A0A087WW17_HUMAN Loading...

Interleukin 17D

AlphaFold DB , UniProt , Accession A0A087WW17, Species HUMAN (Homo sapiens, Human), Gene IL17D, Length 35 aa.

						>A0A087WW17_HUMAN|A0A087WW17|IL17D
MLGALVWMLVAGFLLALPPSWAAGAPRAGRRPARP
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	77.8	Confident	91.7	Very high	214 Å²	214	112.5 Å²	112.5	100%	1.054	62%	0.616	S	S	*	*				0	-49	0	-79.6	170.1	156.1	0	0	112.7	G3 A4 L5	M1-G3 PolarHBondContact O-N 3.08Å; M1-G3 VanDerWaalsContact C-N 3.27Å; M1-A4 PolarHBondContact O-N 2.96Å; M1-L5 PolarHBondContact O-N 3.35Å
2	L	90.8	Very high	91.7	Very high	137 Å²	137	106.4 Å²	106.4	72%	0.717	60%	0.599	S	S	*	*	H	α-helix	trans	-51.8	-42.3	179.4	-174.9	62.4	0	0	0	113.6	A4 L5 V6	L2-A4 VanDerWaalsContact C-N 3.32Å; L2-A4 PolarHBondContact O-N 3.18Å; L2-L5 WeakPolarHBondContact O-CB 3.29Å; L2-L5 PolarHBondContact O-N 3.34Å; L2-V6 WeakPolarHBondContact O-CG2 3.47Å; L2-V6 PolarHBondContact O-N 2.65Å
3	G	91.1	Very high	91.6	Very high	43 Å²	43	108.8 Å²	108.8	44%	0.443	60%	0.599	S	S	.	*	H	α-helix	trans	-58.4	-39.2	177.8	0	0	0	0	0	114.1	M1 V6 W7	M1-G3 PolarHBondContact O-N 3.08Å; M1-G3 VanDerWaalsContact C-N 3.27Å; G3-V6 PolarHBondContact O-N 2.78Å; G3-W7 PolarHBondContact O-N 3.24Å
4	A	91.4	Very high	91.2	Very high	69 Å²	69	109.1 Å²	109.1	57%	0.57	60%	0.599	S	S	*	*	H	α-helix	trans	-68.6	-38	178	0	0	0	0	0	111.9	M1 L2 W7 M8	M1-A4 PolarHBondContact O-N 2.96Å; L2-A4 VanDerWaalsContact C-N 3.32Å; L2-A4 PolarHBondContact O-N 3.18Å; A4-W7 PolarHBondContact O-N 2.73Å; A4-M8 WeakPolarHBondContact O-CB 3.47Å; A4-M8 PolarHBondContact O-N 3.03Å
5	L	94.6	Very high	90.7	Very high	110 Å²	110	111.9 Å²	111.9	58%	0.576	61%	0.611	S	S	*	*	H	α-helix	trans	-62	-44.5	173.8	-113.2	76.4	0	0	0	111.3	M1 L2 W7 M8 L9	M1-L5 PolarHBondContact O-N 3.35Å; L2-L5 WeakPolarHBondContact O-CB 3.29Å; L2-L5 PolarHBondContact O-N 3.34Å; L5-W7 PolarHBondContact O-N 2.94Å; L5-M8 PolarHBondContact O-N 3.4Å; L5-L9 PolarHBondContact O-N 2.92Å
6	V	95.1	Very high	90.3	Very high	77 Å²	77	109.8 Å²	109.8	47%	0.467	61%	0.613	S	S	.	*	H	α-helix	trans	-60.4	-46.5	177	172.9	0	0	0	0	110.6	L2 G3 M8 L9 V10	L2-V6 WeakPolarHBondContact O-CG2 3.47Å; L2-V6 PolarHBondContact O-N 2.65Å; G3-V6 PolarHBondContact O-N 2.78Å; V6-M8 VanDerWaalsContact C-N 3.32Å; V6-M8 PolarHBondContact O-N 3.27Å; V6-L9 PolarHBondContact O-N 2.82Å; V6-V10 WeakPolarHBondContact O-CG2 3.07Å; V6-V10 PolarHBondContact O-N 3.16Å
7	W	94.6	Very high	89.8	Confident	194 Å²	194	108.4 Å²	108.4	74%	0.735	60%	0.604	S	S	*	*	H	α-helix	trans	-61.1	-39.1	177.2	-83.7	113.2	0	0	0	113.1	G3 A4 L5 V10 A11	G3-W7 PolarHBondContact O-N 3.24Å; A4-W7 PolarHBondContact O-N 2.73Å; L5-W7 PolarHBondContact O-N 2.94Å; W7-V10 PolarHBondContact O-N 2.89Å; W7-A11 WeakPolarHBondContact O-CB 3.28Å; W7-A11 PolarHBondContact O-N 3.34Å
8	M	95.1	Very high	88.6	Confident	151 Å²	151	107.2 Å²	107.2	74%	0.744	60%	0.602	S	S	*	*	H	α-helix	trans	-66.5	-40.4	178	-173.8	168.5	145.4	0	0	112.3	A4 L5 V6 G12	A4-M8 WeakPolarHBondContact O-CB 3.47Å; A4-M8 PolarHBondContact O-N 3.03Å; L5-M8 PolarHBondContact O-N 3.4Å; V6-M8 VanDerWaalsContact C-N 3.32Å; V6-M8 PolarHBondContact O-N 3.27Å; M8-G12 PolarHBondContact O-N 3.15Å
9	L	94.6	Very high	87.4	Confident	131 Å²	131	107.2 Å²	107.2	69%	0.686	61%	0.606	S	S	*	*	H	α-helix	trans	-62.8	-45.4	173.1	-91.2	140.1	0	0	0	112	L5 V6 G12 F13	L5-L9 PolarHBondContact O-N 2.92Å; V6-L9 PolarHBondContact O-N 2.82Å; L9-G12 PolarHBondContact O-N 3.41Å; L9-F13 WeakPolarHBondContact O-CB 3.35Å; L9-F13 PolarHBondContact O-N 3.4Å
10	V	92.9	Very high	85.9	Confident	63 Å²	63	106.2 Å²	106.2	38%	0.382	61%	0.607	S	S	.	*	H	α-helix	trans	-62.5	-45	177.6	172.5	0	0	0	0	111.1	V6 W7 F13 L14	V6-V10 WeakPolarHBondContact O-CG2 3.07Å; V6-V10 PolarHBondContact O-N 3.16Å; W7-V10 PolarHBondContact O-N 2.89Å; V10-F13 PolarHBondContact O-N 3.02Å; V10-L14 HydrophobicContact CG1-CG 4.36Å; V10-L14 PolarHBondContact O-N 2.91Å; V10-L14 WeakPolarHBondContact O-CG 3.31Å; V10-L14 VanDerWaalsContact O-CG 3.31Å; V10-L14 WeakPolarHBondContact O-CB 3.32Å; V10-L14 HydrophobicContact CG1-CD1 3.94Å
11	A	91	Very high	84.5	Confident	48 Å²	48	112.6 Å²	112.6	40%	0.397	62%	0.621	S	S	.	*	H	α-helix	trans	-63.1	-44.8	178.3	0	0	0	0	0	112	W7 F13 L14 L15	W7-A11 WeakPolarHBondContact O-CB 3.28Å; W7-A11 PolarHBondContact O-N 3.34Å; A11-F13 VanDerWaalsContact C-N 3.34Å; A11-F13 PolarHBondContact O-N 3.31Å; A11-L14 PolarHBondContact O-N 3.48Å; A11-L15 PolarHBondContact O-N 2.94Å; A11-L15 WeakPolarHBondContact O-CG 3.31Å; A11-L15 WeakPolarHBondContact O-CB 3.48Å; A11-L15 VanDerWaalsContact O-CG 3.31Å
12	G	91.8	Very high	83.5	Confident	40 Å²	40	105.8 Å²	105.8	41%	0.412	60%	0.599	S	S	.	*	H	α-helix	trans	-61.8	-40.9	175.1	0	0	0	0	0	112.5	M8 L9 L15 A16	M8-G12 PolarHBondContact O-N 3.15Å; L9-G12 PolarHBondContact O-N 3.41Å; G12-L15 PolarHBondContact O-N 3.41Å; G12-A16 VanDerWaalsContact O-CB 3.31Å; G12-A16 WeakPolarHBondContact O-CB 3.47Å; G12-A16 PolarHBondContact O-N 3.43Å
13	F	89.5	Confident	81.8	Confident	137 Å²	137	103 Å²	103	60%	0.601	60%	0.595	S	S	*	*	H	α-helix	trans	-63.9	-47.8	176.1	-175.3	-105.5	0	0	0	112	L9 V10 A11 L15 A16 L17	L9-F13 WeakPolarHBondContact O-CB 3.35Å; L9-F13 PolarHBondContact O-N 3.4Å; V10-F13 PolarHBondContact O-N 3.02Å; A11-F13 VanDerWaalsContact C-N 3.34Å; A11-F13 PolarHBondContact O-N 3.31Å; F13-L15 VanDerWaalsContact C-N 3.27Å; F13-L15 PolarHBondContact O-N 3.31Å; F13-A16 PolarHBondContact O-N 3.05Å; F13-A16 VanDerWaalsContact O-N 3.15Å; F13-L17 HydrophobicContact CE1-CD1 3.4Å; F13-L17 PolarHBondContact O-N 3Å; F13-L17 WeakPolarHBondContact O-CD1 3.31Å; F13-L17 HydrophobicContact CZ-CD1 3.51Å; F13-L17 HydrophobicContact CG-CD1 3.97Å; F13-L17 HydrophobicContact CE2-CD1 3.83Å; F13-L17 VanDerWaalsContact CE1-CD1 3.4Å; F13-L17 HydrophobicContact CD2-CD1 4.05Å; F13-L17 HydrophobicContact CD1-CD1 3.64Å
14	L	86.9	Confident	80.1	Confident	114 Å²	114	103.9 Å²	103.9	60%	0.597	61%	0.605	S	S	*	*	H	α-helix	trans	-60.7	-35.7	177.1	-72.4	172.7	0	0	0	112.8	V10 A11	V10-L14 HydrophobicContact CG1-CG 4.36Å; V10-L14 PolarHBondContact O-N 2.91Å; V10-L14 WeakPolarHBondContact O-CG 3.31Å; V10-L14 VanDerWaalsContact O-CG 3.31Å; V10-L14 WeakPolarHBondContact O-CB 3.32Å; V10-L14 HydrophobicContact CG1-CD1 3.94Å; A11-L14 PolarHBondContact O-N 3.48Å
15	L	83.1	Confident	78.5	Confident	150 Å²	150	103.9 Å²	103.9	79%	0.785	61%	0.605	S	S	*	*	H	α-helix	trans	-74.8	-32.6	175.6	-72	171.2	0	0	0	113	A11 G12 F13 L17	A11-L15 PolarHBondContact O-N 2.94Å; A11-L15 WeakPolarHBondContact O-CG 3.31Å; A11-L15 WeakPolarHBondContact O-CB 3.48Å; A11-L15 VanDerWaalsContact O-CG 3.31Å; G12-L15 PolarHBondContact O-N 3.41Å; F13-L15 VanDerWaalsContact C-N 3.27Å; F13-L15 PolarHBondContact O-N 3.31Å; L15-L17 VanDerWaalsContact C-N 3.33Å
16	A	84.8	Confident	76.6	Confident	78 Å²	78	103.9 Å²	103.9	65%	0.645	61%	0.611	S	S	*	*	H	α-helix	trans	-75.4	-23.3	175.7	0	0	0	0	0	112.4	G12 F13 P18	G12-A16 VanDerWaalsContact O-CB 3.31Å; G12-A16 WeakPolarHBondContact O-CB 3.47Å; G12-A16 PolarHBondContact O-N 3.43Å; F13-A16 PolarHBondContact O-N 3.05Å; F13-A16 VanDerWaalsContact O-N 3.15Å; A16-P18 VanDerWaalsContact O-CD 3.28Å; A16-P18 WeakPolarHBondContact O-CD 3.38Å
17	L	80.9	Confident	74.9	Confident	86 Å²	86	109.9 Å²	109.9	45%	0.45	63%	0.626	S	S	.	*	S	Bend	trans	-64.7	118	169.9	-96.7	75.8	0	0	0	108.6	F13 L15	F13-L17 HydrophobicContact CE1-CD1 3.4Å; F13-L17 PolarHBondContact O-N 3Å; F13-L17 WeakPolarHBondContact O-CD1 3.31Å; F13-L17 HydrophobicContact CZ-CD1 3.51Å; F13-L17 HydrophobicContact CG-CD1 3.97Å; F13-L17 HydrophobicContact CE2-CD1 3.83Å; F13-L17 VanDerWaalsContact CE1-CD1 3.4Å; F13-L17 HydrophobicContact CD2-CD1 4.05Å; F13-L17 HydrophobicContact CD1-CD1 3.64Å; L15-L17 VanDerWaalsContact C-N 3.33Å
18	P	68.9	Low	72.9	Confident	88 Å²	88	105.4 Å²	105.4	57%	0.571	63%	0.631	S	S	*	*			trans	-58	150.9	175.4	22	-30.6	0	0	0	109.7	A16 S20	A16-P18 VanDerWaalsContact O-CD 3.28Å; A16-P18 WeakPolarHBondContact O-CD 3.38Å; P18-S20 PolarHBondContact O-N 3.02Å; P18-S20 PolarHBondContact O-OG 3.41Å
19	P	64.9	Low	71.2	Confident	106 Å²	106	101.6 Å²	101.6	69%	0.688	63%	0.629	S	S	*	*	G	3₁₀ helix	trans	-69.2	24.8	179.9	30.9	-37	0	0	0	113	W21 A22 A23	P19-W21 PolarHBondContact O-N 3.01Å; P19-A22 HydrophobicContact CB-CB 4.38Å; P19-A22 WeakPolarHBondContact O-CA 3.45Å; P19-A22 WeakPolarHBondContact O-CB 3.45Å; P19-A22 PolarHBondContact O-N 3.37Å; P19-A23 PolarHBondContact O-N 3.21Å
20	S	58.5	Low	69.6	Low	88 Å²	88	105 Å²	105	62%	0.615	63%	0.633	S	S	*	*	G	3₁₀ helix	trans	-54.7	-21.9	175.7	45.8	0	0	0	0	112.6	P18	P18-S20 PolarHBondContact O-N 3.02Å; P18-S20 PolarHBondContact O-OG 3.41Å
21	W	57	Low	68	Low	240 Å²	240	113.5 Å²	113.5	91%	0.909	66%	0.658	S	S	*	*	G	3₁₀ helix	trans	-76.8	-30.1	171.5	-133.4	89.3	0	0	0	113.8	P19 A23 G24	P19-W21 PolarHBondContact O-N 3.01Å; W21-A23 VanDerWaalsContact C-N 3.35Å; W21-G24 PolarHBondContact O-N 3.33Å
22	A	56	Low	66.5	Low	72 Å²	72	116.5 Å²	116.5	60%	0.595	67%	0.674	S	S	*	*	G	3₁₀ helix	trans	-79.2	-17.7	175.4	0	0	0	0	0	112.9	P19 G24 A25	P19-A22 HydrophobicContact CB-CB 4.38Å; P19-A22 WeakPolarHBondContact O-CA 3.45Å; P19-A22 WeakPolarHBondContact O-CB 3.45Å; P19-A22 PolarHBondContact O-N 3.37Å; A22-G24 PolarHBondContact O-N 3Å; A22-A25 PolarHBondContact O-N 3.18Å
23	A	56.1	Low	64.9	Low	77 Å²	77	119.9 Å²	119.9	64%	0.636	70%	0.698	S	S	*	*	G	3₁₀ helix	trans	-74.2	-4.1	170.5	0	0	0	0	0	113.6	P19 W21	P19-A23 PolarHBondContact O-N 3.21Å; W21-A23 VanDerWaalsContact C-N 3.35Å
24	G	54.7	Low	63.3	Low	63 Å²	63	124.3 Å²	124.3	65%	0.649	71%	0.711	S	S	*	*	G	3₁₀ helix	trans	-83.1	-6	169.8	0	0	0	0	0	114.2	W21 A22 P26	W21-G24 PolarHBondContact O-N 3.33Å; A22-G24 PolarHBondContact O-N 3Å; G24-P26 VanDerWaalsContact O-CD 3.29Å; G24-P26 WeakPolarHBondContact O-CD 3.41Å
25	A	56.7	Low	62.2	Low	68 Å²	68	128.4 Å²	128.4	56%	0.562	74%	0.744	S	S	*	*	S	Bend	trans	-73.6	111.9	159.1	0	0	0	0	0	106.2	A22 R27	A22-A25 PolarHBondContact O-N 3.18Å; A25-R27 PolarHBondContact O-N 3.5Å; A25-R27 VanDerWaalsContact O-N 3.08Å
26	P	55	Low	61.1	Low	110 Å²	110	127.3 Å²	127.3	71%	0.714	74%	0.742	S	S	*	*			trans	-53.8	130.1	172.8	-7.1	18.8	0	0	0	105.4	G24 A28	G24-P26 VanDerWaalsContact O-CD 3.29Å; G24-P26 WeakPolarHBondContact O-CD 3.41Å; P26-A28 HydrophobicContact CB-CB 4.32Å; P26-A28 PolarHBondContact O-N 3.38Å
27	R	59	Low	59.9	Low	203 Å²	203	129.9 Å²	129.9	77%	0.766	75%	0.747	S	S	*	*			trans	-62.2	64.9	157.8	-72.5	-177.9	170.8	104	-3.9	107.7	A25 G29 R30	A25-R27 PolarHBondContact O-N 3.5Å; A25-R27 VanDerWaalsContact O-N 3.08Å; R27-G29 PolarHBondContact O-N 3.35Å; R27-R30 PolarHBondContact O-N 3.27Å
28	A	54.3	Low	58.7	Low	101 Å²	101	132.3 Å²	132.3	84%	0.835	76%	0.764	S	S	*	*	T	Hydrogen-bonded Turn	trans	-69.9	44.9	170.7	0	0	0	0	0	109.4	P26	P26-A28 HydrophobicContact CB-CB 4.32Å; P26-A28 PolarHBondContact O-N 3.38Å
29	G	58.4	Low	58.1	Low	70 Å²	70	134.9 Å²	134.9	72%	0.722	78%	0.775	S	S	*	*	T	Hydrogen-bonded Turn	trans	-161.1	8.1	-174.2	0	0	0	0	0	112.7	R27	R27-G29 PolarHBondContact O-N 3.35Å
30	R	60.3	Low	57.7	Low	203 Å²	203	136.8 Å²	136.8	77%	0.766	78%	0.78	S	S	*	*			trans	-142.2	53.7	172.7	-70.6	-156.4	-160.2	169	4.3	114.1	R27	R27-R30 PolarHBondContact O-N 3.27Å
31	R	60.3	Low	57.6	Low	241 Å²	241	140 Å²	140	91%	0.909	79%	0.791	S	S	*	*			trans	-111.7	105	144.5	-120.4	-178.5	-177.2	176.4	1.2	106.7	A33	R31-A33 PolarHBondContact O-N 2.99Å
32	P	59.8	Low	57.7	Low	112 Å²	112	132.9 Å²	132.9	73%	0.727	78%	0.783	S	S	*	*			trans	-58.1	122.9	163.5	1.1	11.5	0	0	0	105.8	R34	P32-R34 PolarHBondContact O-N 3.05Å
33	A	57.9	Low	57.8	Low	111 Å²	111	137.5 Å²	137.5	92%	0.917	80%	0.797	S	S	*	*			trans	-57.7	107.1	166.5	0	0	0	0	0	107.5	R31	R31-A33 PolarHBondContact O-N 2.99Å
34	R	56.4	Low	58	Low	230 Å²	230	142.6 Å²	142.6	87%	0.868	81%	0.811	S	S	*	*			trans	-136.2	115	164.3	-155.6	176.4	-167.1	160.8	5.4	103.1	P32	P32-R34 PolarHBondContact O-N 3.05Å
35	P	62.9	Low	58.3	Low	199 Å²	199	149.8 Å²	149.8	100%	1.292	83%	0.825	S	S	*	*				-111.7	0	62.3	3.3	18.6	0	0	0	114.6

Retrieved 35 of 35 residues in 39.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).