A0A087WVU0_HUMAN Loading...

Ragulator complex protein LAMTOR4

As part of the Ragulator complex it is involved in amino acid sensing and activation of mTORC1, a signaling complex promoting cell growth in response to growth factors, energy levels, and amino acids. Activated by amino acids through a mechanism involving the lysosomal V-ATPase, the Ragulator plays a dual role for the small GTPases Rag (RagA/RRAGA, RagB/RRAGB, RagC/RRAGC and/or RagD/RRAGD): it (1) acts as a guanine nucleotide exchange factor (GEF), activating the small GTPases Rag and (2) mediates recruitment of Rag GTPases to the lysosome membrane. Activated Ragulator and Rag GTPases function as a scaffold recruiting mTORC1 to lysosomes where it is in turn activated.

AlphaFold DB , UniProt , Accession A0A087WVU0, Species HUMAN (Homo sapiens, Human), Gene LAMTOR4, Length 41 aa.

						>A0A087WVU0_HUMAN|A0A087WVU0|LAMTOR4
MNVPFKRLSVVFGEHTLLVTVSGQRVFVVKRQNRGREPIDV
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	59.1	Low	89.2	Confident	236 Å²	236	130.4 Å²	130.4	100%	1.163	67%	0.67	S	S	*	*				0	112.3	0	-148	178.5	-120.1	0	0	106.8	V3	M1-V3 PolarHBondContact O-N 3.15Å
2	N	84.4	Confident	89.8	Confident	159 Å²	159	127.5 Å²	127.5	85%	0.85	65%	0.649	S	S	*	*			trans	-75.9	109.7	-177.4	-172.8	14.9	0	0	0	108.5	P4	N2-P4 WeakPolarHBondContact O-CD 3.37Å
3	V	82.4	Confident	90	Very high	105 Å²	105	123.7 Å²	123.7	64%	0.636	66%	0.661	S	S	*	*			trans	-85.1	114.8	178.3	-175.5	0	0	0	0	107.7	M1 F5	M1-V3 PolarHBondContact O-N 3.15Å; V3-F5 VanDerWaalsContact O-N 3.15Å; V3-F5 PolarHBondContact O-N 3.28Å
4	P	87	Confident	90.3	Very high	98 Å²	98	126.5 Å²	126.5	64%	0.636	67%	0.668	S	S	*	*	S	Bend	trans	-69	-16.3	-169.1	23.5	-31.9	0	0	0	114	N2	N2-P4 WeakPolarHBondContact O-CD 3.37Å
5	F	91.8	Very high	90.6	Very high	150 Å²	150	120.9 Å²	120.9	66%	0.658	64%	0.637	S	S	*	*			trans	-134.8	133.7	-176.2	-47.6	-72.3	0	0	0	111.5	V3 R7	V3-F5 VanDerWaalsContact O-N 3.15Å; V3-F5 PolarHBondContact O-N 3.28Å; F5-R7 VanDerWaalsContact C-N 3.35Å
6	K	93.6	Very high	91	Very high	210 Å²	210	114.4 Å²	114.4	91%	0.913	60%	0.603	S	S	*	*	S	Bend	trans	-73.5	-28.2	170.5	-66	-176.8	-179.7	179.8	0	112.4
7	R	96.1	Very high	91.5	Very high	153 Å²	153	110.6 Å²	110.6	58%	0.577	58%	0.583	S	S	*	*			trans	-156	139.3	-177	-174.1	174.3	70.2	-157.4	-2.1	110.3	F5 V19 T20	F5-R7 VanDerWaalsContact C-N 3.35Å; R7-V19 WeakPolarHBondContact CA-O 3.3Å; R7-V19 WeakPolarHBondContact CG-O 3.4Å; R7-T20 HydrophobicContact CB-CG2 3.99Å; R7-T20 HydrophobicContact CG-CG2 3.8Å
8	L	96.9	Very high	91.8	Very high	95 Å²	95	106.3 Å²	106.3	50%	0.497	56%	0.561	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-103.2	146.1	170.3	179	152.6	0	0	0	109.4	V10 V19	L8-V10 HydrophobicContact CD2-CG2 3.75Å; L8-V19 PolarHBondContact O-N 3.25Å; L8-V19 PolarHBondContact N-O 3.05Å; L8-V19 HydrophobicContact CD2-CG2 4.07Å; L8-V19 HydrophobicContact CD2-CB 4.16Å; L8-V19 HydrophobicContact CB-CB 4.22Å
9	S	96.9	Very high	92.1	Very high	57 Å²	57	102.4 Å²	102.4	40%	0.399	54%	0.541	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-135.2	125.9	177.5	-59.7	0	0	0	0	110.6	L17 L18	S9-L17 CarbonylContact C-O 3.58Å; S9-L17 VanDerWaalsContact CA-O 3.3Å; S9-L17 WeakPolarHBondContact CA-O 3.33Å; S9-L18 VanDerWaalsContact OG-CD2 3.26Å; S9-L18 WeakPolarHBondContact OG-CD2 3.38Å
10	V	97.6	Very high	92.4	Very high	66 Å²	66	100 Å²	100	40%	0.4	53%	0.531	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.1	110.6	171.9	-174.5	0	0	0	0	107.4	L8 F12 T16 L17	L8-V10 HydrophobicContact CD2-CG2 3.75Å; V10-F12 HydrophobicContact CB-CE2 4.27Å; V10-F12 HydrophobicContact CG1-CD2 4.48Å; V10-F12 HydrophobicContact CG1-CE2 3.72Å; V10-F12 HydrophobicContact CG1-CZ 3.8Å; V10-T16 CarbonylContact O-C 3.57Å; V10-T16 WeakPolarHBondContact O-CG2 3.35Å; V10-T16 WeakPolarHBondContact O-CA 3.22Å; V10-L17 HydrophobicContact CB-CB 4.33Å; V10-L17 PolarHBondContact N-O 2.83Å; V10-L17 PolarHBondContact O-N 2.74Å
11	V	95.9	Very high	92.5	Very high	105 Å²	105	100 Å²	100	64%	0.636	53%	0.534	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-98.4	117.6	-172.8	-175.5	0	0	0	0	109.2	T16	V11-T16 HydrophobicContact CG2-CG2 4.02Å
12	F	95.4	Very high	94.2	Very high	96 Å²	96	92.7 Å²	92.7	42%	0.421	51%	0.506	S	S	.	.			trans	-99	176.6	168.3	-55.6	-93.9	0	0	0	109.5	V10 H15 L17 N33	V10-F12 HydrophobicContact CB-CE2 4.27Å; V10-F12 HydrophobicContact CG1-CD2 4.48Å; V10-F12 HydrophobicContact CG1-CE2 3.72Å; V10-F12 HydrophobicContact CG1-CZ 3.8Å; F12-H15 AromaticContact CD2-NE2 3.59Å; F12-H15 PolarHBondContact N-O 2.89Å; F12-H15 AromaticContact CE2-NE2 3.98Å; F12-H15 AromaticContact CD2-CD2 3.79Å; F12-H15 WeakPolarHBondContact CB-O 3.39Å; F12-H15 VanDerWaalsContact CB-O 3.22Å; F12-H15 WeakPolarHBondContact CA-O 3.26Å; F12-H15 CarbonylContact C-O 3.57Å; F12-L17 HydrophobicContact CE2-CD1 3.94Å; F12-L17 HydrophobicContact CE2-CG 3.97Å; F12-L17 HydrophobicContact CZ-CD1 4.43Å; F12-N33 PolarHBondContact O-ND2 2.86Å
13	G	93.3	Very high	94.6	Very high	78 Å²	78	88.6 Å²	88.6	80%	0.804	50%	0.502	S	S	*	.	S	Bend	trans	-59	-48.7	176.6	0	0	0	0	0	113	N33	G13-N33 PolarHBondContact O-ND2 2.91Å
14	E	94.1	Very high	95.2	Very high	163 Å²	163	93.1 Å²	93.1	76%	0.762	52%	0.516	S	S	*	.	S	Bend	trans	-98.2	-23	-172.4	-60.4	-179.2	164.9	0	0	114.4	N33	E14-N33 PolarHBondContact O-N 2.88Å
15	H	95.1	Very high	95.6	Very high	42 Å²	42	97.2 Å²	97.2	19%	0.194	52%	0.519	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-150	164.8	-174.1	68.3	-87.1	0	0	0	112	F12 K30 R31 N33	F12-H15 AromaticContact CD2-NE2 3.59Å; F12-H15 PolarHBondContact N-O 2.89Å; F12-H15 AromaticContact CE2-NE2 3.98Å; F12-H15 AromaticContact CD2-CD2 3.79Å; F12-H15 WeakPolarHBondContact CB-O 3.39Å; F12-H15 VanDerWaalsContact CB-O 3.22Å; F12-H15 WeakPolarHBondContact CA-O 3.26Å; F12-H15 CarbonylContact C-O 3.57Å; H15-K30 WeakPolarHBondContact CD2-CE 3.49Å; H15-K30 WeakPolarHBondContact NE2-CE 3.38Å; H15-R31 CarbonylContact C-O 3.47Å; H15-R31 WeakPolarHBondContact CB-O 3.2Å; H15-R31 WeakPolarHBondContact CA-O 3.35Å; H15-R31 VanDerWaalsContact CB-O 3.26Å; H15-N33 WeakPolarHBondContact CA-OD1 3.26Å; H15-N33 PolarHBondContact N-ND2 2.82Å
16	T	97.3	Very high	95.9	Very high	17 Å²	17	94.6 Å²	94.6	10%	0.104	52%	0.515	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.2	137.7	177.7	-63.4	0	0	0	0	109.2	V10 V11 L18 R31 N33	V10-T16 CarbonylContact O-C 3.57Å; V10-T16 WeakPolarHBondContact O-CG2 3.35Å; V10-T16 WeakPolarHBondContact O-CA 3.22Å; V11-T16 HydrophobicContact CG2-CG2 4.02Å; T16-L18 HydrophobicContact CG2-CD2 3.71Å; T16-L18 HydrophobicContact CG2-CG 4.37Å; T16-R31 PolarHBondContact N-O 3.02Å; T16-R31 PolarHBondContact O-N 2.76Å; T16-N33 PolarHBondContact N-OD1 3.03Å; T16-N33 PolarHBondContact OG1-OD1 2.87Å
17	L	98	Very high	96.1	Very high	50 Å²	50	89.4 Å²	89.4	26%	0.262	49%	0.492	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-93.1	121.3	165.8	-61.3	177.1	0	0	0	109	S9 V10 F12 V28 V29 K30	S9-L17 CarbonylContact C-O 3.58Å; S9-L17 VanDerWaalsContact CA-O 3.3Å; S9-L17 WeakPolarHBondContact CA-O 3.33Å; V10-L17 HydrophobicContact CB-CB 4.33Å; V10-L17 PolarHBondContact N-O 2.83Å; V10-L17 PolarHBondContact O-N 2.74Å; F12-L17 HydrophobicContact CE2-CD1 3.94Å; F12-L17 HydrophobicContact CE2-CG 3.97Å; F12-L17 HydrophobicContact CZ-CD1 4.43Å; L17-V28 HydrophobicContact CD2-CG1 4.39Å; L17-V29 CarbonylContact C-O 3.6Å; L17-V29 WeakPolarHBondContact CA-O 3.49Å; L17-K30 HydrophobicContact CD2-CB 3.82Å; L17-K30 HydrophobicContact CD2-CG 3.98Å
18	L	97.2	Very high	96.2	Very high	34 Å²	34	86.3 Å²	86.3	18%	0.178	49%	0.49	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.6	125	175.8	-56	176.3	0	0	0	108.7	S9 T16 V28 V29	S9-L18 VanDerWaalsContact OG-CD2 3.26Å; S9-L18 WeakPolarHBondContact OG-CD2 3.38Å; T16-L18 HydrophobicContact CG2-CD2 3.71Å; T16-L18 HydrophobicContact CG2-CG 4.37Å; L18-V28 WeakPolarHBondContact O-CA 3.33Å; L18-V29 HydrophobicContact CB-CB 4.36Å; L18-V29 PolarHBondContact N-O 3.25Å; L18-V29 PolarHBondContact O-N 2.79Å
19	V	97.9	Very high	96.2	Very high	31 Å²	31	85.9 Å²	85.9	19%	0.188	49%	0.491	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.1	130.7	-174.6	-175.6	0	0	0	0	110.5	R7 L8 V26 F27 V28	R7-V19 WeakPolarHBondContact CA-O 3.3Å; R7-V19 WeakPolarHBondContact CG-O 3.4Å; L8-V19 PolarHBondContact O-N 3.25Å; L8-V19 PolarHBondContact N-O 3.05Å; L8-V19 HydrophobicContact CD2-CG2 4.07Å; L8-V19 HydrophobicContact CD2-CB 4.16Å; L8-V19 HydrophobicContact CB-CB 4.22Å; V19-V26 HydrophobicContact CG1-CG1 3.78Å; V19-F27 WeakPolarHBondContact CA-O 3.4Å; V19-V28 HydrophobicContact CG2-CG1 4.4Å; V19-V28 HydrophobicContact CG2-CG2 4.34Å
20	T	97.4	Very high	96.3	Very high	54 Å²	54	90.3 Å²	90.3	33%	0.331	50%	0.504	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-132.5	159.4	170.9	58.3	0	0	0	0	110.9	R7 F27	R7-T20 HydrophobicContact CB-CG2 3.99Å; R7-T20 HydrophobicContact CG-CG2 3.8Å; T20-F27 PolarHBondContact N-O 2.85Å; T20-F27 PolarHBondContact O-N 2.89Å
21	V	95.8	Very high	96.2	Very high	101 Å²	101	92.3 Å²	92.3	61%	0.612	50%	0.504	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-123.6	132.6	175.4	-178.5	0	0	0	0	108.6	R25 V26	V21-R25 WeakPolarHBondContact CA-O 3.43Å; V21-V26 HydrophobicContact CG2-CG2 4.36Å
22	S	94.1	Very high	96.1	Very high	82 Å²	82	93.3 Å²	93.3	57%	0.573	50%	0.502	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-137.1	122.5	170.4	-176.6	0	0	0	0	109.4	Q24 R25	S22-Q24 PolarHBondContact O-N 2.88Å; S22-R25 PolarHBondContact N-O 2.83Å; S22-R25 PolarHBondContact O-N 2.89Å
23	G	91.9	Very high	95.9	Very high	73 Å²	73	91.9 Å²	91.9	75%	0.753	50%	0.499	S	S	*	.	T	Hydrogen-bonded Turn	trans	58	-121.3	-168	0	0	0	0	0	110.9
24	Q	95.3	Very high	95.4	Very high	201 Å²	201	97 Å²	97	94%	0.939	49%	0.494	S	S	*	.	T	Hydrogen-bonded Turn	trans	-104.1	14.4	177.5	-61.2	178.8	31	0	0	112.9	S22	S22-Q24 PolarHBondContact O-N 2.88Å
25	R	96.5	Very high	94.2	Very high	184 Å²	184	92.8 Å²	92.8	69%	0.694	49%	0.493	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-109.3	138.4	-177	-65.2	-178.1	-178.8	172.3	0.6	111	V21 S22 F27	V21-R25 WeakPolarHBondContact CA-O 3.43Å; S22-R25 PolarHBondContact N-O 2.83Å; S22-R25 PolarHBondContact O-N 2.89Å; R25-F27 HydrophobicContact CB-CE2 3.72Å; R25-F27 HydrophobicContact CB-CZ 3.99Å
26	V	97.3	Very high	93.1	Very high	95 Å²	95	101 Å²	101	58%	0.576	52%	0.523	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-102.6	130.2	172.7	-174.6	0	0	0	0	108.5	V19 V21 V28	V19-V26 HydrophobicContact CG1-CG1 3.78Å; V21-V26 HydrophobicContact CG2-CG2 4.36Å; V26-V28 HydrophobicContact CG1-CG2 4.15Å
27	F	98.2	Very high	92.3	Very high	100 Å²	100	107.7 Å²	107.7	44%	0.439	55%	0.553	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-112.2	131.1	176.9	-59.9	-96.5	0	0	0	108.5	V19 T20 R25	V19-F27 WeakPolarHBondContact CA-O 3.4Å; T20-F27 PolarHBondContact N-O 2.85Å; T20-F27 PolarHBondContact O-N 2.89Å; R25-F27 HydrophobicContact CB-CE2 3.72Å; R25-F27 HydrophobicContact CB-CZ 3.99Å
28	V	98.1	Very high	91.7	Very high	88 Å²	88	111 Å²	111	53%	0.533	58%	0.578	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-127.6	126.8	-178.7	-173.9	0	0	0	0	109	L17 L18 V19 V26	L17-V28 HydrophobicContact CD2-CG1 4.39Å; L18-V28 WeakPolarHBondContact O-CA 3.33Å; V19-V28 HydrophobicContact CG2-CG1 4.4Å; V19-V28 HydrophobicContact CG2-CG2 4.34Å; V26-V28 HydrophobicContact CG1-CG2 4.15Å
29	V	97.9	Very high	90.9	Very high	86 Å²	86	116.5 Å²	116.5	52%	0.521	61%	0.605	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-120.9	126.1	175.9	179.2	0	0	0	0	109.3	L17 L18	L17-V29 CarbonylContact C-O 3.6Å; L17-V29 WeakPolarHBondContact CA-O 3.49Å; L18-V29 HydrophobicContact CB-CB 4.36Å; L18-V29 PolarHBondContact N-O 3.25Å; L18-V29 PolarHBondContact O-N 2.79Å
30	K	97.3	Very high	90.1	Very high	151 Å²	151	123 Å²	123	66%	0.657	64%	0.639	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-89.5	121.6	169.2	-173.3	177.6	-177.6	179.3	0	109.3	H15 L17	H15-K30 WeakPolarHBondContact CD2-CE 3.49Å; H15-K30 WeakPolarHBondContact NE2-CE 3.38Å; L17-K30 HydrophobicContact CD2-CB 3.82Å; L17-K30 HydrophobicContact CD2-CG 3.98Å
31	R	95.5	Very high	89.2	Confident	108 Å²	108	130 Å²	130	41%	0.408	68%	0.681	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-121.9	131.8	179.9	-171	-171.4	175	-151.6	-5.9	109.8	H15 T16	H15-R31 CarbonylContact C-O 3.47Å; H15-R31 WeakPolarHBondContact CB-O 3.2Å; H15-R31 WeakPolarHBondContact CA-O 3.35Å; H15-R31 VanDerWaalsContact CB-O 3.26Å; T16-R31 PolarHBondContact N-O 3.02Å; T16-R31 PolarHBondContact O-N 2.76Å
32	Q	95.6	Very high	88.8	Confident	125 Å²	125	131.4 Å²	131.4	58%	0.584	68%	0.684	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-64.4	143	168.1	-73.5	-169.6	-17.4	0	0	110.7	R34	Q32-R34 HydrophobicContact CB-CG 4.36Å; Q32-R34 PolarHBondContact O-N 3.31Å
33	N	89.9	Confident	88.5	Confident	67 Å²	67	134 Å²	134	36%	0.358	69%	0.69	S	S	.	*			trans	-75	71	175.9	-67.6	-11	0	0	0	109.9	F12 G13 E14 H15 T16	F12-N33 PolarHBondContact O-ND2 2.86Å; G13-N33 PolarHBondContact O-ND2 2.91Å; E14-N33 PolarHBondContact O-N 2.88Å; H15-N33 WeakPolarHBondContact CA-OD1 3.26Å; H15-N33 PolarHBondContact N-ND2 2.82Å; T16-N33 PolarHBondContact N-OD1 3.03Å; T16-N33 PolarHBondContact OG1-OD1 2.87Å
34	R	82.2	Confident	88.4	Confident	186 Å²	186	137.4 Å²	137.4	70%	0.702	69%	0.687	S	S	*	*			trans	-84.7	128.8	167.8	-64.2	-173	-177.5	-175.6	-1	108.5	Q32 R36	Q32-R34 HydrophobicContact CB-CG 4.36Å; Q32-R34 PolarHBondContact O-N 3.31Å; R34-R36 PolarHBondContact O-N 3.18Å
35	G	70.6	Confident	88	Confident	73 Å²	73	133.6 Å²	133.6	75%	0.753	67%	0.672	S	S	*	*			trans	-49.4	132.9	169.4	0	0	0	0	0	109.4	E37	G35-E37 VanDerWaalsContact C-N 3.35Å; G35-E37 PolarHBondContact O-N 3.39Å
36	R	70.8	Confident	87.4	Confident	215 Å²	215	130.5 Å²	130.5	81%	0.811	67%	0.671	S	S	*	*			trans	-90.8	78.2	-175.2	-152.9	-179.8	-162.4	-176.5	-0.7	108.2	R34	R34-R36 PolarHBondContact O-N 3.18Å
37	E	80.7	Confident	86.8	Confident	157 Å²	157	132.9 Å²	132.9	73%	0.734	68%	0.677	S	S	*	*	P	Polyproline II helix	trans	-69.8	144.8	163.3	-69.4	-67.3	145.9	0	0	108.5	G35 I39	G35-E37 VanDerWaalsContact C-N 3.35Å; G35-E37 PolarHBondContact O-N 3.39Å; E37-I39 PolarHBondContact O-N 3.28Å
38	P	85	Confident	85.9	Confident	121 Å²	121	135.2 Å²	135.2	79%	0.786	69%	0.694	S	S	*	*	P	Polyproline II helix	trans	-51.5	129.4	163.8	-22	33.3	0	0	0	109
39	I	81.1	Confident	85	Confident	148 Å²	148	138.8 Å²	138.8	76%	0.759	71%	0.706	S	S	*	*	P	Polyproline II helix	trans	-93	126.8	169.6	-57.4	170.8	0	0	0	105	E37 V41	E37-I39 PolarHBondContact O-N 3.28Å; I39-V41 WeakPolarHBondContact O-CG2 3.38Å; I39-V41 PolarHBondContact O-N 3.41Å
40	D	82.1	Confident	83.9	Confident	168 Å²	168	143.3 Å²	143.3	90%	0.898	72%	0.722	S	S	*	*	P	Polyproline II helix	trans	-69.1	122.9	170.3	-142	4.7	0	0	0	107.6
41	V	76.7	Confident	82.7	Confident	200 Å²	200	142.5 Å²	142.5	100%	1.212	73%	0.728	S	S	*	*			trans	-103.8	0	-168.9	-143.4	0	0	0	0	111.1	I39	I39-V41 WeakPolarHBondContact O-CG2 3.38Å; I39-V41 PolarHBondContact O-N 3.41Å

Retrieved 41 of 41 residues in 38.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).