A0A087WVR2_HUMAN Loading...

Transmembrane and coiled-coil domains 3

AlphaFold DB , UniProt , Accession A0A087WVR2, Species HUMAN (Homo sapiens, Human), Gene SLC9D1, Length 94 aa.

						>A0A087WVR2_HUMAN|A0A087WVR2|SLC9D1
FLLAALVLSLILPRSSQYIKWIVSAGLAQVSEFSFVLGSRARRAGVISREVYLLILSVTTLSLLLAPVLWRAAITRPHLPTLAVHIEGTEAFEP
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	F	51.5	Low	64.2	Low	187 Å²	187	111.4 Å²	111.4	82%	0.82	62%	0.623	S	S	*	*				0	-64.2	0	-167	-103.4	0	0	0	111.7	L3 A4 A5	F1-L3 VanDerWaalsContact C-N 3.31Å; F1-L3 PolarHBondContact O-N 3.35Å; F1-A4 PolarHBondContact O-N 2.81Å; F1-A4 VanDerWaalsContact O-N 3.09Å; F1-A5 PolarHBondContact O-N 3.11Å
2	L	55.4	Low	63.2	Low	146 Å²	146	110.9 Å²	110.9	76%	0.764	62%	0.617	S	S	*	*	H	α-helix	trans	-56.5	-40.6	178.1	-67.2	170.2	0	0	0	113.8	A4 A5 L6	L2-A4 PolarHBondContact O-N 3.41Å; L2-A5 PolarHBondContact O-N 3.36Å; L2-L6 WeakPolarHBondContact O-CB 3.34Å; L2-L6 PolarHBondContact O-N 3.34Å
3	L	59.4	Low	62.6	Low	121 Å²	121	111.1 Å²	111.1	63%	0.634	63%	0.626	S	S	*	*	H	α-helix	trans	-63.4	-41	176.3	-161	92.3	0	0	0	112.5	F1 L6 V7	F1-L3 VanDerWaalsContact C-N 3.31Å; F1-L3 PolarHBondContact O-N 3.35Å; L3-L6 PolarHBondContact O-N 3.43Å; L3-V7 VanDerWaalsContact O-CG2 3.25Å; L3-V7 WeakPolarHBondContact O-CG2 3.35Å; L3-V7 PolarHBondContact O-N 3.3Å
4	A	60.2	Low	62.7	Low	66 Å²	66	120 Å²	120	55%	0.545	65%	0.645	S	S	.	*	H	α-helix	trans	-69.2	-38.3	178.6	0	0	0	0	0	111.6	F1 L2 L8	F1-A4 PolarHBondContact O-N 2.81Å; F1-A4 VanDerWaalsContact O-N 3.09Å; L2-A4 PolarHBondContact O-N 3.41Å; A4-L8 WeakPolarHBondContact O-CB 3.46Å; A4-L8 PolarHBondContact O-N 3.26Å
5	A	62.7	Low	62.4	Low	55 Å²	55	119.8 Å²	119.8	46%	0.455	66%	0.657	S	S	.	*	H	α-helix	trans	-64.7	-40.1	173.9	0	0	0	0	0	112.1	F1 L2 S9	F1-A5 PolarHBondContact O-N 3.11Å; L2-A5 PolarHBondContact O-N 3.36Å; A5-S9 VanDerWaalsContact O-CB 3.31Å; A5-S9 WeakPolarHBondContact O-CB 3.47Å; A5-S9 PolarHBondContact O-N 3.19Å; A5-S9 VanDerWaalsContact O-N 3.12Å
6	L	72.1	Confident	62.1	Low	108 Å²	108	115.5 Å²	115.5	57%	0.565	64%	0.638	S	S	*	*	H	α-helix	trans	-63.6	-47.7	176.3	-171	86	0	0	0	111.7	L2 L3 S9 L10	L2-L6 WeakPolarHBondContact O-CB 3.34Å; L2-L6 PolarHBondContact O-N 3.34Å; L3-L6 PolarHBondContact O-N 3.43Å; L6-S9 PolarHBondContact O-N 2.94Å; L6-L10 HydrophobicContact CG-CD1 4.16Å; L6-L10 PolarHBondContact O-N 2.9Å; L6-L10 VanDerWaalsContact O-N 3.14Å
7	V	71.1	Confident	62.4	Low	75 Å²	75	117.8 Å²	117.8	46%	0.455	64%	0.643	S	S	.	*	H	α-helix	trans	-62.9	-44.7	-179.2	169.8	0	0	0	0	111.2	L3 S9 L10 I11	L3-V7 VanDerWaalsContact O-CG2 3.25Å; L3-V7 WeakPolarHBondContact O-CG2 3.35Å; L3-V7 PolarHBondContact O-N 3.3Å; V7-S9 VanDerWaalsContact C-N 3.33Å; V7-S9 PolarHBondContact O-N 2.91Å; V7-L10 PolarHBondContact O-N 3.4Å; V7-I11 HydrophobicContact CG1-CD1 4.12Å; V7-I11 PolarHBondContact O-N 3.27Å
8	L	67	Low	62.8	Low	101 Å²	101	121.5 Å²	121.5	53%	0.529	65%	0.647	S	S	.	*	H	α-helix	trans	-67.7	-33.6	-180	-167.1	66.8	0	0	0	112.5	A4 L12	A4-L8 WeakPolarHBondContact O-CB 3.46Å; A4-L8 PolarHBondContact O-N 3.26Å; L8-L12 PolarHBondContact O-N 3.11Å
9	S	67.5	Low	63.4	Low	103 Å²	103	120.7 Å²	120.7	72%	0.72	64%	0.642	S	S	*	*	H	α-helix	trans	-72.5	-30	178.7	-151.3	0	0	0	0	112.9	A5 L6 V7	A5-S9 VanDerWaalsContact O-CB 3.31Å; A5-S9 WeakPolarHBondContact O-CB 3.47Å; A5-S9 PolarHBondContact O-N 3.19Å; A5-S9 VanDerWaalsContact O-N 3.12Å; L6-S9 PolarHBondContact O-N 2.94Å; V7-S9 VanDerWaalsContact C-N 3.33Å; V7-S9 PolarHBondContact O-N 2.91Å
10	L	69.1	Low	63.9	Low	142 Å²	142	119.6 Å²	119.6	74%	0.743	63%	0.631	S	S	*	*	H	α-helix	trans	-79.7	-24.2	176.3	-77.8	163.3	0	0	0	113.3	L6 V7	L6-L10 HydrophobicContact CG-CD1 4.16Å; L6-L10 PolarHBondContact O-N 2.9Å; L6-L10 VanDerWaalsContact O-N 3.14Å; V7-L10 PolarHBondContact O-N 3.4Å
11	I	70.3	Confident	64.7	Low	121 Å²	121	122.5 Å²	122.5	62%	0.621	63%	0.634	S	S	*	*	H	α-helix	trans	-94.1	-19.8	-174.1	-96.8	158	0	0	0	114	V7	V7-I11 HydrophobicContact CG1-CD1 4.12Å; V7-I11 PolarHBondContact O-N 3.27Å
12	L	51.5	Low	66.1	Low	106 Å²	106	118.9 Å²	118.9	56%	0.555	62%	0.622	S	S	*	*	S	Bend	trans	-108	113.3	-169.3	-132.5	70.9	0	0	0	114.3	L8	L8-L12 PolarHBondContact O-N 3.11Å
13	P	55.3	Low	67.4	Low	113 Å²	113	115.7 Å²	115.7	73%	0.734	61%	0.608	S	S	*	*			trans	-70	154	-178	27.1	-32.8	0	0	0	113.9	S15	P13-S15 PolarHBondContact O-N 2.83Å; P13-S15 VanDerWaalsContact O-N 3.09Å
14	R	64.4	Low	68.5	Low	236 Å²	236	112.6 Å²	112.6	89%	0.891	60%	0.596	S	S	*	*	S	Bend	trans	-74.5	82.6	-172.5	-77.3	-166	158.1	97.8	-1.2	113.7
15	S	58.4	Low	69.8	Low	117 Å²	117	112.3 Å²	112.3	82%	0.818	60%	0.595	S	S	*	*	S	Bend	trans	-136.6	6.2	173.8	-151.9	0	0	0	0	118.5	P13	P13-S15 PolarHBondContact O-N 2.83Å; P13-S15 VanDerWaalsContact O-N 3.09Å
16	S	58.3	Low	71	Confident	51 Å²	51	111.2 Å²	111.2	36%	0.357	59%	0.588	S	S	.	*			trans	-161.2	101.9	167.2	-175.7	0	0	0	0	112.5	Y18 I19 K20	S16-Y18 VanDerWaalsContact C-N 3.26Å; S16-Y18 PolarHBondContact O-N 2.83Å; S16-I19 PolarHBondContact O-N 2.87Å; S16-K20 PolarHBondContact O-N 2.84Å
17	Q	66.2	Low	71.8	Confident	155 Å²	155	110.9 Å²	110.9	72%	0.724	59%	0.586	S	S	*	*	H	α-helix	trans	-62.3	-32.6	177	-102.9	167.3	-42.8	0	0	112.3	K20 W21	Q17-K20 WeakPolarHBondContact O-CB 3.24Å; Q17-K20 PolarHBondContact O-N 3.4Å; Q17-W21 PolarHBondContact O-N 3.5Å
18	Y	70.6	Confident	72.6	Confident	184 Å²	184	110.2 Å²	110.2	72%	0.722	59%	0.589	S	S	*	*	H	α-helix	trans	-65.2	-44.1	179.6	-109.8	-88.9	0	0	0	112.8	S16 K20 W21 I22	S16-Y18 VanDerWaalsContact C-N 3.26Å; S16-Y18 PolarHBondContact O-N 2.83Å; Y18-K20 PolarHBondContact O-N 3.01Å; Y18-W21 PolarHBondContact O-N 3.44Å; Y18-I22 HydrophobicContact CD1-CD1 4.28Å; Y18-I22 WeakPolarHBondContact O-CG1 3.41Å; Y18-I22 PolarHBondContact O-N 3.26Å
19	I	73.3	Confident	73.6	Confident	106 Å²	106	112.4 Å²	112.4	54%	0.544	60%	0.597	S	S	.	*	H	α-helix	trans	-60.9	-36.9	175.8	-74.9	170.6	0	0	0	110.4	S16 W21 V23	S16-I19 PolarHBondContact O-N 2.87Å; I19-W21 PolarHBondContact O-N 2.76Å; I19-V23 HydrophobicContact CG2-CG2 4.08Å; I19-V23 VanDerWaalsContact O-CB 3.23Å; I19-V23 WeakPolarHBondContact O-CB 3.46Å; I19-V23 WeakPolarHBondContact O-CG2 3.12Å; I19-V23 PolarHBondContact O-N 3.35Å
20	K	74.1	Confident	74.3	Confident	98 Å²	98	112 Å²	112	43%	0.426	59%	0.589	S	S	.	*	H	α-helix	trans	-62.2	-43.3	177.2	-67	-178.5	177.8	-169	0	112.6	S16 Q17 Y18 S24	S16-K20 PolarHBondContact O-N 2.84Å; Q17-K20 WeakPolarHBondContact O-CB 3.24Å; Q17-K20 PolarHBondContact O-N 3.4Å; Y18-K20 PolarHBondContact O-N 3.01Å; K20-S24 VanDerWaalsContact O-CB 3.3Å; K20-S24 WeakPolarHBondContact O-CB 3.28Å; K20-S24 PolarHBondContact O-N 3.21Å; K20-S24 PolarHBondContact O-OG 3.05Å; K20-S24 VanDerWaalsContact O-OG 3.12Å
21	W	79.9	Confident	75.1	Confident	181 Å²	181	107.6 Å²	107.6	69%	0.686	57%	0.571	S	S	*	*	H	α-helix	trans	-72	-39.4	-179.5	-68.1	115	0	0	0	113	Q17 Y18 I19 S24 A25	Q17-W21 PolarHBondContact O-N 3.5Å; Y18-W21 PolarHBondContact O-N 3.44Å; I19-W21 PolarHBondContact O-N 2.76Å; W21-S24 WeakPolarHBondContact CA-OG 3.2Å; W21-S24 PolarHBondContact O-N 3.5Å; W21-S24 PolarHBondContact O-OG 3.46Å; W21-A25 VanDerWaalsContact O-CB 3.29Å; W21-A25 WeakPolarHBondContact O-CB 3.45Å; W21-A25 PolarHBondContact O-N 3.16Å
22	I	81.2	Confident	75.9	Confident	112 Å²	112	108.6 Å²	108.6	57%	0.574	57%	0.573	S	S	*	*	H	α-helix	trans	-66.5	-44.6	176.7	-69.3	165.6	0	0	0	110.2	Y18 A25 G26	Y18-I22 HydrophobicContact CD1-CD1 4.28Å; Y18-I22 WeakPolarHBondContact O-CG1 3.41Å; Y18-I22 PolarHBondContact O-N 3.26Å; I22-A25 PolarHBondContact O-N 3.21Å; I22-G26 PolarHBondContact O-N 2.96Å
23	V	82.9	Confident	77.6	Confident	79 Å²	79	110 Å²	110	48%	0.479	58%	0.575	S	S	.	*	H	α-helix	trans	-64.2	-42.9	176.7	171.8	0	0	0	0	110.5	I19 G26 L27	I19-V23 HydrophobicContact CG2-CG2 4.08Å; I19-V23 VanDerWaalsContact O-CB 3.23Å; I19-V23 WeakPolarHBondContact O-CB 3.46Å; I19-V23 WeakPolarHBondContact O-CG2 3.12Å; I19-V23 PolarHBondContact O-N 3.35Å; V23-G26 PolarHBondContact O-N 3.49Å; V23-L27 VanDerWaalsContact O-CB 3.26Å; V23-L27 WeakPolarHBondContact O-CB 3.46Å; V23-L27 PolarHBondContact O-N 3.07Å
24	S	82.4	Confident	78.8	Confident	55 Å²	55	108 Å²	108	39%	0.385	56%	0.563	S	S	.	*	H	α-helix	trans	-67	-40	179	66.1	0	0	0	0	112.9	K20 W21 L27 A28	K20-S24 VanDerWaalsContact O-CB 3.3Å; K20-S24 WeakPolarHBondContact O-CB 3.28Å; K20-S24 PolarHBondContact O-N 3.21Å; K20-S24 PolarHBondContact O-OG 3.05Å; K20-S24 VanDerWaalsContact O-OG 3.12Å; W21-S24 WeakPolarHBondContact CA-OG 3.2Å; W21-S24 PolarHBondContact O-N 3.5Å; W21-S24 PolarHBondContact O-OG 3.46Å; S24-L27 PolarHBondContact O-N 3.48Å; S24-A28 WeakPolarHBondContact O-CB 3.29Å; S24-A28 PolarHBondContact O-N 3.37Å
25	A	87.8	Confident	79.6	Confident	61 Å²	61	104.4 Å²	104.4	50%	0.504	55%	0.554	S	S	.	*	H	α-helix	trans	-64.1	-46.3	175.4	0	0	0	0	0	111.8	W21 I22 L27 A28 Q29	W21-A25 VanDerWaalsContact O-CB 3.29Å; W21-A25 WeakPolarHBondContact O-CB 3.45Å; W21-A25 PolarHBondContact O-N 3.16Å; I22-A25 PolarHBondContact O-N 3.21Å; A25-L27 VanDerWaalsContact C-N 3.34Å; A25-L27 PolarHBondContact O-N 3.03Å; A25-A28 PolarHBondContact O-N 2.89Å; A25-Q29 PolarHBondContact O-N 3.4Å
26	G	86.6	Confident	80.9	Confident	31 Å²	31	102.1 Å²	102.1	32%	0.32	54%	0.535	S	S	.	.	H	α-helix	trans	-62.3	-40.7	175.4	0	0	0	0	0	112.4	I22 V23 Q29 V30	I22-G26 PolarHBondContact O-N 2.96Å; V23-G26 PolarHBondContact O-N 3.49Å; G26-Q29 PolarHBondContact O-N 3.35Å; G26-V30 VanDerWaalsContact O-CG2 3.31Å; G26-V30 WeakPolarHBondContact O-CG2 3.39Å; G26-V30 PolarHBondContact O-N 3.12Å
27	L	89.5	Confident	81.9	Confident	101 Å²	101	104.1 Å²	104.1	53%	0.529	54%	0.541	S	S	.	.	H	α-helix	trans	-67.3	-38.9	178.3	-147.2	78.3	0	0	0	112.2	V23 S24 A25 S31	V23-L27 VanDerWaalsContact O-CB 3.26Å; V23-L27 WeakPolarHBondContact O-CB 3.46Å; V23-L27 PolarHBondContact O-N 3.07Å; S24-L27 PolarHBondContact O-N 3.48Å; A25-L27 VanDerWaalsContact C-N 3.34Å; A25-L27 PolarHBondContact O-N 3.03Å; L27-S31 VanDerWaalsContact O-CB 3.29Å; L27-S31 WeakPolarHBondContact O-CB 3.38Å; L27-S31 PolarHBondContact O-N 2.92Å; L27-S31 PolarHBondContact O-OG 2.92Å
28	A	88.1	Confident	82.1	Confident	62 Å²	62	98.6 Å²	98.6	51%	0.512	53%	0.526	S	S	.	.	H	α-helix	trans	-62.9	-44.9	175.8	0	0	0	0	0	111.4	S24 A25 S31 E32	S24-A28 WeakPolarHBondContact O-CB 3.29Å; S24-A28 PolarHBondContact O-N 3.37Å; A25-A28 PolarHBondContact O-N 2.89Å; A28-S31 WeakPolarHBondContact O-CB 3.31Å; A28-S31 PolarHBondContact O-N 3.42Å; A28-E32 PolarHBondContact O-N 3.01Å; A28-E32 VanDerWaalsContact O-N 3.11Å
29	Q	87.3	Confident	82.4	Confident	147 Å²	147	91.1 Å²	91.1	69%	0.687	50%	0.501	S	S	*	.	H	α-helix	trans	-63.6	-46.9	178.6	-173	-178.8	3	0	0	112.1	A25 G26 S31 E32 F33	A25-Q29 PolarHBondContact O-N 3.4Å; G26-Q29 PolarHBondContact O-N 3.35Å; Q29-S31 VanDerWaalsContact C-N 3.25Å; Q29-S31 PolarHBondContact O-N 3.48Å; Q29-E32 PolarHBondContact O-N 3.34Å; Q29-F33 PolarHBondContact O-N 2.98Å
30	V	82.9	Confident	82.4	Confident	93 Å²	93	94 Å²	94	56%	0.564	51%	0.505	S	S	*	.	H	α-helix	trans	-63.5	-34.5	177.2	173.9	0	0	0	0	111.1	G26 F33 S34	G26-V30 VanDerWaalsContact O-CG2 3.31Å; G26-V30 WeakPolarHBondContact O-CG2 3.39Å; G26-V30 PolarHBondContact O-N 3.12Å; V30-F33 PolarHBondContact O-N 2.99Å; V30-S34 PolarHBondContact O-N 3.49Å; V30-S34 PolarHBondContact O-OG 3.44Å
31	S	85.3	Confident	82	Confident	51 Å²	51	91 Å²	91	36%	0.357	50%	0.498	S	S	.	.	H	α-helix	trans	-66.8	-38.6	178.2	-61.9	0	0	0	0	113.1	L27 A28 Q29 S34 F35	L27-S31 VanDerWaalsContact O-CB 3.29Å; L27-S31 WeakPolarHBondContact O-CB 3.38Å; L27-S31 PolarHBondContact O-N 2.92Å; L27-S31 PolarHBondContact O-OG 2.92Å; A28-S31 WeakPolarHBondContact O-CB 3.31Å; A28-S31 PolarHBondContact O-N 3.42Å; Q29-S31 VanDerWaalsContact C-N 3.25Å; Q29-S31 PolarHBondContact O-N 3.48Å; S31-S34 PolarHBondContact O-N 3.23Å; S31-F35 WeakPolarHBondContact O-CB 3.3Å; S31-F35 PolarHBondContact O-N 3.33Å
32	E	87.9	Confident	81.1	Confident	142 Å²	142	92.5 Å²	92.5	66%	0.664	50%	0.504	S	S	*	.	H	α-helix	trans	-62.9	-44.8	176.1	-175.5	175.1	-172.8	0	0	111	A28 Q29 F35 V36	A28-E32 PolarHBondContact O-N 3.01Å; A28-E32 VanDerWaalsContact O-N 3.11Å; Q29-E32 PolarHBondContact O-N 3.34Å; E32-F35 PolarHBondContact O-N 2.93Å; E32-V36 WeakPolarHBondContact O-CG2 3.29Å; E32-V36 PolarHBondContact O-N 2.67Å
33	F	86.5	Confident	80.2	Confident	136 Å²	136	95.8 Å²	95.8	60%	0.596	51%	0.509	S	S	*	.	H	α-helix	trans	-65	-43.4	178.1	-174.5	-109	0	0	0	112.6	Q29 V30 F35 V36 L37	Q29-F33 PolarHBondContact O-N 2.98Å; V30-F33 PolarHBondContact O-N 2.99Å; F33-F35 VanDerWaalsContact C-N 3.29Å; F33-F35 PolarHBondContact O-N 3.31Å; F33-V36 PolarHBondContact O-N 2.52Å; F33-L37 HydrophobicContact CD1-CD1 3.76Å; F33-L37 HydrophobicContact CD1-CG 4.47Å; F33-L37 HydrophobicContact CE1-CD1 3.22Å; F33-L37 HydrophobicContact CE1-CG 4.08Å; F33-L37 HydrophobicContact CE2-CD1 4.38Å; F33-L37 HydrophobicContact CE2-CG 4.42Å; F33-L37 HydrophobicContact CZ-CD1 3.59Å; F33-L37 HydrophobicContact CZ-CG 4.05Å; F33-L37 WeakPolarHBondContact O-CB 3.11Å; F33-L37 PolarHBondContact O-N 3.41Å
34	S	81.6	Confident	79.3	Confident	71 Å²	71	95.3 Å²	95.3	50%	0.497	51%	0.514	S	S	.	.	H	α-helix	trans	-62	-34.8	172.9	-70.1	0	0	0	0	112.8	V30 S31 G38	V30-S34 PolarHBondContact O-N 3.49Å; V30-S34 PolarHBondContact O-OG 3.44Å; S31-S34 PolarHBondContact O-N 3.23Å; S34-G38 PolarHBondContact O-N 3.25Å
35	F	80.7	Confident	78.3	Confident	160 Å²	160	95.6 Å²	95.6	70%	0.702	53%	0.525	S	S	*	.	H	α-helix	trans	-69.7	-41.7	175.8	-169.3	-96.5	0	0	0	111.9	S31 E32 F33 G38 S39	S31-F35 WeakPolarHBondContact O-CB 3.3Å; S31-F35 PolarHBondContact O-N 3.33Å; E32-F35 PolarHBondContact O-N 2.93Å; F33-F35 VanDerWaalsContact C-N 3.29Å; F33-F35 PolarHBondContact O-N 3.31Å; F35-G38 PolarHBondContact O-N 3.24Å; F35-S39 WeakPolarHBondContact O-CB 3.43Å; F35-S39 PolarHBondContact O-N 2.91Å
36	V	84.9	Confident	77.1	Confident	69 Å²	69	97.9 Å²	97.9	42%	0.418	53%	0.533	S	S	.	.	H	α-helix	trans	-61.9	-50.5	174.6	170.9	0	0	0	0	110.5	E32 F33 S39 R40	E32-V36 WeakPolarHBondContact O-CG2 3.29Å; E32-V36 PolarHBondContact O-N 2.67Å; F33-V36 PolarHBondContact O-N 2.52Å; V36-S39 WeakPolarHBondContact O-CB 3.26Å; V36-S39 PolarHBondContact O-N 3.44Å; V36-R40 WeakPolarHBondContact O-CG 3.34Å; V36-R40 PolarHBondContact O-N 3.48Å
37	L	80.2	Confident	75.8	Confident	92 Å²	92	100.9 Å²	100.9	48%	0.482	54%	0.54	S	S	.	.	H	α-helix	trans	-61.7	-45.7	176.9	-79.9	175.8	0	0	0	112.2	F33 S39 R40 A41	F33-L37 HydrophobicContact CD1-CD1 3.76Å; F33-L37 HydrophobicContact CD1-CG 4.47Å; F33-L37 HydrophobicContact CE1-CD1 3.22Å; F33-L37 HydrophobicContact CE1-CG 4.08Å; F33-L37 HydrophobicContact CE2-CD1 4.38Å; F33-L37 HydrophobicContact CE2-CG 4.42Å; F33-L37 HydrophobicContact CZ-CD1 3.59Å; F33-L37 HydrophobicContact CZ-CG 4.05Å; F33-L37 WeakPolarHBondContact O-CB 3.11Å; F33-L37 PolarHBondContact O-N 3.41Å; L37-S39 VanDerWaalsContact C-N 3.3Å; L37-S39 PolarHBondContact O-N 3.03Å; L37-R40 PolarHBondContact O-N 3.21Å; L37-R40 VanDerWaalsContact O-N 3.16Å; L37-A41 VanDerWaalsContact O-CB 3.28Å; L37-A41 WeakPolarHBondContact O-CB 3.5Å; L37-A41 PolarHBondContact O-N 2.99Å
38	G	70.3	Confident	74.9	Confident	39 Å²	39	99 Å²	99	40%	0.402	54%	0.536	S	S	.	.	H	α-helix	trans	-61.5	-37.9	176.2	0	0	0	0	0	112.6	S34 F35 R40 R42	S34-G38 PolarHBondContact O-N 3.25Å; F35-G38 PolarHBondContact O-N 3.24Å; G38-R40 VanDerWaalsContact C-N 3.34Å; G38-R40 PolarHBondContact O-N 3.1Å; G38-R42 WeakPolarHBondContact O-CB 3.23Å; G38-R42 PolarHBondContact O-N 3.15Å
39	S	75.9	Confident	73.8	Confident	28 Å²	28	105.5 Å²	105.5	20%	0.196	55%	0.547	C	S	.	.	H	α-helix	trans	-67.1	-32.5	175.3	-176.4	0	0	0	0	112.8	F35 V36 L37 R43	F35-S39 WeakPolarHBondContact O-CB 3.43Å; F35-S39 PolarHBondContact O-N 2.91Å; V36-S39 WeakPolarHBondContact O-CB 3.26Å; V36-S39 PolarHBondContact O-N 3.44Å; L37-S39 VanDerWaalsContact C-N 3.3Å; L37-S39 PolarHBondContact O-N 3.03Å; S39-R43 WeakPolarHBondContact O-CG 3.21Å; S39-R43 PolarHBondContact O-N 3.48Å; S39-R43 PolarHBondContact O-NE 3.39Å; S39-R43 VanDerWaalsContact O-NE 3.11Å; S39-R43 PolarHBondContact OG-NH2 3.24Å
40	R	74.6	Confident	73.2	Confident	167 Å²	167	104.4 Å²	104.4	63%	0.63	54%	0.542	S	S	*	.	H	α-helix	trans	-79.9	-43	173.8	-62.1	-55.8	177.5	107.4	0.2	111.9	V36 L37 G38 R42 R43 A44	V36-R40 WeakPolarHBondContact O-CG 3.34Å; V36-R40 PolarHBondContact O-N 3.48Å; L37-R40 PolarHBondContact O-N 3.21Å; L37-R40 VanDerWaalsContact O-N 3.16Å; G38-R40 VanDerWaalsContact C-N 3.34Å; G38-R40 PolarHBondContact O-N 3.1Å; R40-R42 VanDerWaalsContact C-N 3.34Å; R40-R42 PolarHBondContact O-N 3.29Å; R40-R43 PolarHBondContact O-N 3.34Å; R40-A44 VanDerWaalsContact O-CB 3.24Å; R40-A44 WeakPolarHBondContact O-CB 3.43Å; R40-A44 PolarHBondContact O-N 3.03Å
41	A	66.2	Low	72.8	Confident	34 Å²	34	103.2 Å²	103.2	28%	0.281	54%	0.535	S	S	.	.	H	α-helix	trans	-62.5	-38.8	176.5	0	0	0	0	0	112.3	L37 A44 G45 V46	L37-A41 VanDerWaalsContact O-CB 3.28Å; L37-A41 WeakPolarHBondContact O-CB 3.5Å; L37-A41 PolarHBondContact O-N 2.99Å; A41-A44 PolarHBondContact O-N 3.5Å; A41-G45 PolarHBondContact O-N 3.02Å; A41-V46 PolarHBondContact O-N 2.88Å
42	R	60.3	Low	72.1	Confident	212 Å²	212	107.7 Å²	107.7	80%	0.8	55%	0.545	S	S	*	.	H	α-helix	trans	-66.5	-39.2	174.4	-167.6	177.4	89.3	-161.7	7.4	112.4	G38 R40 A44	G38-R42 WeakPolarHBondContact O-CB 3.23Å; G38-R42 PolarHBondContact O-N 3.15Å; R40-R42 VanDerWaalsContact C-N 3.34Å; R40-R42 PolarHBondContact O-N 3.29Å; R42-A44 VanDerWaalsContact C-N 3.34Å
43	R	61.9	Low	71.6	Confident	181 Å²	181	104.9 Å²	104.9	68%	0.683	53%	0.534	S	S	*	.	H	α-helix	trans	-73.3	-26.8	175.3	-80.2	-174.9	-89.5	-158.5	-2.3	112.9	S39 R40 G45	S39-R43 WeakPolarHBondContact O-CG 3.21Å; S39-R43 PolarHBondContact O-N 3.48Å; S39-R43 PolarHBondContact O-NE 3.39Å; S39-R43 VanDerWaalsContact O-NE 3.11Å; S39-R43 PolarHBondContact OG-NH2 3.24Å; R40-R43 PolarHBondContact O-N 3.34Å; R43-G45 VanDerWaalsContact C-N 3.33Å
44	A	63.5	Low	71.4	Confident	70 Å²	70	103.8 Å²	103.8	58%	0.579	53%	0.534	S	S	*	.	T	Hydrogen-bonded Turn	trans	-84.5	-1.3	178	0	0	0	0	0	113.8	R40 A41 R42 V46	R40-A44 VanDerWaalsContact O-CB 3.24Å; R40-A44 WeakPolarHBondContact O-CB 3.43Å; R40-A44 PolarHBondContact O-N 3.03Å; A41-A44 PolarHBondContact O-N 3.5Å; R42-A44 VanDerWaalsContact C-N 3.34Å; A44-V46 HydrophobicContact CB-CG2 3.77Å; A44-V46 PolarHBondContact O-N 2.95Å
45	G	61.2	Low	71.4	Confident	61 Å²	61	105 Å²	105	63%	0.629	53%	0.534	S	S	*	.	T	Hydrogen-bonded Turn	trans	67.7	15.1	176.4	0	0	0	0	0	115.1	A41 R43 I47	A41-G45 PolarHBondContact O-N 3.02Å; R43-G45 VanDerWaalsContact C-N 3.33Å; G45-I47 VanDerWaalsContact C-N 3.29Å; G45-I47 PolarHBondContact O-N 3.09Å
46	V	63.2	Low	71.4	Confident	109 Å²	109	101.4 Å²	101.4	66%	0.661	52%	0.521	S	S	*	.			trans	-68.8	-24.9	-170.3	179	0	0	0	0	112.9	A41 A44	A41-V46 PolarHBondContact O-N 2.88Å; A44-V46 HydrophobicContact CB-CG2 3.77Å; A44-V46 PolarHBondContact O-N 2.95Å
47	I	60	Low	71.6	Confident	93 Å²	93	101.1 Å²	101.1	48%	0.477	52%	0.522	S	S	.	.	S	Bend	trans	-121.1	113	179.4	-62.2	176.1	0	0	0	108.4	G45 V51	G45-I47 VanDerWaalsContact C-N 3.29Å; G45-I47 PolarHBondContact O-N 3.09Å; I47-V51 HydrophobicContact CG2-CB 4.05Å; I47-V51 HydrophobicContact CG2-CG1 4.15Å
48	S	69.5	Low	72.1	Confident	63 Å²	63	101.4 Å²	101.4	44%	0.441	53%	0.528	S	S	.	.			trans	-66.2	152.7	173.7	-160.5	0	0	0	0	110.9	E50 V51 Y52	S48-E50 WeakPolarHBondContact CB-OE2 3.33Å; S48-E50 PolarHBondContact O-N 3.09Å; S48-E50 VanDerWaalsContact O-N 3.15Å; S48-E50 PolarHBondContact OG-OE2 3.44Å; S48-V51 PolarHBondContact O-N 3.12Å; S48-Y52 PolarHBondContact O-N 2.73Å; S48-Y52 VanDerWaalsContact O-N 3.1Å
49	R	65.7	Low	72.7	Confident	198 Å²	198	103 Å²	103	75%	0.747	53%	0.53	S	S	*	.	H	α-helix	trans	-58.6	-32	-175.6	-156.5	174.7	-168.2	-91.5	3.1	111.7	L53	R49-L53 VanDerWaalsContact O-CG 3.32Å; R49-L53 WeakPolarHBondContact O-CG 3.35Å; R49-L53 PolarHBondContact O-N 2.97Å
50	E	74.4	Confident	73.2	Confident	123 Å²	123	105.3 Å²	105.3	58%	0.575	54%	0.543	S	S	*	.	H	α-helix	trans	-68.3	-42.1	175.5	-53	84.1	-170.5	0	0	112.2	S48 L53 L54	S48-E50 WeakPolarHBondContact CB-OE2 3.33Å; S48-E50 PolarHBondContact O-N 3.09Å; S48-E50 VanDerWaalsContact O-N 3.15Å; S48-E50 PolarHBondContact OG-OE2 3.44Å; E50-L53 PolarHBondContact O-N 3.49Å; E50-L54 WeakPolarHBondContact O-CB 3.32Å; E50-L54 PolarHBondContact O-N 3.34Å
51	V	75.4	Confident	73.9	Confident	69 Å²	69	102.8 Å²	102.8	42%	0.418	54%	0.541	S	S	.	.	H	α-helix	trans	-67.1	-39.5	-179.5	179.7	0	0	0	0	110.7	I47 S48 L53 L54 I55	I47-V51 HydrophobicContact CG2-CB 4.05Å; I47-V51 HydrophobicContact CG2-CG1 4.15Å; S48-V51 PolarHBondContact O-N 3.12Å; V51-L53 VanDerWaalsContact C-N 3.35Å; V51-L53 PolarHBondContact O-N 3.5Å; V51-L54 PolarHBondContact O-N 3.37Å; V51-I55 HydrophobicContact CG1-CD1 3.94Å; V51-I55 WeakPolarHBondContact O-CG1 3.31Å; V51-I55 PolarHBondContact O-N 3.06Å
52	Y	69.4	Low	74.8	Confident	145 Å²	145	104.9 Å²	104.9	57%	0.569	55%	0.554	S	S	*	*	H	α-helix	trans	-60	-44.6	173.1	179.8	-96.8	0	0	0	111.9	S48 L56	S48-Y52 PolarHBondContact O-N 2.73Å; S48-Y52 VanDerWaalsContact O-N 3.1Å; Y52-L56 HydrophobicContact CE1-CD2 4.37Å; Y52-L56 WeakPolarHBondContact O-CB 3.41Å; Y52-L56 PolarHBondContact O-N 3.47Å
53	L	76.9	Confident	76.1	Confident	82 Å²	82	100 Å²	100	43%	0.429	54%	0.543	S	S	.	.	H	α-helix	trans	-69.1	-33.2	178.5	-71.8	172.3	0	0	0	112.9	R49 E50 V51 S57	R49-L53 VanDerWaalsContact O-CG 3.32Å; R49-L53 WeakPolarHBondContact O-CG 3.35Å; R49-L53 PolarHBondContact O-N 2.97Å; E50-L53 PolarHBondContact O-N 3.49Å; V51-L53 VanDerWaalsContact C-N 3.35Å; V51-L53 PolarHBondContact O-N 3.5Å; L53-S57 VanDerWaalsContact O-CB 3.29Å; L53-S57 WeakPolarHBondContact O-CB 3.29Å; L53-S57 PolarHBondContact O-N 2.94Å; L53-S57 PolarHBondContact O-OG 2.99Å
54	L	84.4	Confident	77.3	Confident	113 Å²	113	97 Å²	97	59%	0.592	54%	0.54	S	S	*	.	H	α-helix	trans	-66	-47.9	174.5	-85.3	168	0	0	0	111.9	E50 V51 L56 S57 V58	E50-L54 WeakPolarHBondContact O-CB 3.32Å; E50-L54 PolarHBondContact O-N 3.34Å; V51-L54 PolarHBondContact O-N 3.37Å; L54-L56 VanDerWaalsContact C-N 3.34Å; L54-L56 PolarHBondContact O-N 2.72Å; L54-S57 PolarHBondContact O-N 2.95Å; L54-V58 PolarHBondContact O-N 3.3Å
55	I	79.8	Confident	78.4	Confident	98 Å²	98	98 Å²	98	50%	0.503	54%	0.535	S	S	.	.	H	α-helix	trans	-63.2	-42.6	178.1	-66.2	167.6	0	0	0	110.5	V51 S57 V58 T59	V51-I55 HydrophobicContact CG1-CD1 3.94Å; V51-I55 WeakPolarHBondContact O-CG1 3.31Å; V51-I55 PolarHBondContact O-N 3.06Å; I55-S57 PolarHBondContact O-N 3.02Å; I55-V58 PolarHBondContact O-N 3.14Å; I55-T59 WeakPolarHBondContact O-CB 3.38Å; I55-T59 PolarHBondContact O-N 3.39Å; I55-T59 PolarHBondContact O-OG1 3.49Å
56	L	81.7	Confident	79.5	Confident	84 Å²	84	97.6 Å²	97.6	44%	0.44	53%	0.526	S	S	.	.	H	α-helix	trans	-63	-42.1	177.4	-173	65.6	0	0	0	111.8	Y52 L54 T60	Y52-L56 HydrophobicContact CE1-CD2 4.37Å; Y52-L56 WeakPolarHBondContact O-CB 3.41Å; Y52-L56 PolarHBondContact O-N 3.47Å; L54-L56 VanDerWaalsContact C-N 3.34Å; L54-L56 PolarHBondContact O-N 2.72Å; L56-T60 WeakPolarHBondContact O-CB 3.25Å; L56-T60 PolarHBondContact O-N 2.74Å; L56-T60 PolarHBondContact O-OG1 3.49Å
57	S	88.1	Confident	80.4	Confident	63 Å²	63	95.8 Å²	95.8	44%	0.441	52%	0.516	S	S	.	.	H	α-helix	trans	-63.2	-51.4	176.8	-62.2	0	0	0	0	111.6	L53 L54 I55 T59 T60 L61	L53-S57 VanDerWaalsContact O-CB 3.29Å; L53-S57 WeakPolarHBondContact O-CB 3.29Å; L53-S57 PolarHBondContact O-N 2.94Å; L53-S57 PolarHBondContact O-OG 2.99Å; L54-S57 PolarHBondContact O-N 2.95Å; I55-S57 PolarHBondContact O-N 3.02Å; S57-T59 VanDerWaalsContact C-N 3.32Å; S57-T59 PolarHBondContact O-N 2.99Å; S57-T60 PolarHBondContact O-N 3.43Å; S57-L61 WeakPolarHBondContact O-CD1 3.38Å; S57-L61 PolarHBondContact O-N 2.91Å
58	V	91.6	Very high	81.7	Confident	98 Å²	98	95.9 Å²	95.9	59%	0.594	52%	0.521	S	S	*	.	H	α-helix	trans	-59.5	-43.1	179	164.2	0	0	0	0	111.7	L54 I55 T60 L61 S62	L54-V58 PolarHBondContact O-N 3.3Å; I55-V58 PolarHBondContact O-N 3.14Å; V58-T60 VanDerWaalsContact C-N 3.35Å; V58-T60 PolarHBondContact O-N 3.24Å; V58-L61 PolarHBondContact O-N 3.37Å; V58-S62 WeakPolarHBondContact O-CB 3.42Å; V58-S62 PolarHBondContact O-N 3.37Å
59	T	82.1	Confident	82.4	Confident	72 Å²	72	98 Å²	98	44%	0.442	53%	0.527	S	S	.	.	H	α-helix	trans	-63.4	-42.8	178	-54.5	0	0	0	0	111.2	I55 S57 S62 L63	I55-T59 WeakPolarHBondContact O-CB 3.38Å; I55-T59 PolarHBondContact O-N 3.39Å; I55-T59 PolarHBondContact O-OG1 3.49Å; S57-T59 VanDerWaalsContact C-N 3.32Å; S57-T59 PolarHBondContact O-N 2.99Å; T59-S62 PolarHBondContact O-N 3.39Å; T59-L63 HydrophobicContact CG2-CD1 4.38Å; T59-L63 WeakPolarHBondContact O-CG 3.21Å; T59-L63 PolarHBondContact O-N 3.17Å
60	T	86.8	Confident	82.9	Confident	77 Å²	77	97.2 Å²	97.2	47%	0.472	52%	0.524	S	S	.	.	H	α-helix	trans	-64.2	-44.3	178.2	-55.9	0	0	0	0	111.3	L56 S57 V58 S62 L63 L64	L56-T60 WeakPolarHBondContact O-CB 3.25Å; L56-T60 PolarHBondContact O-N 2.74Å; L56-T60 PolarHBondContact O-OG1 3.49Å; S57-T60 PolarHBondContact O-N 3.43Å; V58-T60 VanDerWaalsContact C-N 3.35Å; V58-T60 PolarHBondContact O-N 3.24Å; T60-S62 PolarHBondContact O-N 3.48Å; T60-L63 PolarHBondContact O-N 3Å; T60-L64 WeakPolarHBondContact O-CB 3.39Å; T60-L64 PolarHBondContact O-N 3.32Å
61	L	89.2	Confident	83	Confident	113 Å²	113	100.5 Å²	100.5	59%	0.592	53%	0.531	S	S	*	.	H	α-helix	trans	-61.1	-43.4	174.5	-93.2	102.4	0	0	0	112	S57 V58 L63 L64 L65	S57-L61 WeakPolarHBondContact O-CD1 3.38Å; S57-L61 PolarHBondContact O-N 2.91Å; V58-L61 PolarHBondContact O-N 3.37Å; L61-L63 PolarHBondContact O-N 3.31Å; L61-L64 PolarHBondContact O-N 3.46Å; L61-L65 PolarHBondContact O-N 2.89Å
62	S	85.9	Confident	83.3	Confident	79 Å²	79	99.6 Å²	99.6	55%	0.552	53%	0.531	S	S	*	.	H	α-helix	trans	-64	-41.4	-179.4	-161.2	0	0	0	0	111.9	V58 T59 T60 L64 L65 A66	V58-S62 WeakPolarHBondContact O-CB 3.42Å; V58-S62 PolarHBondContact O-N 3.37Å; T59-S62 PolarHBondContact O-N 3.39Å; T60-S62 PolarHBondContact O-N 3.48Å; S62-L64 VanDerWaalsContact C-N 3.32Å; S62-L64 PolarHBondContact O-N 2.91Å; S62-L65 PolarHBondContact O-N 3.04Å; S62-A66 PolarHBondContact O-N 3.19Å
63	L	86.9	Confident	83.7	Confident	109 Å²	109	95.3 Å²	95.3	57%	0.571	53%	0.525	S	S	*	.	H	α-helix	trans	-64.6	-35.3	173.9	-72.9	174.5	0	0	0	112.8	T59 T60 L61 P67	T59-L63 HydrophobicContact CG2-CD1 4.38Å; T59-L63 WeakPolarHBondContact O-CG 3.21Å; T59-L63 PolarHBondContact O-N 3.17Å; T60-L63 PolarHBondContact O-N 3Å; L61-L63 PolarHBondContact O-N 3.31Å; L63-P67 WeakPolarHBondContact O-CD 3.1Å
64	L	88.4	Confident	83.7	Confident	119 Å²	119	96.5 Å²	96.5	62%	0.623	53%	0.531	S	S	*	.	H	α-helix	trans	-72.7	-34.8	177.6	-157.2	149.8	0	0	0	111.4	T60 L61 S62 P67	T60-L64 WeakPolarHBondContact O-CB 3.39Å; T60-L64 PolarHBondContact O-N 3.32Å; L61-L64 PolarHBondContact O-N 3.46Å; S62-L64 VanDerWaalsContact C-N 3.32Å; S62-L64 PolarHBondContact O-N 2.91Å; L64-P67 WeakPolarHBondContact O-CD 3.47Å; L64-P67 WeakPolarHBondContact O-CG 3.38Å
65	L	85.8	Confident	82.9	Confident	90 Å²	90	96.4 Å²	96.4	47%	0.471	54%	0.535	S	S	.	.	H	α-helix	trans	-72	-36	176.1	-109.2	73.6	0	0	0	113.3	L61 S62 V68 L69	L61-L65 PolarHBondContact O-N 2.89Å; S62-L65 PolarHBondContact O-N 3.04Å; L65-V68 WeakPolarHBondContact O-CB 3.39Å; L65-V68 PolarHBondContact O-N 3.28Å; L65-L69 HydrophobicContact CB-CD1 4.38Å; L65-L69 HydrophobicContact CD2-CD1 4.47Å; L65-L69 WeakPolarHBondContact O-CG 3.47Å; L65-L69 PolarHBondContact O-N 2.93Å
66	A	85	Confident	82	Confident	53 Å²	53	100.9 Å²	100.9	44%	0.438	55%	0.546	S	S	.	.	H	α-helix	trans	-50.3	-50.1	-175.7	0	0	0	0	0	114.9	S62 V68 L69 W70	S62-A66 PolarHBondContact O-N 3.19Å; A66-V68 VanDerWaalsContact C-N 3.34Å; A66-V68 PolarHBondContact O-N 3.05Å; A66-L69 PolarHBondContact O-N 3.49Å; A66-W70 WeakPolarHBondContact O-CB 3.37Å; A66-W70 PolarHBondContact O-N 3.47Å
67	P	82.1	Confident	80.8	Confident	71 Å²	71	102.5 Å²	102.5	46%	0.461	56%	0.561	S	S	.	*	H	α-helix	trans	-68.3	-31.3	177.9	26.8	-35.2	0	0	0	112.9	L63 L64 W70 R71	L63-P67 WeakPolarHBondContact O-CD 3.1Å; L64-P67 WeakPolarHBondContact O-CD 3.47Å; L64-P67 WeakPolarHBondContact O-CG 3.38Å; P67-W70 PolarHBondContact O-N 2.92Å; P67-R71 WeakPolarHBondContact O-CB 3.47Å; P67-R71 VanDerWaalsContact O-CG 3.29Å; P67-R71 WeakPolarHBondContact O-CG 3.48Å; P67-R71 PolarHBondContact O-N 2.95Å
68	V	85.8	Confident	79.5	Confident	94 Å²	94	107.6 Å²	107.6	57%	0.57	58%	0.578	S	S	*	*	H	α-helix	trans	-67.7	-46.5	177.6	-179.2	0	0	0	0	110.1	L65 A66 W70 R71 A72	L65-V68 WeakPolarHBondContact O-CB 3.39Å; L65-V68 PolarHBondContact O-N 3.28Å; A66-V68 VanDerWaalsContact C-N 3.34Å; A66-V68 PolarHBondContact O-N 3.05Å; V68-W70 VanDerWaalsContact C-N 3.35Å; V68-R71 PolarHBondContact O-N 3.06Å; V68-A72 WeakPolarHBondContact O-CB 3.32Å; V68-A72 PolarHBondContact O-N 3.49Å
69	L	84.6	Confident	78	Confident	109 Å²	109	110 Å²	110	57%	0.571	59%	0.587	S	S	*	*	H	α-helix	trans	-63.4	-40.7	175.6	-68.6	174.1	0	0	0	111.6	L65 A66 A72 A73	L65-L69 HydrophobicContact CB-CD1 4.38Å; L65-L69 HydrophobicContact CD2-CD1 4.47Å; L65-L69 WeakPolarHBondContact O-CG 3.47Å; L65-L69 PolarHBondContact O-N 2.93Å; A66-L69 PolarHBondContact O-N 3.49Å; L69-A72 PolarHBondContact O-N 2.86Å; L69-A73 WeakPolarHBondContact O-CB 3.32Å; L69-A73 PolarHBondContact O-N 3.33Å
70	W	76.9	Confident	76.6	Confident	180 Å²	180	111.4 Å²	111.4	68%	0.682	60%	0.597	S	S	*	*	H	α-helix	trans	-61.3	-45.7	175	-177.5	-106.1	0	0	0	112.2	A66 P67 V68 A72 A73 I74	A66-W70 WeakPolarHBondContact O-CB 3.37Å; A66-W70 PolarHBondContact O-N 3.47Å; P67-W70 PolarHBondContact O-N 2.92Å; V68-W70 VanDerWaalsContact C-N 3.35Å; W70-A72 PolarHBondContact O-N 3.45Å; W70-A73 PolarHBondContact O-N 2.93Å; W70-I74 HydrophobicContact CD2-CD1 4.03Å; W70-I74 VanDerWaalsContact CE2-CD1 3.43Å; W70-I74 HydrophobicContact CG-CD1 4.08Å; W70-I74 HydrophobicContact CZ2-CD1 3.93Å; W70-I74 WeakPolarHBondContact O-CG1 3.29Å; W70-I74 PolarHBondContact O-N 3.34Å
71	R	77.2	Confident	75.5	Confident	192 Å²	192	113.4 Å²	113.4	73%	0.725	61%	0.609	S	S	*	*	H	α-helix	trans	-62	-43.7	175.3	-73.4	-176.9	77.3	-150.4	1.9	111.6	P67 V68 A73 I74 T75	P67-R71 WeakPolarHBondContact O-CB 3.47Å; P67-R71 VanDerWaalsContact O-CG 3.29Å; P67-R71 WeakPolarHBondContact O-CG 3.48Å; P67-R71 PolarHBondContact O-N 2.95Å; V68-R71 PolarHBondContact O-N 3.06Å; R71-A73 VanDerWaalsContact C-N 3.33Å; R71-A73 PolarHBondContact O-N 3.39Å; R71-I74 PolarHBondContact O-N 3.41Å; R71-T75 PolarHBondContact O-N 2.59Å; R71-T75 PolarHBondContact O-OG1 3.04Å
72	A	80.8	Confident	74.2	Confident	50 Å²	50	114.9 Å²	114.9	41%	0.413	62%	0.617	S	S	.	*	H	α-helix	trans	-63.8	-36.2	176.9	0	0	0	0	0	112.7	V68 L69 W70 T75 R76	V68-A72 WeakPolarHBondContact O-CB 3.32Å; V68-A72 PolarHBondContact O-N 3.49Å; L69-A72 PolarHBondContact O-N 2.86Å; W70-A72 PolarHBondContact O-N 3.45Å; A72-T75 WeakPolarHBondContact CA-OG1 3.44Å; A72-T75 PolarHBondContact O-OG1 2.93Å; A72-R76 PolarHBondContact O-N 3.38Å
73	A	77	Confident	72.7	Confident	55 Å²	55	113.8 Å²	113.8	46%	0.455	61%	0.613	S	S	.	*	H	α-helix	trans	-67.1	-42.9	176.2	0	0	0	0	0	111.9	L69 W70 R71 R76	L69-A73 WeakPolarHBondContact O-CB 3.32Å; L69-A73 PolarHBondContact O-N 3.33Å; W70-A73 PolarHBondContact O-N 2.93Å; R71-A73 VanDerWaalsContact C-N 3.33Å; R71-A73 PolarHBondContact O-N 3.39Å; A73-R76 PolarHBondContact O-N 3.49Å
74	I	77.1	Confident	71.4	Confident	108 Å²	108	114.4 Å²	114.4	55%	0.554	62%	0.621	S	S	*	*	H	α-helix	trans	-73.7	-30.2	178.2	-62.5	162	0	0	0	112.2	W70 R71 R76	W70-I74 HydrophobicContact CD2-CD1 4.03Å; W70-I74 VanDerWaalsContact CE2-CD1 3.43Å; W70-I74 HydrophobicContact CG-CD1 4.08Å; W70-I74 HydrophobicContact CZ2-CD1 3.93Å; W70-I74 WeakPolarHBondContact O-CG1 3.29Å; W70-I74 PolarHBondContact O-N 3.34Å; R71-I74 PolarHBondContact O-N 3.41Å; I74-R76 PolarHBondContact O-N 3.4Å
75	T	67.9	Low	69.9	Low	110 Å²	110	116.1 Å²	116.1	68%	0.675	63%	0.626	S	S	*	*	T	Hydrogen-bonded Turn	trans	-75.5	-6.1	175.4	26.9	0	0	0	0	113.5	R71 A72 P77	R71-T75 PolarHBondContact O-N 2.59Å; R71-T75 PolarHBondContact O-OG1 3.04Å; A72-T75 WeakPolarHBondContact CA-OG1 3.44Å; A72-T75 PolarHBondContact O-OG1 2.93Å; T75-P77 WeakPolarHBondContact O-CD 3.16Å
76	R	60.7	Low	68.5	Low	192 Å²	192	118 Å²	118	73%	0.725	63%	0.634	S	S	*	*	S	Bend	trans	-71.4	111.8	164.6	-64.2	-148.5	-174.8	-164.9	3.5	107.8	A72 A73 I74 H78	A72-R76 PolarHBondContact O-N 3.38Å; A73-R76 PolarHBondContact O-N 3.49Å; I74-R76 PolarHBondContact O-N 3.4Å; R76-H78 PolarHBondContact O-N 3.36Å
77	P	57.6	Low	67.2	Low	118 Å²	118	123.5 Å²	123.5	77%	0.766	65%	0.651	S	S	*	*			trans	-63.2	117.1	176.1	28.1	-31.5	0	0	0	107.1	T75 L79	T75-P77 WeakPolarHBondContact O-CD 3.16Å; P77-L79 PolarHBondContact O-N 3.14Å
78	H	60.4	Low	66	Low	170 Å²	170	122.8 Å²	122.8	79%	0.787	66%	0.657	S	S	*	*			trans	-57.4	108.4	161.5	-66.6	-24.8	0	0	0	106.3	R76	R76-H78 PolarHBondContact O-N 3.36Å
79	L	60.1	Low	64.6	Low	150 Å²	150	123.6 Å²	123.6	79%	0.785	66%	0.662	S	S	*	*			trans	-45.8	122.7	169.3	-81	154.9	0	0	0	107.6	P77 T81	P77-L79 PolarHBondContact O-N 3.14Å; L79-T81 PolarHBondContact O-N 3.28Å; L79-T81 PolarHBondContact O-OG1 2.83Å
80	P	53.5	Low	63.3	Low	100 Å²	100	126.8 Å²	126.8	65%	0.649	67%	0.674	S	S	*	*			trans	-75.8	78.2	179.6	31.3	-32.1	0	0	0	108.4	L82 A83	P80-L82 PolarHBondContact O-N 2.99Å; P80-L82 VanDerWaalsContact O-N 3.14Å; P80-A83 PolarHBondContact O-N 3.49Å
81	T	63.3	Low	62.5	Low	119 Å²	119	122.4 Å²	122.4	73%	0.73	68%	0.676	S	S	*	*	T	Hydrogen-bonded Turn	trans	-70.3	0.9	171.9	-3.7	0	0	0	0	112.7	L79	L79-T81 PolarHBondContact O-N 3.28Å; L79-T81 PolarHBondContact O-OG1 2.83Å
82	L	60.6	Low	61.6	Low	144 Å²	144	122.7 Å²	122.7	75%	0.754	68%	0.683	S	S	*	*	T	Hydrogen-bonded Turn	trans	-96.9	-9.1	177.5	-71.9	163.9	0	0	0	113.8	P80 V84	P80-L82 PolarHBondContact O-N 2.99Å; P80-L82 VanDerWaalsContact O-N 3.14Å; L82-V84 VanDerWaalsContact C-N 3.28Å; L82-V84 PolarHBondContact O-N 3.45Å
83	A	56.1	Low	60.2	Low	57 Å²	57	128.6 Å²	128.6	47%	0.471	70%	0.702	S	S	.	*	H	α-helix	trans	-71.8	-23.9	173.7	0	0	0	0	0	112.6	P80 H85	P80-A83 PolarHBondContact O-N 3.49Å; A83-H85 VanDerWaalsContact C-N 3.33Å; A83-H85 PolarHBondContact O-N 3.41Å
84	V	58.9	Low	59.3	Low	122 Å²	122	134.9 Å²	134.9	74%	0.739	74%	0.738	S	S	*	*	H	α-helix	trans	-77.2	-16.9	-178.8	179.3	0	0	0	0	112.8	L82	L82-V84 VanDerWaalsContact C-N 3.28Å; L82-V84 PolarHBondContact O-N 3.45Å
85	H	56.4	Low	58.4	Low	155 Å²	155	136.3 Å²	136.3	72%	0.718	75%	0.748	S	S	*	*	H	α-helix	trans	-95.8	-19.1	-176.7	-138	58	0	0	0	114.4	A83	A83-H85 VanDerWaalsContact C-N 3.33Å; A83-H85 PolarHBondContact O-N 3.41Å
86	I	57.2	Low	57.9	Low	128 Å²	128	137.6 Å²	137.6	66%	0.656	75%	0.752	S	S	*	*	H	α-helix	trans	-89.4	-31.5	178.9	-55.3	-66.9	0	0	0	111.3	G88 T89	I86-G88 PolarHBondContact O-N 3.42Å; I86-T89 PolarHBondContact O-N 3.36Å
87	E	57.8	Low	57.8	Low	170 Å²	170	134.6 Å²	134.6	79%	0.794	75%	0.753	S	S	*	*	T	Hydrogen-bonded Turn	trans	-73.5	-11.5	179.2	-151.2	158.7	135.9	0	0	113.6
88	G	56.4	Low	57.8	Low	56 Å²	56	135.6 Å²	135.6	58%	0.577	75%	0.752	S	S	*	*	T	Hydrogen-bonded Turn	trans	-88.1	-6.5	175.7	0	0	0	0	0	115.5	I86	I86-G88 PolarHBondContact O-N 3.42Å
89	T	56.6	Low	57.6	Low	110 Å²	110	133.4 Å²	133.4	68%	0.675	75%	0.75	S	S	*	*	T	Hydrogen-bonded Turn	trans	-101.2	-14.5	-177.2	-58.9	0	0	0	0	113.2	I86 A91	I86-T89 PolarHBondContact O-N 3.36Å; T89-A91 PolarHBondContact O-N 3.26Å
90	E	56.8	Low	57.5	Low	177 Å²	177	132.3 Å²	132.3	83%	0.827	75%	0.748	S	S	*	*	T	Hydrogen-bonded Turn	trans	-84.5	2.6	175.9	-57.9	-90.7	112.7	0	0	112.2	F92	E90-F92 VanDerWaalsContact C-N 3.3Å; E90-F92 PolarHBondContact O-N 3.42Å
91	A	59.5	Low	57.7	Low	88 Å²	88	134.6 Å²	134.6	73%	0.727	76%	0.755	S	S	*	*	T	Hydrogen-bonded Turn	trans	-86.9	16.6	179.2	0	0	0	0	0	114.1	T89	T89-A91 PolarHBondContact O-N 3.26Å
92	F	58.3	Low	57.3	Low	198 Å²	198	135.8 Å²	135.8	87%	0.868	76%	0.757	S	S	*	*	S	Bend	trans	-125	105.9	175.3	-161.9	-102.7	0	0	0	110.4	E90	E90-F92 VanDerWaalsContact C-N 3.3Å; E90-F92 PolarHBondContact O-N 3.42Å
93	E	52.1	Low	57	Low	173 Å²	173	135.2 Å²	135.2	81%	0.808	76%	0.757	S	S	*	*			trans	-64.5	168.3	-169.3	-97.2	-141.1	120.4	0	0	117.2
94	P	58.5	Low	57.1	Low	188 Å²	188	142.3 Å²	142.3	100%	1.221	78%	0.783	S	S	*	*			trans	-68.2	0	177.3	30.1	-38.9	0	0	0	116.8

Retrieved 94 of 94 residues in 86.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).