHBondContact O-CB 3.27Å; R27-E31 WeakPolarHBondContact O-CG 3.26Å; R27-E31 PolarHBondContact O-N 3.28Å
28	M	85.8	Confident	85.7	Confident	5 Å²	5	70.2 Å²	70.2	3%	0.025	33%	0.332	C	S	.	.	H	α-helix	trans	-58.8	-37.5	174.8	-72.9	176.8	74.4	0	0	111.7	Y24 C25 Q26 N32 I33 A36 Y59 L61	Y24-M28 WeakPolarHBondContact O-CG 3.44Å; Y24-M28 PolarHBondContact O-N 3.43Å; C25-M28 PolarHBondContact O-N 2.94Å; Q26-M28 VanDerWaalsContact C-N 3.35Å; Q26-M28 PolarHBondContact O-N 3.32Å; M28-N32 CarbonylContact O-C 3.5Å; M28-N32 WeakPolarHBondContact O-CA 3.4Å; M28-N32 PolarHBondContact O-N 3.08Å; M28-N32 VanDerWaalsContact O-N 3.11Å; M28-I33 HydrophobicContact CB-CB 4.13Å; M28-I33 HydrophobicContact CB-CG2 4.43Å; M28-I33 HydrophobicContact CE-CG2 3.92Å; M28-I33 HydrophobicContact CG-CB 4.17Å; M28-I33 HydrophobicContact CG-CG2 3.98Å; M28-I33 PolarHBondContact O-N 3.36Å; M28-A36 HydrophobicContact CE-CB 3.63Å; M28-A36 HydrophobicContact CG-CB 4.29Å; M28-A36 HydrophobicContact SD-CB 3.75Å; M28-Y59 HydrophobicContact CB-CD1 4.38Å; M28-Y59 HydrophobicContact CE-CD1 4.35Å; M28-L61 HydrophobicContact SD-CD1 4.17Å
29	Q	84.9	Confident	85.5	Confident	99 Å²	99	68.1 Å²	68.1	46%	0.463	32%	0.322	S	S	.	.	H	α-helix	trans	-68.8	-46.8	175.2	-69.3	170.1	36.5	0	0	111.9	C25 Q26 R27 E31 N32 Y59	C25-Q29 WeakPolarHBondContact O-CG 3.39Å; C25-Q29 PolarHBondContact O-N 3.27Å; Q26-Q29 WeakPolarHBondContact O-CB 3.49Å; Q26-Q29 PolarHBondContact O-N 3.2Å; Q26-Q29 VanDerWaalsContact O-N 3.14Å; R27-Q29 PolarHBondContact O-N 3.01Å; Q29-E31 VanDerWaalsContact C-N 3.35Å; Q29-E31 PolarHBondContact O-N 3.24Å; Q29-N32 PolarHBondContact O-N 3.39Å; Q29-Y59 HydrophobicContact CG-CE1 4.12Å; Q29-Y59 HydrophobicContact CG-CE2 3.8Å
30	E	87.9	Confident	85.3	Confident	120 Å²	120	59.8 Å²	59.8	56%	0.561	29%	0.286	S	S	*	.	H	α-helix	trans	-60.6	-42.8	179	-71.7	169.4	-172.6	0	0	112	Q26 R27 N32	Q26-E30 WeakPolarHBondContact CG-OE1 3.26Å; Q26-E30 PolarHBondContact NE2-OE1 3.25Å; Q26-E30 WeakPolarHBondContact O-CG 3.43Å; Q26-E30 PolarHBondContact O-N 3.13Å; R27-E30 PolarHBondContact O-N 3.46Å; E30-N32 VanDerWaalsContact C-N 3.32Å; E30-N32 PolarHBondContact O-ND2 3.2Å
31	E	83.5	Confident	85	Confident	135 Å²	135	62 Å²	62	63%	0.631	29%	0.294	S	S	*	.	T	Hydrogen-bonded Turn	trans	-89.7	5.2	-178.5	-60	-140.5	98	0	0	113.5	R27 Q29 I33	R27-E31 WeakPolarHBondContact O-CB 3.27Å; R27-E31 WeakPolarHBondContact O-CG 3.26Å; R27-E31 PolarHBondContact O-N 3.28Å; Q29-E31 VanDerWaalsContact C-N 3.35Å; Q29-E31 PolarHBondContact O-N 3.24Å; E31-I33 HydrophobicContact CB-CD1 3.65Å; E31-I33 HydrophobicContact CB-CG1 3.86Å; E31-I33 HydrophobicContact CG-CD1 4.5Å; E31-I33 PolarHBondContact O-N 2.98Å
32	N	83.4	Confident	84.8	Confident	121 Å²	121	69.4 Å²	69.4	65%	0.647	33%	0.329	S	S	*	.	T	Hydrogen-bonded Turn	trans	54.9	34.2	-178.1	-63.3	-90.9	0	0	0	113.6	M28 Q29 E30	M28-N32 CarbonylContact O-C 3.5Å; M28-N32 WeakPolarHBondContact O-CA 3.4Å; M28-N32 PolarHBondContact O-N 3.08Å; M28-N32 VanDerWaalsContact O-N 3.11Å; Q29-N32 PolarHBondContact O-N 3.39Å; E30-N32 VanDerWaalsContact C-N 3.32Å; E30-N32 PolarHBondContact O-ND2 3.2Å
33	I	84.3	Confident	84.6	Confident	11 Å²	11	63.7 Å²	63.7	6%	0.056	31%	0.307	C	S	.	.			trans	-84.2	116.1	176.4	-64.3	165.8	0	0	0	107.8	S5 M28 E31 R35 A36 Y59	S5-I33 VanDerWaalsContact O-CG2 3.32Å; S5-I33 WeakPolarHBondContact O-CG2 3.15Å; M28-I33 HydrophobicContact CB-CB 4.13Å; M28-I33 HydrophobicContact CB-CG2 4.43Å; M28-I33 HydrophobicContact CE-CG2 3.92Å; M28-I33 HydrophobicContact CG-CB 4.17Å; M28-I33 HydrophobicContact CG-CG2 3.98Å; M28-I33 PolarHBondContact O-N 3.36Å; E31-I33 HydrophobicContact CB-CD1 3.65Å; E31-I33 HydrophobicContact CB-CG1 3.86Å; E31-I33 HydrophobicContact CG-CD1 4.5Å; E31-I33 PolarHBondContact O-N 2.98Å; I33-R35 WeakPolarHBondContact CG2-O 3.39Å; I33-A36 HydrophobicContact CG2-CB 4.14Å; I33-Y59 WeakPolarHBondContact O-CD1 3.35Å; I33-Y59 WeakPolarHBondContact O-CE1 3.4Å
34	T	84.6	Confident	84.6	Confident	58 Å²	58	60.2 Å²	60.2	36%	0.356	29%	0.285	S	S	.	.	S	Bend	trans	-90	-21.3	176.6	54.8	0	0	0	0	112.5	A4 Y59 I60	A4-T34 WeakPolarHBondContact CB-OG1 3.49Å; T34-Y59 WeakPolarHBondContact O-CA 3.47Å; T34-I60 PolarHBondContact O-N 3.29Å
35	R	83.6	Confident	84.9	Confident	115 Å²	115	60.1 Å²	60.1	43%	0.434	29%	0.288	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-134.8	130.1	-179.5	-67.9	-162.3	172.2	-137.7	1.3	111.6	Q6 S7 I33 I60	Q6-R35 WeakPolarHBondContact CA-O 3.39Å; Q6-R35 HydrophobicContact CG-CB 4.03Å; S7-R35 PolarHBondContact N-O 3.25Å; I33-R35 WeakPolarHBondContact CG2-O 3.39Å; R35-I60 CarbonylContact C-O 3.42Å; R35-I60 VanDerWaalsContact CA-O 3.3Å; R35-I60 WeakPolarHBondContact CA-O 3.4Å; R35-I60 HydrophobicContact CG-CB 4.19Å; R35-I60 HydrophobicContact CG-CD1 4.43Å
36	A	83.3	Confident	85.1	Confident	7 Å²	7	65 Å²	65	6%	0.058	32%	0.319	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-139.1	156.6	174	0	0	0	0	0	111.7	S7 M28 I33 I60 L61 E62	S7-A36 WeakPolarHBondContact O-CA 3.4Å; S7-A36 VanDerWaalsContact O-CB 3.27Å; S7-A36 WeakPolarHBondContact O-CB 3.49Å; M28-A36 HydrophobicContact CE-CB 3.63Å; M28-A36 HydrophobicContact CG-CB 4.29Å; M28-A36 HydrophobicContact SD-CB 3.75Å; I33-A36 HydrophobicContact CG2-CB 4.14Å; A36-I60 PolarHBondContact N-O 2.87Å; A36-L61 HydrophobicContact CB-CD1 3.49Å; A36-L61 VanDerWaalsContact CB-CD1 3.49Å; A36-L61 WeakPolarHBondContact O-CA 3.3Å; A36-E62 PolarHBondContact O-N 3.02Å
37	L	83.4	Confident	85.2	Confident	49 Å²	49	62.9 Å²	62.9	26%	0.257	32%	0.317	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.6	131.5	178.1	-60.9	178	0	0	0	108.7	S7 A8 R9 E62 F64	S7-L37 PolarHBondContact O-N 2.88Å; A8-L37 HydrophobicContact CB-CB 4.11Å; A8-L37 HydrophobicContact CB-CD1 4.42Å; R9-L37 PolarHBondContact N-O 3.27Å; L37-E62 HydrophobicContact CD2-CB 3.63Å; L37-E62 HydrophobicContact CD2-CG 4.08Å; L37-F64 HydrophobicContact CD2-CD2 4.19Å; L37-F64 HydrophobicContact CD2-CE2 3.69Å
38	I	82.6	Confident	85.4	Confident	1 Å²	1	56.9 Å²	56.9	1%	0.005	29%	0.294	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.6	126.7	176.7	-173.2	167.7	0	0	0	110.9	T11 V16 I21 Y24 V40 M44 L61 E62 Q63 F64	T11-I38 HydrophobicContact CG2-CD1 3.77Å; T11-I38 HydrophobicContact CG2-CG1 3.88Å; V16-I38 HydrophobicContact CG1-CD1 4.31Å; I21-I38 HydrophobicContact CD1-CD1 4.26Å; Y24-I38 HydrophobicContact CD2-CD1 4.25Å; Y24-I38 HydrophobicContact CE2-CD1 4.16Å; I38-V40 HydrophobicContact CG1-CG1 4.19Å; I38-M44 HydrophobicContact CD1-CE 3.87Å; I38-M44 HydrophobicContact CG1-CE 4.38Å; I38-M44 HydrophobicContact CG2-CE 3.44Å; I38-M44 VanDerWaalsContact CG2-CE 3.44Å; I38-L61 HydrophobicContact CB-CD1 4.23Å; I38-L61 HydrophobicContact CG2-CD1 4.14Å; I38-L61 HydrophobicContact CG2-CD2 4.14Å; I38-L61 HydrophobicContact CG2-CG 3.93Å; I38-E62 WeakPolarHBondContact CG2-O 3.35Å; I38-E62 PolarHBondContact N-O 2.97Å; I38-Q63 HydrophobicContact CG2-CB 4.09Å; I38-Q63 CarbonylContact O-C 3.58Å; I38-Q63 WeakPolarHBondContact O-CA 3.26Å; I38-F64 PolarHBondContact O-N 2.85Å
39	V	83.4	Confident	85.5	Confident	15 Å²	15	61.4 Å²	61.4	9%	0.091	31%	0.314	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.4	125.9	178.1	-173.6	0	0	0	0	109.7	R9 I10 T11 F64 Q66 L69	R9-V39 PolarHBondContact O-N 2.98Å; I10-V39 HydrophobicContact CG1-CB 4.42Å; I10-V39 HydrophobicContact CG1-CG2 4.17Å; I10-V39 HydrophobicContact CG2-CB 4.28Å; T11-V39 PolarHBondContact N-O 3.31Å; T11-V39 VanDerWaalsContact N-O 3.16Å; T11-V39 PolarHBondContact OG1-O 2.87Å; V39-F64 CarbonylContact C-O 3.55Å; V39-F64 WeakPolarHBondContact CA-O 3.41Å; V39-Q66 HydrophobicContact CG1-CB 4.02Å; V39-Q66 HydrophobicContact CG1-CG 4.46Å; V39-L69 HydrophobicContact CB-CD1 3.97Å; V39-L69 HydrophobicContact CG1-CD1 3.36Å; V39-L69 HydrophobicContact CG2-CD1 3.36Å
40	V	85.1	Confident	85.8	Confident	0 Å²	0	61.6 Å²	61.6	0%	0	32%	0.315	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.7	147.7	-177.8	-58.5	0	0	0	0	110.7	V16 I38 M44 F64 L65 Q66	V16-V40 HydrophobicContact CB-CG1 4.11Å; V16-V40 HydrophobicContact CG2-CB 4.31Å; V16-V40 HydrophobicContact CG2-CG1 3.44Å; V16-V40 VanDerWaalsContact CG2-CG1 3.44Å; I38-V40 HydrophobicContact CG1-CG1 4.19Å; V40-M44 HydrophobicContact CG1-CE 4.12Å; V40-M44 HydrophobicContact CG1-CG 4.28Å; V40-F64 PolarHBondContact N-O 3.4Å; V40-L65 HydrophobicContact CG2-CD2 4.05Å; V40-L65 CarbonylContact O-C 3.56Å; V40-L65 VanDerWaalsContact O-CA 3.3Å; V40-L65 WeakPolarHBondContact O-CA 3.35Å; V40-Q66 PolarHBondContact O-N 3.22Å
41	Q	81.5	Confident	85.8	Confident	73 Å²	73	56.4 Å²	56.4	34%	0.341	29%	0.292	S	S	.	.	S	Bend	trans	-85.3	-53.2	-177.6	-62.5	-172.6	-4.8	0	0	113.1	Q66	Q41-Q66 HydrophobicContact CG-CB 4.33Å
42	Q	82.8	Confident	85.9	Confident	155 Å²	155	51.1 Å²	51.1	72%	0.724	27%	0.268	S	S	*	.	S	Bend	trans	-104	-8.5	178.2	-65.3	179.8	-22.4	0	0	113.3	P14	P14-Q42 WeakPolarHBondContact O-CA 3.26Å; P14-Q42 VanDerWaalsContact O-CB 3.25Å; P14-Q42 WeakPolarHBondContact O-CB 3.48Å; P14-Q42 PolarHBondContact O-N 2.97Å
43	G	84.7	Confident	86.1	Confident	10 Å²	10	49.9 Å²	49.9	10%	0.103	26%	0.264	C	S	.	.	E	Extended strand (participates in β ladder)	trans	114.5	-168.2	178.7	0	0	0	0	0	114.8	K15 V16	K15-G43 WeakPolarHBondContact CA-O 3.33Å; V16-G43 PolarHBondContact N-O 2.84Å; V16-G43 VanDerWaalsContact N-O 3.08Å
44	M	88.4	Confident	86.4	Confident	14 Å²	14	54.7 Å²	54.7	7%	0.069	29%	0.29	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-109	149.6	-178.7	-66.7	-166.6	159.6	0	0	113.1	V16 I21 I38 V40 A48 K49 L52 Q63	V16-M44 HydrophobicContact CB-CE 4.35Å; V16-M44 HydrophobicContact CB-CG 4.16Å; V16-M44 HydrophobicContact CG1-CE 4.06Å; I21-M44 HydrophobicContact CD1-CE 3.36Å; I21-M44 HydrophobicContact CD1-SD 4.11Å; I21-M44 HydrophobicContact CG1-CE 4.36Å; I38-M44 HydrophobicContact CD1-CE 3.87Å; I38-M44 HydrophobicContact CG1-CE 4.38Å; I38-M44 HydrophobicContact CG2-CE 3.44Å; I38-M44 VanDerWaalsContact CG2-CE 3.44Å; V40-M44 HydrophobicContact CG1-CE 4.12Å; V40-M44 HydrophobicContact CG1-CG 4.28Å; M44-A48 HydrophobicContact CB-CB 4.16Å; M44-A48 HydrophobicContact SD-CB 4.44Å; M44-K49 HydrophobicContact CB-CG 3.86Å; M44-L52 HydrophobicContact SD-CD1 3.77Å; M44-Q63 HydrophobicContact CE-CB 4.1Å; M44-Q63 HydrophobicContact SD-CB 4.12Å; M44-Q63 HydrophobicContact SD-CG 4.45Å
45	T	90.1	Very high	86.3	Confident	32 Å²	32	53.8 Å²	53.8	20%	0.196	28%	0.282	C	S	.	.			trans	-64	152.1	167.1	55.8	0	0	0	0	111.8	K15 V16 S47 A48 K49	K15-T45 HydrophobicContact CD-CG2 4.24Å; K15-T45 HydrophobicContact CG-CG2 4.25Å; V16-T45 PolarHBondContact O-N 2.87Å; V16-T45 PolarHBondContact O-OG1 3.1Å; T45-S47 VanDerWaalsContact C-N 3.26Å; T45-S47 PolarHBondContact O-N 2.98Å; T45-A48 WeakPolarHBondContact O-CB 3Å; T45-A48 PolarHBondContact O-N 3.49Å; T45-A48 VanDerWaalsContact OG1-CB 3.26Å; T45-A48 WeakPolarHBondContact OG1-CB 3.18Å; T45-A48 PolarHBondContact OG1-N 3.14Å; T45-K49 PolarHBondContact O-N 2.79Å
46	P	90.1	Very high	86.4	Confident	107 Å²	107	50.8 Å²	50.8	70%	0.695	28%	0.282	S	S	*	.	H	α-helix	trans	-55.5	-41.1	177.6	-24.4	33.1	0	0	0	112.7	A48 K49 Q50	P46-A48 VanDerWaalsContact C-N 3.32Å; P46-A48 PolarHBondContact O-N 3.41Å; P46-K49 PolarHBondContact O-N 2.87Å; P46-Q50 PolarHBondContact O-N 3.45Å
47	S	90.9	Very high	86.5	Confident	67 Å²	67	56.3 Å²	56.3	47%	0.469	32%	0.318	S	S	.	.	H	α-helix	trans	-64	-35.3	177	-47.1	0	0	0	0	112.8	T45 S51	T45-S47 VanDerWaalsContact C-N 3.26Å; T45-S47 PolarHBondContact O-N 2.98Å; S47-S51 PolarHBondContact O-N 3.36Å; S47-S51 PolarHBondContact O-OG 3.29Å
48	A	88.9	Confident	86.6	Confident	0 Å²	0	61.2 Å²	61.2	0%	0	34%	0.337	C	S	.	.	H	α-helix	trans	-66.2	-45.8	173.4	0	0	0	0	0	111.3	I21 M44 T45 P46 Q50 S51 L52	I21-A48 HydrophobicContact CG1-CB 3.68Å; M44-A48 HydrophobicContact CB-CB 4.16Å; M44-A48 HydrophobicContact SD-CB 4.44Å; T45-A48 WeakPolarHBondContact O-CB 3Å; T45-A48 PolarHBondContact O-N 3.49Å; T45-A48 VanDerWaalsContact OG1-CB 3.26Å; T45-A48 WeakPolarHBondContact OG1-CB 3.18Å; T45-A48 PolarHBondContact OG1-N 3.14Å; P46-A48 VanDerWaalsContact C-N 3.32Å; P46-A48 PolarHBondContact O-N 3.41Å; A48-Q50 VanDerWaalsContact C-N 3.33Å; A48-Q50 PolarHBondContact O-N 3.27Å; A48-S51 WeakPolarHBondContact O-CB 3.48Å; A48-S51 PolarHBondContact O-N 3.11Å; A48-L52 PolarHBondContact O-N 3.06Å
49	K	88.5	Confident	86.7	Confident	100 Å²	100	62.9 Å²	62.9	44%	0.435	34%	0.343	S	S	.	.	H	α-helix	trans	-60.2	-42.1	176.6	-67.4	-173.4	180	-173.5	0	112.3	M44 T45 P46 S51 L52 V53	M44-K49 HydrophobicContact CB-CG 3.86Å; T45-K49 PolarHBondContact O-N 2.79Å; P46-K49 PolarHBondContact O-N 2.87Å; K49-S51 VanDerWaalsContact C-N 3.27Å; K49-S51 PolarHBondContact O-N 3.23Å; K49-L52 VanDerWaalsContact O-CB 3.31Å; K49-L52 WeakPolarHBondContact O-CB 3.17Å; K49-L52 PolarHBondContact O-N 3.15Å; K49-V53 PolarHBondContact O-N 2.97Å
50	Q	89.9	Confident	86.8	Confident	103 Å²	103	64.5 Å²	64.5	48%	0.481	35%	0.351	S	S	.	.	H	α-helix	trans	-58.2	-42.7	177.3	-170	60.7	54.5	0	0	111.4	P46 A48 L52 V53 D54	P46-Q50 PolarHBondContact O-N 3.45Å; A48-Q50 VanDerWaalsContact C-N 3.33Å; A48-Q50 PolarHBondContact O-N 3.27Å; Q50-L52 PolarHBondContact O-N 3.28Å; Q50-V53 WeakPolarHBondContact O-CB 3.43Å; Q50-V53 PolarHBondContact O-N 2.87Å; Q50-V53 VanDerWaalsContact O-N 3.09Å; Q50-D54 PolarHBondContact NE2-OD1 3.03Å; Q50-D54 VanDerWaalsContact NE2-OD1 3.08Å; Q50-D54 PolarHBondContact O-N 3.23Å
51	S	88.3	Confident	86.8	Confident	11 Å²	11	65.3 Å²	65.3	8%	0.077	36%	0.355	C	S	.	.	H	α-helix	trans	-60	-32.9	176.4	-60.5	0	0	0	0	112.6	I18 S47 A48 K49 M55	I18-S51 WeakPolarHBondContact CD1-OG 3.4Å; S47-S51 PolarHBondContact O-N 3.36Å; S47-S51 PolarHBondContact O-OG 3.29Å; A48-S51 WeakPolarHBondContact O-CB 3.48Å; A48-S51 PolarHBondContact O-N 3.11Å; K49-S51 VanDerWaalsContact C-N 3.27Å; K49-S51 PolarHBondContact O-N 3.23Å; S51-M55 WeakPolarHBondContact O-CE 3.31Å; S51-M55 VanDerWaalsContact O-CG 3.26Å; S51-M55 WeakPolarHBondContact O-CG 3.14Å; S51-M55 PolarHBondContact O-N 3.2Å
52	L	86.1	Confident	86.9	Confident	25 Å²	25	65.6 Å²	65.6	13%	0.131	36%	0.356	C	S	.	.	H	α-helix	trans	-65.5	-43.4	175.3	-48.1	-178.7	0	0	0	111.6	I21 M44 A48 K49 Q50 M55 A56 L61	I21-L52 HydrophobicContact CD1-CD2 4.05Å; I21-L52 HydrophobicContact CG1-CD2 4.49Å; I21-L52 HydrophobicContact CG2-CD2 3.91Å; M44-L52 HydrophobicContact SD-CD1 3.77Å; A48-L52 PolarHBondContact O-N 3.06Å; K49-L52 VanDerWaalsContact O-CB 3.31Å; K49-L52 WeakPolarHBondContact O-CB 3.17Å; K49-L52 PolarHBondContact O-N 3.15Å; Q50-L52 PolarHBondContact O-N 3.28Å; L52-M55 PolarHBondContact O-N 3.44Å; L52-A56 PolarHBondContact O-N 3.03Å; L52-A56 VanDerWaalsContact O-N 3.13Å; L52-L61 HydrophobicContact CD2-CB 3.9Å; L52-L61 HydrophobicContact CD2-CD2 3.46Å; L52-L61 VanDerWaalsContact CD2-CD2 3.46Å; L52-L61 HydrophobicContact CD2-CG 4Å
53	V	88.6	Confident	87	Confident	95 Å²	95	61.3 Å²	61.3	58%	0.576	34%	0.337	S	S	*	.	H	α-helix	trans	-64.4	-44.1	179.1	179.5	0	0	0	0	110.4	K49 Q50 M55 A56	K49-V53 PolarHBondContact O-N 2.97Å; Q50-V53 WeakPolarHBondContact O-CB 3.43Å; Q50-V53 PolarHBondContact O-N 2.87Å; Q50-V53 VanDerWaalsContact O-N 3.09Å; V53-M55 PolarHBondContact O-N 3.35Å; V53-M55 VanDerWaalsContact O-N 3.16Å; V53-A56 PolarHBondContact O-N 3.27Å
54	D	88.8	Confident	86.9	Confident	112 Å²	112	63.8 Å²	63.8	60%	0.599	34%	0.344	S	S	*	.	H	α-helix	trans	-63.5	-22.1	-179.7	-60.7	-21	0	0	0	112.7	Q50	Q50-D54 PolarHBondContact NE2-OD1 3.03Å; Q50-D54 VanDerWaalsContact NE2-OD1 3.08Å; Q50-D54 PolarHBondContact O-N 3.23Å
55	M	83.6	Confident	86.5	Confident	38 Å²	38	65.3 Å²	65.3	19%	0.187	35%	0.353	C	S	.	.	H	α-helix	trans	-96.9	-18.8	-178.9	-69.4	-170.5	-104.8	0	0	113.6	I21 C25 S51 L52 V53 K58 Y59	I21-M55 HydrophobicContact CG2-CE 3.96Å; C25-M55 HydrophobicContact CB-CE 3.66Å; C25-M55 HydrophobicContact CB-SD 3.26Å; C25-M55 WeakPolarHBondContact CB-SD 3.43Å; C25-M55 WeakPolarHBondContact SG-CE 3.32Å; C25-M55 PolarHBondContact SG-SD 3.41Å; S51-M55 WeakPolarHBondContact O-CE 3.31Å; S51-M55 VanDerWaalsContact O-CG 3.26Å; S51-M55 WeakPolarHBondContact O-CG 3.14Å; S51-M55 PolarHBondContact O-N 3.2Å; L52-M55 PolarHBondContact O-N 3.44Å; V53-M55 PolarHBondContact O-N 3.35Å; V53-M55 VanDerWaalsContact O-N 3.16Å; M55-K58 PolarHBondContact O-N 2.93Å; M55-K58 VanDerWaalsContact O-N 3.1Å; M55-Y59 CarbonylContact C-O 3.6Å; M55-Y59 PolarHBondContact O-N 2.94Å
56	A	84.5	Confident	85.8	Confident	53 Å²	53	67.8 Å²	67.8	44%	0.438	36%	0.362	S	S	.	.	T	Hydrogen-bonded Turn	trans	-70.8	149.4	170.7	0	0	0	0	0	111.1	L52 V53 K58	L52-A56 PolarHBondContact O-N 3.03Å; L52-A56 VanDerWaalsContact O-N 3.13Å; V53-A56 PolarHBondContact O-N 3.27Å; A56-K58 VanDerWaalsContact C-N 3.33Å
57	P	86.6	Confident	84.8	Confident	123 Å²	123	69.3 Å²	69.3	80%	0.799	36%	0.36	S	S	*	.	T	Hydrogen-bonded Turn	cis	-86.2	1.2	-3.1	35.5	-35.5	0	0	0	113.4
58	K	85.6	Confident	83.7	Confident	151 Å²	151	70.8 Å²	70.8	66%	0.657	36%	0.359	S	S	*	.	T	Hydrogen-bonded Turn	trans	-66.3	-41.4	-173.2	-170.7	177.7	178.8	180	0	112.3	M55 A56	M55-K58 PolarHBondContact O-N 2.93Å; M55-K58 VanDerWaalsContact O-N 3.1Å; A56-K58 VanDerWaalsContact C-N 3.33Å
59	Y	84.9	Confident	82.3	Confident	37 Å²	37	74.5 Å²	74.5	15%	0.145	38%	0.379	C	S	.	.	S	Bend	trans	-128.7	121.6	174.2	-60.7	-78.4	0	0	0	108.8	M28 Q29 I33 T34 M55	M28-Y59 HydrophobicContact CB-CD1 4.38Å; M28-Y59 HydrophobicContact CE-CD1 4.35Å; Q29-Y59 HydrophobicContact CG-CE1 4.12Å; Q29-Y59 HydrophobicContact CG-CE2 3.8Å; I33-Y59 WeakPolarHBondContact O-CD1 3.35Å; I33-Y59 WeakPolarHBondContact O-CE1 3.4Å; T34-Y59 WeakPolarHBondContact O-CA 3.47Å; M55-Y59 CarbonylContact C-O 3.6Å; M55-Y59 PolarHBondContact O-N 2.94Å
60	I	85.3	Confident	80.6	Confident	49 Å²	49	76.3 Å²	76.3	25%	0.251	39%	0.393	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.2	113.2	-178.6	-55.9	173.6	0	0	0	107.4	T34 R35 A36 E62	T34-I60 PolarHBondContact O-N 3.29Å; R35-I60 CarbonylContact C-O 3.42Å; R35-I60 VanDerWaalsContact CA-O 3.3Å; R35-I60 WeakPolarHBondContact CA-O 3.4Å; R35-I60 HydrophobicContact CG-CB 4.19Å; R35-I60 HydrophobicContact CG-CD1 4.43Å; A36-I60 PolarHBondContact N-O 2.87Å; I60-E62 HydrophobicContact CG2-CG 3.93Å
61	L	85.3	Confident	78.3	Confident	17 Å²	17	76.5 Å²	76.5	9%	0.089	40%	0.396	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.3	107.8	173.3	-176.8	72.9	0	0	0	108.5	I21 M28 A36 I38 L52	I21-L61 HydrophobicContact CD1-CD2 3.76Å; M28-L61 HydrophobicContact SD-CD1 4.17Å; A36-L61 HydrophobicContact CB-CD1 3.49Å; A36-L61 VanDerWaalsContact CB-CD1 3.49Å; A36-L61 WeakPolarHBondContact O-CA 3.3Å; I38-L61 HydrophobicContact CB-CD1 4.23Å; I38-L61 HydrophobicContact CG2-CD1 4.14Å; I38-L61 HydrophobicContact CG2-CD2 4.14Å; I38-L61 HydrophobicContact CG2-CG 3.93Å; L52-L61 HydrophobicContact CD2-CB 3.9Å; L52-L61 HydrophobicContact CD2-CD2 3.46Å; L52-L61 VanDerWaalsContact CD2-CD2 3.46Å; L52-L61 HydrophobicContact CD2-CG 4Å
62	E	84	Confident	76.1	Confident	78 Å²	78	80.3 Å²	80.3	36%	0.364	42%	0.415	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.4	129.1	-178.9	-53.3	180	73.8	0	0	109.7	A36 L37 I38 I60 F64	A36-E62 PolarHBondContact O-N 3.02Å; L37-E62 HydrophobicContact CD2-CB 3.63Å; L37-E62 HydrophobicContact CD2-CG 4.08Å; I38-E62 WeakPolarHBondContact CG2-O 3.35Å; I38-E62 PolarHBondContact N-O 2.97Å; I60-E62 HydrophobicContact CG2-CG 3.93Å; E62-F64 HydrophobicContact CB-CD2 4.36Å; E62-F64 HydrophobicContact CB-CE2 3.85Å
63	Q	83.9	Confident	74.3	Confident	66 Å²	66	86.7 Å²	86.7	31%	0.308	45%	0.448	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-94	128.3	175.8	56.6	134	59.9	0	0	110.9	I38 M44	I38-Q63 HydrophobicContact CG2-CB 4.09Å; I38-Q63 CarbonylContact O-C 3.58Å; I38-Q63 WeakPolarHBondContact O-CA 3.26Å; M44-Q63 HydrophobicContact CE-CB 4.1Å; M44-Q63 HydrophobicContact SD-CB 4.12Å; M44-Q63 HydrophobicContact SD-CG 4.45Å
64	F	82.5	Confident	72.2	Confident	61 Å²	61	87.6 Å²	87.6	27%	0.268	45%	0.454	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.1	137.8	174.3	-78.4	-92.2	0	0	0	109.9	L37 I38 V39 V40 E62	L37-F64 HydrophobicContact CD2-CD2 4.19Å; L37-F64 HydrophobicContact CD2-CE2 3.69Å; I38-F64 PolarHBondContact O-N 2.85Å; V39-F64 CarbonylContact C-O 3.55Å; V39-F64 WeakPolarHBondContact CA-O 3.41Å; V40-F64 PolarHBondContact N-O 3.4Å; E62-F64 HydrophobicContact CB-CD2 4.36Å; E62-F64 HydrophobicContact CB-CE2 3.85Å
65	L	80.9	Confident	70.2	Confident	47 Å²	47	89.6 Å²	89.6	25%	0.246	46%	0.46	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-75.9	140.1	169.9	-70.6	166	0	0	0	109.4	V40 Q67 E68 L69	V40-L65 HydrophobicContact CG2-CD2 4.05Å; V40-L65 CarbonylContact O-C 3.56Å; V40-L65 VanDerWaalsContact O-CA 3.3Å; V40-L65 WeakPolarHBondContact O-CA 3.35Å; L65-Q67 PolarHBondContact O-N 3.08Å; L65-Q67 VanDerWaalsContact O-N 3.1Å; L65-E68 HydrophobicContact CB-CB 4.36Å; L65-E68 HydrophobicContact CB-CG 4Å; L65-E68 PolarHBondContact N-OE2 3.45Å; L65-E68 WeakPolarHBondContact O-CB 3.49Å; L65-E68 PolarHBondContact O-N 2.87Å; L65-L69 PolarHBondContact O-N 3.1Å
66	Q	75.2	Confident	68.5	Low	83 Å²	83	97 Å²	97	39%	0.388	49%	0.494	S	S	.	.	H	α-helix	trans	-55.6	-30.6	173.6	-169.2	178.2	-79.2	0	0	111.3	V39 V40 Q41 E68 L69	V39-Q66 HydrophobicContact CG1-CB 4.02Å; V39-Q66 HydrophobicContact CG1-CG 4.46Å; V40-Q66 PolarHBondContact O-N 3.22Å; Q41-Q66 HydrophobicContact CG-CB 4.33Å; Q66-E68 VanDerWaalsContact C-N 3.35Å; Q66-L69 PolarHBondContact O-N 3.16Å
67	Q	69.6	Low	66.5	Low	140 Å²	140	102.8 Å²	102.8	65%	0.654	51%	0.511	S	S	*	.	H	α-helix	trans	-69.2	-28.6	175.1	-60.3	179.5	-84.1	0	0	113.3	L65	L65-Q67 PolarHBondContact O-N 3.08Å; L65-Q67 VanDerWaalsContact O-N 3.1Å
68	E	66.7	Low	64.7	Low	97 Å²	97	102.3 Å²	102.3	45%	0.453	51%	0.511	S	S	.	.	H	α-helix	trans	-79.6	-28.9	177.3	-70.4	179.5	145.7	0	0	112.1	L65 Q66 L70 I71	L65-E68 HydrophobicContact CB-CB 4.36Å; L65-E68 HydrophobicContact CB-CG 4Å; L65-E68 PolarHBondContact N-OE2 3.45Å; L65-E68 WeakPolarHBondContact O-CB 3.49Å; L65-E68 PolarHBondContact O-N 2.87Å; Q66-E68 VanDerWaalsContact C-N 3.35Å; E68-L70 VanDerWaalsContact C-N 3.29Å; E68-L70 PolarHBondContact O-N 2.96Å; E68-I71 PolarHBondContact O-N 3.13Å
69	L	58.8	Low	63.1	Low	79 Å²	79	102.3 Å²	102.3	41%	0.414	52%	0.517	S	S	.	.	H	α-helix	trans	-67	-27.9	175.2	-85	159.2	0	0	0	113.7	V39 L65 Q66 I71 N72	V39-L69 HydrophobicContact CB-CD1 3.97Å; V39-L69 HydrophobicContact CG1-CD1 3.36Å; V39-L69 HydrophobicContact CG2-CD1 3.36Å; L65-L69 PolarHBondContact O-N 3.1Å; Q66-L69 PolarHBondContact O-N 3.16Å; L69-I71 PolarHBondContact O-N 3.29Å; L69-N72 PolarHBondContact O-N 3.32Å
70	L	52.7	Low	61.1	Low	138 Å²	138	105.4 Å²	105.4	72%	0.723	54%	0.544	S	S	*	.	T	Hydrogen-bonded Turn	trans	-65.8	-15.7	175.5	-77.4	161.4	0	0	0	113.2	E68	E68-L70 VanDerWaalsContact C-N 3.29Å; E68-L70 PolarHBondContact O-N 2.96Å
71	I	43.3	Very low	59.3	Low	107 Å²	107	108.6 Å²	108.6	55%	0.549	57%	0.566	S	S	.	*	T	Hydrogen-bonded Turn	trans	-89.2	-17.6	178.7	-65.4	171.8	0	0	0	111.3	E68 L69 I73 T74	E68-I71 PolarHBondContact O-N 3.13Å; L69-I71 PolarHBondContact O-N 3.29Å; I71-I73 PolarHBondContact O-N 3.25Å; I71-T74 PolarHBondContact O-N 3.09Å; I71-T74 PolarHBondContact O-OG1 3.27Å
72	N	42.3	Very low	57.4	Low	90 Å²	90	113.6 Å²	113.6	48%	0.481	60%	0.602	S	S	.	*	T	Hydrogen-bonded Turn	trans	-97.3	38.4	-172	-86.7	-17.8	0	0	0	115.2	L69	L69-N72 PolarHBondContact O-N 3.32Å
73	I	47.6	Very low	55.6	Low	159 Å²	159	119 Å²	119	82%	0.815	65%	0.649	S	S	*	*	T	Hydrogen-bonded Turn	trans	-109.6	8.3	151.9	53	170.7	0	0	0	112.4	I71	I71-I73 PolarHBondContact O-N 3.25Å
74	T	43.8	Very low	54.2	Low	115 Å²	115	121.7 Å²	121.7	71%	0.706	67%	0.666	S	S	*	*	S	Bend	trans	-122	20.4	-176.7	19.4	0	0	0	0	115.4	I71	I71-T74 PolarHBondContact O-N 3.09Å; I71-T74 PolarHBondContact O-OG1 3.27Å
75	E	47	Very low	52.7	Low	153 Å²	153	124.9 Å²	124.9	72%	0.715	69%	0.687	S	S	*	*			trans	-124.6	24.9	171	-75.1	-158.8	88.7	0	0	113.8	E77	E75-E77 VanDerWaalsContact C-N 3.29Å; E75-E77 PolarHBondContact O-N 3.03Å
76	H	47.8	Very low	51.1	Low	195 Å²	195	129.2 Å²	129.2	90%	0.903	71%	0.712	S	S	*	*			trans	-93.8	50.4	166.3	-127.5	-82.2	0	0	0	111.5
77	E	41.9	Very low	49.7	Very low	174 Å²	174	131.9 Å²	131.9	81%	0.813	73%	0.731	S	S	*	*			trans	-149.5	55.9	160.3	-154.4	-165.3	156	0	0	111.5	E75	E75-E77 VanDerWaalsContact C-N 3.29Å; E75-E77 PolarHBondContact O-N 3.03Å
78	S	49.1	Very low	48.4	Very low	112 Å²	112	131.4 Å²	131.4	78%	0.783	74%	0.736	S	S	*	*			trans	-105.6	63.5	159.8	-169.3	0	0	0	0	109.7
79	L	52.5	Low	47.2	Very low	152 Å²	152	133.7 Å²	133.7	80%	0.796	75%	0.754	S	S	*	*			trans	-152.7	86.4	160.6	-77.7	-177.5	0	0	0	110.5
80	S	43.2	Very low	46.4	Very low	101 Å²	101	137.6 Å²	137.6	71%	0.706	78%	0.779	S	S	*	*			trans	-164.4	75.5	143	-75.1	0	0	0	0	107.1
81	T	47.8	Very low	45.9	Very low	117 Å²	117	137.6 Å²	137.6	72%	0.718	78%	0.783	S	S	*	*				50.7	105.1	111	61.6	0	0	0	0	113.3	S83	T81-S83 PolarHBondContact O-N 3.36Å
82	S	45.6	Very low	46.1	Very low	121 Å²	121	140.2 Å²	140.2	85%	0.846	80%	0.803	S	S	*	*			trans	-28.1	128.2	153.3	50.2	0	0	0	0	113.5
83	S	44.9	Very low	46.5	Very low	193 Å²	193	144.7 Å²	144.7	100%	1.35	83%	0.832	S	S	*	*			trans	-134.1	0	150.1	-68.6	0	0	0	0	108.1	T81	T81-S83 PolarHBondContact O-N 3.36Å

Retrieved 83 of 83 residues in 176.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).