A0A087WWA2_HUMAN Loading...

N-acetylglucosamine-1-phosphate transferase subunit gamma

AlphaFold DB , UniProt , Accession A0A087WWA2, Species HUMAN (Homo sapiens, Human), Gene GNPTG, Length 61 aa.

						>A0A087WWA2_HUMAN|A0A087WWA2|GNPTG
MAAGLARLLLLLGLSAGGPAPAGAAKMKVVEEPNAFGVNNPFLPQASRLQAKRDPSPVSGE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	67.2	Low	84.2	Confident	222 Å²	222	110.7 Å²	110.7	100%	1.094	63%	0.629	S	S	*	*				0	-58.9	0	-128.5	79.8	176.8	0	0	112.8	A3 G4 L5	M1-A3 PolarHBondContact O-N 3.11Å; M1-G4 PolarHBondContact O-N 2.88Å; M1-L5 PolarHBondContact O-N 2.94Å
2	A	74.1	Confident	84.1	Confident	81 Å²	81	111 Å²	111	67%	0.669	63%	0.627	S	S	*	*	H	α-helix	trans	-61.8	-41.1	-169.5	0	0	0	0	0	115.7	G4 L5 A6	A2-G4 VanDerWaalsContact C-N 3.32Å; A2-G4 PolarHBondContact O-N 3.26Å; A2-L5 PolarHBondContact O-N 3.34Å; A2-A6 PolarHBondContact O-N 3.38Å
3	A	80.4	Confident	84.1	Confident	70 Å²	70	106.4 Å²	106.4	58%	0.579	62%	0.619	S	S	*	*	H	α-helix	trans	-66.4	-31.6	-179.3	0	0	0	0	0	113.5	M1 R7	M1-A3 PolarHBondContact O-N 3.11Å; A3-R7 WeakPolarHBondContact O-CG 3.46Å; A3-R7 PolarHBondContact O-N 3.29Å; A3-R7 VanDerWaalsContact O-N 3.16Å
4	G	88.1	Confident	83.6	Confident	48 Å²	48	107.8 Å²	107.8	50%	0.495	62%	0.622	S	S	.	*	H	α-helix	trans	-70.4	-39.2	175.6	0	0	0	0	0	111.8	M1 A2 R7 L8	M1-G4 PolarHBondContact O-N 2.88Å; A2-G4 VanDerWaalsContact C-N 3.32Å; A2-G4 PolarHBondContact O-N 3.26Å; G4-R7 PolarHBondContact O-N 2.95Å; G4-L8 WeakPolarHBondContact O-CB 3.46Å; G4-L8 PolarHBondContact O-N 3.35Å
5	L	89.4	Confident	83	Confident	100 Å²	100	106.3 Å²	106.3	52%	0.524	62%	0.62	S	S	.	*	H	α-helix	trans	-67.9	-42.6	178	-146	159.9	0	0	0	110.9	M1 A2 R7 L8 L9	M1-L5 PolarHBondContact O-N 2.94Å; A2-L5 PolarHBondContact O-N 3.34Å; L5-R7 VanDerWaalsContact C-N 3.35Å; L5-R7 PolarHBondContact O-N 3.02Å; L5-L8 PolarHBondContact O-N 3.03Å; L5-L9 HydrophobicContact CD2-CD1 3.53Å; L5-L9 HydrophobicContact CD2-CD2 4.49Å; L5-L9 HydrophobicContact CD2-CG 3.87Å; L5-L9 VanDerWaalsContact O-CG 3.29Å; L5-L9 WeakPolarHBondContact O-CG 3.46Å; L5-L9 PolarHBondContact O-N 3.15Å
6	A	89.7	Confident	82.5	Confident	60 Å²	60	104.9 Å²	104.9	50%	0.496	63%	0.625	S	S	.	*	H	α-helix	trans	-60.8	-41.8	174.5	0	0	0	0	0	112.6	A2 L9 L10	A2-A6 PolarHBondContact O-N 3.38Å; A6-L9 PolarHBondContact O-N 3.26Å; A6-L10 WeakPolarHBondContact O-CB 3.28Å; A6-L10 PolarHBondContact O-N 3.35Å
7	R	88.5	Confident	81.8	Confident	184 Å²	184	102.5 Å²	102.5	69%	0.694	63%	0.627	S	S	*	*	H	α-helix	trans	-65.6	-40.7	175.3	-75.4	176.6	179.5	-178.5	-0.2	112	A3 G4 L5 L10 L11	A3-R7 WeakPolarHBondContact O-CG 3.46Å; A3-R7 PolarHBondContact O-N 3.29Å; A3-R7 VanDerWaalsContact O-N 3.16Å; G4-R7 PolarHBondContact O-N 2.95Å; L5-R7 VanDerWaalsContact C-N 3.35Å; L5-R7 PolarHBondContact O-N 3.02Å; R7-L10 PolarHBondContact O-N 3.06Å; R7-L11 VanDerWaalsContact O-CG 3.25Å; R7-L11 WeakPolarHBondContact O-CG 3.21Å; R7-L11 PolarHBondContact O-N 3.41Å
8	L	87.7	Confident	81.1	Confident	114 Å²	114	99.8 Å²	99.8	60%	0.597	62%	0.623	S	S	*	*	H	α-helix	trans	-63.3	-44.4	177.1	-177.2	64.2	0	0	0	111.5	G4 L5 L11 L12	G4-L8 WeakPolarHBondContact O-CB 3.46Å; G4-L8 PolarHBondContact O-N 3.35Å; L5-L8 PolarHBondContact O-N 3.03Å; L8-L11 PolarHBondContact O-N 3.23Å; L8-L12 WeakPolarHBondContact O-CB 3.13Å; L8-L12 PolarHBondContact O-N 3.16Å
9	L	89.9	Confident	80.5	Confident	105 Å²	105	101.5 Å²	101.5	55%	0.55	64%	0.635	S	S	.	*	H	α-helix	trans	-65	-38.8	177.7	-68.7	173.4	0	0	0	112.2	L5 A6 L12 G13	L5-L9 HydrophobicContact CD2-CD1 3.53Å; L5-L9 HydrophobicContact CD2-CD2 4.49Å; L5-L9 HydrophobicContact CD2-CG 3.87Å; L5-L9 VanDerWaalsContact O-CG 3.29Å; L5-L9 WeakPolarHBondContact O-CG 3.46Å; L5-L9 PolarHBondContact O-N 3.15Å; A6-L9 PolarHBondContact O-N 3.26Å; L9-L12 PolarHBondContact O-N 3.11Å; L9-G13 PolarHBondContact O-N 2.75Å
10	L	86.8	Confident	79.7	Confident	114 Å²	114	100.6 Å²	100.6	60%	0.597	64%	0.638	S	S	*	*	H	α-helix	trans	-63.3	-47.1	175.3	-179.2	65.3	0	0	0	111.4	A6 R7 L12 G13 L14	A6-L10 WeakPolarHBondContact O-CB 3.28Å; A6-L10 PolarHBondContact O-N 3.35Å; R7-L10 PolarHBondContact O-N 3.06Å; L10-L12 VanDerWaalsContact C-N 3.33Å; L10-L12 PolarHBondContact O-N 2.69Å; L10-G13 PolarHBondContact O-N 3.44Å; L10-L14 HydrophobicContact CD1-CD1 3.73Å; L10-L14 HydrophobicContact CG-CD1 4.17Å; L10-L14 WeakPolarHBondContact O-CD1 3.13Å; L10-L14 PolarHBondContact O-N 3.47Å
11	L	84.4	Confident	78.9	Confident	120 Å²	120	101.6 Å²	101.6	63%	0.628	65%	0.645	S	S	*	*	H	α-helix	trans	-63.6	-40.6	178.7	-69.1	170.7	0	0	0	111.7	R7 L8 L14 S15	R7-L11 VanDerWaalsContact O-CG 3.25Å; R7-L11 WeakPolarHBondContact O-CG 3.21Å; R7-L11 PolarHBondContact O-N 3.41Å; L8-L11 PolarHBondContact O-N 3.23Å; L11-L14 PolarHBondContact O-N 2.73Å; L11-S15 PolarHBondContact O-N 3.17Å; L11-S15 VanDerWaalsContact O-N 3.09Å; L11-S15 PolarHBondContact O-OG 2.85Å
12	L	83.4	Confident	78.7	Confident	114 Å²	114	95.5 Å²	95.5	60%	0.597	63%	0.63	S	S	*	*	H	α-helix	trans	-64.3	-43.5	176.9	-169.6	65.2	0	0	0	111.3	L8 L9 L10 L14 S15 A16	L8-L12 WeakPolarHBondContact O-CB 3.13Å; L8-L12 PolarHBondContact O-N 3.16Å; L9-L12 PolarHBondContact O-N 3.11Å; L10-L12 VanDerWaalsContact C-N 3.33Å; L10-L12 PolarHBondContact O-N 2.69Å; L12-L14 PolarHBondContact O-N 2.98Å; L12-S15 PolarHBondContact O-N 2.86Å; L12-S15 PolarHBondContact O-OG 2.72Å; L12-A16 PolarHBondContact O-N 2.62Å
13	G	83.2	Confident	78.1	Confident	51 Å²	51	94.7 Å²	94.7	53%	0.526	63%	0.63	S	S	.	*	H	α-helix	trans	-61.8	-38.8	176.6	0	0	0	0	0	113.6	L9 L10	L9-G13 PolarHBondContact O-N 2.75Å; L10-G13 PolarHBondContact O-N 3.44Å
14	L	77.9	Confident	77.2	Confident	126 Å²	126	96 Å²	96	66%	0.66	64%	0.641	S	S	*	*	H	α-helix	trans	-70	-34.8	176.1	-92.7	74.3	0	0	0	112.5	L10 L11 L12 A16	L10-L14 HydrophobicContact CD1-CD1 3.73Å; L10-L14 HydrophobicContact CG-CD1 4.17Å; L10-L14 WeakPolarHBondContact O-CD1 3.13Å; L10-L14 PolarHBondContact O-N 3.47Å; L11-L14 PolarHBondContact O-N 2.73Å; L12-L14 PolarHBondContact O-N 2.98Å; L14-A16 VanDerWaalsContact C-N 3.3Å; L14-A16 PolarHBondContact O-N 2.88Å
15	S	74.6	Confident	76.1	Confident	85 Å²	85	97.8 Å²	97.8	59%	0.594	65%	0.651	S	S	*	*	H	α-helix	trans	-73.8	-17.6	178.9	69.3	0	0	0	0	114.5	L11 L12 G17	L11-S15 PolarHBondContact O-N 3.17Å; L11-S15 VanDerWaalsContact O-N 3.09Å; L11-S15 PolarHBondContact O-OG 2.85Å; L12-S15 PolarHBondContact O-N 2.86Å; L12-S15 PolarHBondContact O-OG 2.72Å; S15-G17 PolarHBondContact O-N 3.05Å
16	A	74.8	Confident	75.2	Confident	84 Å²	84	102.9 Å²	102.9	69%	0.694	67%	0.669	S	S	*	*	T	Hydrogen-bonded Turn	trans	-73.8	-13.6	-179.3	0	0	0	0	0	113.1	L12 L14 G18	L12-A16 PolarHBondContact O-N 2.62Å; L14-A16 VanDerWaalsContact C-N 3.3Å; L14-A16 PolarHBondContact O-N 2.88Å; A16-G18 VanDerWaalsContact C-N 3.29Å; A16-G18 PolarHBondContact O-N 3.49Å
17	G	71	Confident	74.2	Confident	65 Å²	65	108.6 Å²	108.6	67%	0.67	69%	0.687	S	S	*	*			trans	-75.7	79	169.3	0	0	0	0	0	110.6	S15	S15-G17 PolarHBondContact O-N 3.05Å
18	G	69.2	Low	73.4	Confident	53 Å²	53	108 Å²	108	55%	0.546	69%	0.69	S	S	.	*			trans	-54.9	160.1	167.1	0	0	0	0	0	111	A16 A20	A16-G18 VanDerWaalsContact C-N 3.29Å; A16-G18 PolarHBondContact O-N 3.49Å; G18-A20 PolarHBondContact O-N 3.46Å
19	P	68.3	Low	72.6	Confident	133 Å²	133	108.7 Å²	108.7	86%	0.864	70%	0.698	S	S	*	*			trans	-54	115.7	178.7	22.2	-31.3	0	0	0	108.7
20	A	65.8	Low	71.5	Confident	82 Å²	82	108.6 Å²	108.6	68%	0.678	70%	0.702	S	S	*	*			trans	-52.7	135.3	169.5	0	0	0	0	0	106.6	G18 A22	G18-A20 PolarHBondContact O-N 3.46Å; A20-A22 VanDerWaalsContact C-N 3.28Å; A20-A22 PolarHBondContact O-N 3Å
21	P	62.4	Low	70.8	Confident	122 Å²	122	110 Å²	110	79%	0.792	71%	0.705	S	S	*	*			trans	-58.4	103.4	174.5	24.6	-31.3	0	0	0	105.9	G23	P21-G23 VanDerWaalsContact C-N 3.34Å; P21-G23 WeakPolarHBondContact O-CA 3.23Å; P21-G23 PolarHBondContact O-N 3.35Å
22	A	62.9	Low	70.3	Confident	95 Å²	95	111.5 Å²	111.5	79%	0.785	71%	0.709	S	S	*	*			trans	-53.2	110.5	170.6	0	0	0	0	0	103.5	A20 A24	A20-A22 VanDerWaalsContact C-N 3.28Å; A20-A22 PolarHBondContact O-N 3Å; A22-A24 PolarHBondContact O-N 2.93Å
23	G	61.9	Low	69.3	Low	64 Å²	64	110.8 Å²	110.8	66%	0.66	71%	0.711	S	S	*	*			trans	-41.3	121.9	-160.9	0	0	0	0	0	108.7	P21 A25	P21-G23 VanDerWaalsContact C-N 3.34Å; P21-G23 WeakPolarHBondContact O-CA 3.23Å; P21-G23 PolarHBondContact O-N 3.35Å; G23-A25 PolarHBondContact O-N 3Å
24	A	61.5	Low	68.4	Low	98 Å²	98	112 Å²	112	81%	0.81	71%	0.705	S	S	*	*			trans	-58.3	89	174.4	0	0	0	0	0	106	A22 K26	A22-A24 PolarHBondContact O-N 2.93Å; A24-K26 PolarHBondContact O-N 3.4Å
25	A	64.3	Low	67.6	Low	85 Å²	85	109 Å²	109	70%	0.702	70%	0.699	S	S	*	*			trans	-60.5	108.4	176.6	0	0	0	0	0	103.2	G23 M27	G23-A25 PolarHBondContact O-N 3Å; A25-M27 VanDerWaalsContact C-N 3.27Å; A25-M27 PolarHBondContact O-N 3.4Å
26	K	71.1	Confident	66.9	Low	207 Å²	207	112.5 Å²	112.5	90%	0.9	70%	0.704	S	S	*	*			trans	-53.5	101.6	175.9	-87.6	-172.5	172.9	-168.6	0	106.1	A24 K28	A24-K26 PolarHBondContact O-N 3.4Å; K26-K28 PolarHBondContact O-N 3.43Å
27	M	67.6	Low	66.5	Low	180 Å²	180	108.5 Å²	108.5	89%	0.887	67%	0.671	S	S	*	*			trans	-69.1	104.3	173.1	-74.9	175	88.8	0	0	105	A25 V29	A25-M27 VanDerWaalsContact C-N 3.27Å; A25-M27 PolarHBondContact O-N 3.4Å; M27-V29 PolarHBondContact O-N 3Å; M27-V29 VanDerWaalsContact O-N 3.17Å
28	K	73.6	Confident	66.4	Low	171 Å²	171	108.2 Å²	108.2	74%	0.743	66%	0.656	S	S	*	*			trans	-64.8	116.6	163.6	-174.2	173.1	-176	-68.2	0	105	K26 V30	K26-K28 PolarHBondContact O-N 3.43Å; K28-V30 VanDerWaalsContact C-N 3.26Å; K28-V30 HydrophobicContact CG-CG2 4.43Å; K28-V30 PolarHBondContact O-N 3.47Å
29	V	69.5	Low	66.4	Low	129 Å²	129	111.5 Å²	111.5	78%	0.782	66%	0.661	S	S	*	*			trans	-59	103.4	161.4	169.3	0	0	0	0	105.2	M27 E31	M27-V29 PolarHBondContact O-N 3Å; M27-V29 VanDerWaalsContact O-N 3.17Å; V29-E31 PolarHBondContact O-N 3.04Å
30	V	67.3	Low	66.8	Low	103 Å²	103	106.4 Å²	106.4	62%	0.624	63%	0.627	S	S	*	*			trans	-85	104.6	165.2	175.3	0	0	0	0	102.9	K28 E32	K28-V30 VanDerWaalsContact C-N 3.26Å; K28-V30 HydrophobicContact CG-CG2 4.43Å; K28-V30 PolarHBondContact O-N 3.47Å; V30-E32 PolarHBondContact O-N 3.38Å
31	E	72.4	Confident	67.4	Low	143 Å²	143	107.1 Å²	107.1	67%	0.668	62%	0.624	S	S	*	*			trans	-50.4	128.5	165.9	-171.2	173.8	167.9	0	0	106.8	V29	V29-E31 PolarHBondContact O-N 3.04Å
32	E	73.3	Confident	68.3	Low	152 Å²	152	110.2 Å²	110.2	71%	0.71	63%	0.626	S	S	*	*			trans	-48.5	134.3	-176.7	-154.4	-115.2	148.3	0	0	108.4	V30 N34	V30-E32 PolarHBondContact O-N 3.38Å; E32-N34 PolarHBondContact O-N 3.47Å
33	P	63.2	Low	69	Low	98 Å²	98	108 Å²	108	64%	0.636	60%	0.6	S	S	*	*			trans	-58.4	104.6	-176.9	-16.7	28.1	0	0	0	107.4	A35	P33-A35 PolarHBondContact O-N 3.32Å
34	N	64.8	Low	70	Confident	76 Å²	76	109 Å²	109	41%	0.406	60%	0.595	S	S	.	*			trans	-76.5	77	-169.4	-155	-1.9	0	0	0	108	E32 F36 G37	E32-N34 PolarHBondContact O-N 3.47Å; N34-F36 PolarHBondContact O-N 3.48Å; N34-F36 VanDerWaalsContact O-N 3.11Å; N34-G37 WeakPolarHBondContact ND2-CA 3.18Å; N34-G37 PolarHBondContact O-N 2.94Å; N34-G37 WeakPolarHBondContact OD1-CA 3.44Å; N34-G37 PolarHBondContact OD1-N 3.47Å
35	A	60.3	Low	70.8	Confident	64 Å²	64	112.4 Å²	112.4	53%	0.529	59%	0.594	S	S	.	*	T	Hydrogen-bonded Turn	trans	-60.2	-27.4	-169.5	0	0	0	0	0	111.8	P33 N40	P33-A35 PolarHBondContact O-N 3.32Å; A35-N40 PolarHBondContact O-ND2 2.79Å
36	F	59.9	Low	71.5	Confident	158 Å²	158	113.2 Å²	113.2	69%	0.693	60%	0.601	S	S	*	*	T	Hydrogen-bonded Turn	trans	-118.1	17.9	176.6	-60.3	-80	0	0	0	112.5	N34 L49	N34-F36 PolarHBondContact O-N 3.48Å; N34-F36 VanDerWaalsContact O-N 3.11Å; F36-L49 HydrophobicContact CB-CD1 4.2Å; F36-L49 WeakPolarHBondContact O-CD1 3.35Å; F36-L49 VanDerWaalsContact O-CG 3.23Å; F36-L49 WeakPolarHBondContact O-CG 3.49Å
37	G	65.5	Low	71.8	Confident	1 Å²	1	107 Å²	107	1%	0.01	58%	0.584	C	S	.	*			trans	-69.2	148.8	-164.7	0	0	0	0	0	117.1	N34 N39 N40	N34-G37 WeakPolarHBondContact ND2-CA 3.18Å; N34-G37 PolarHBondContact O-N 2.94Å; N34-G37 WeakPolarHBondContact OD1-CA 3.44Å; N34-G37 PolarHBondContact OD1-N 3.47Å; G37-N39 PolarHBondContact O-N 3.25Å; G37-N40 WeakPolarHBondContact O-CB 3.25Å; G37-N40 PolarHBondContact O-N 3.09Å
38	V	68.8	Low	72.4	Confident	58 Å²	58	103 Å²	103	35%	0.352	56%	0.559	S	S	.	*	T	Hydrogen-bonded Turn	trans	-42.2	-35.5	163.6	175.5	0	0	0	0	111.9	R48 L49 A51	V38-R48 WeakPolarHBondContact O-CD 3.42Å; V38-L49 WeakPolarHBondContact CA-O 3.21Å; V38-L49 HydrophobicContact CG2-CB 4.41Å; V38-L49 WeakPolarHBondContact CG2-O 3.33Å; V38-A51 HydrophobicContact CG2-CB 4.28Å
39	N	70.6	Confident	72.5	Confident	123 Å²	123	99.9 Å²	99.9	66%	0.658	55%	0.55	S	S	*	.	T	Hydrogen-bonded Turn	trans	-104.7	17.4	-173.5	-62.7	-46.4	0	0	0	114.4	G37 P41	G37-N39 PolarHBondContact O-N 3.25Å; N39-P41 VanDerWaalsContact O-CD 3.28Å; N39-P41 WeakPolarHBondContact O-CD 3.42Å
40	N	77.1	Confident	72.9	Confident	26 Å²	26	102.1 Å²	102.1	14%	0.139	55%	0.552	C	S	.	*			trans	-74.6	115.9	-179.9	-171.5	-18.8	0	0	0	111.1	A35 G37 F42 L43 R48	A35-N40 PolarHBondContact O-ND2 2.79Å; G37-N40 WeakPolarHBondContact O-CB 3.25Å; G37-N40 PolarHBondContact O-N 3.09Å; N40-F42 PolarHBondContact O-N 3.45Å; N40-F42 WeakPolarHBondContact OD1-CB 3.29Å; N40-F42 PolarHBondContact OD1-N 3.45Å; N40-L43 HydrophobicContact CB-CB 4.26Å; N40-L43 HydrophobicContact CB-CD1 3.86Å; N40-L43 HydrophobicContact CB-CG 3.98Å; N40-L43 PolarHBondContact O-N 3.4Å; N40-R48 PolarHBondContact O-NE 2.99Å; N40-R48 PolarHBondContact O-NH2 3.27Å; N40-R48 VanDerWaalsContact O-NH2 3.15Å
41	P	76.6	Confident	73.2	Confident	96 Å²	96	100.7 Å²	100.7	62%	0.623	55%	0.551	S	S	*	*	T	Hydrogen-bonded Turn	trans	-70.3	-21	-179	29.6	-34.9	0	0	0	112.8	N39	N39-P41 VanDerWaalsContact O-CD 3.28Å; N39-P41 WeakPolarHBondContact O-CD 3.42Å
42	F	81.4	Confident	73.2	Confident	188 Å²	188	103.9 Å²	103.9	83%	0.825	56%	0.563	S	S	*	*	T	Hydrogen-bonded Turn	trans	-87.1	-9.8	-179	-56.1	-72.4	0	0	0	113.4	N40	N40-F42 PolarHBondContact O-N 3.45Å; N40-F42 WeakPolarHBondContact OD1-CB 3.29Å; N40-F42 PolarHBondContact OD1-N 3.45Å
43	L	78.8	Confident	73.1	Confident	48 Å²	48	106.5 Å²	106.5	25%	0.251	57%	0.566	S	S	.	*	S	Bend	trans	-91.2	135	174.7	-69.3	178	0	0	0	111.3	N40 R48	N40-L43 HydrophobicContact CB-CB 4.26Å; N40-L43 HydrophobicContact CB-CD1 3.86Å; N40-L43 HydrophobicContact CB-CG 3.98Å; N40-L43 PolarHBondContact O-N 3.4Å; L43-R48 HydrophobicContact CB-CG 4.08Å; L43-R48 PolarHBondContact O-NE 3.24Å; L43-R48 PolarHBondContact O-NH2 3.41Å
44	P	82.8	Confident	73.8	Confident	85 Å²	85	108.6 Å²	108.6	55%	0.552	57%	0.572	S	S	*	*			trans	-57.3	146.1	168.4	-20.7	31.1	0	0	0	111.1	A46 S47 R48	P44-A46 PolarHBondContact O-N 3.32Å; P44-A46 VanDerWaalsContact O-N 3.11Å; P44-S47 PolarHBondContact O-N 2.93Å; P44-R48 PolarHBondContact O-N 3.39Å
45	Q	77.3	Confident	74.3	Confident	169 Å²	169	110.7 Å²	110.7	79%	0.79	59%	0.59	S	S	*	*	G	3₁₀ helix	trans	-53.8	-37	-176.5	-176.9	177	-16.4	0	0	113.3	S47 R48	Q45-S47 PolarHBondContact O-N 3.16Å; Q45-R48 PolarHBondContact O-N 3.4Å
46	A	80	Confident	75.1	Confident	103 Å²	103	112.1 Å²	112.1	85%	0.851	60%	0.596	S	S	*	*	G	3₁₀ helix	trans	-68.4	-20.8	178.6	0	0	0	0	0	114	P44	P44-A46 PolarHBondContact O-N 3.32Å; P44-A46 VanDerWaalsContact O-N 3.11Å
47	S	76.8	Confident	76.1	Confident	77 Å²	77	110.3 Å²	110.3	54%	0.538	60%	0.6	S	S	.	*	G	3₁₀ helix	trans	-103	-2.8	-178.6	-55.1	0	0	0	0	112.9	P44 Q45	P44-S47 PolarHBondContact O-N 2.93Å; Q45-S47 PolarHBondContact O-N 3.16Å
48	R	80.1	Confident	76.8	Confident	94 Å²	94	117 Å²	117	36%	0.355	64%	0.64	S	S	.	*	S	Bend	trans	-71.7	133.7	175	-72.6	178.8	179.1	152.2	5.9	109.6	V38 N40 L43 P44 Q45	V38-R48 WeakPolarHBondContact O-CD 3.42Å; N40-R48 PolarHBondContact O-NE 2.99Å; N40-R48 PolarHBondContact O-NH2 3.27Å; N40-R48 VanDerWaalsContact O-NH2 3.15Å; L43-R48 HydrophobicContact CB-CG 4.08Å; L43-R48 PolarHBondContact O-NE 3.24Å; L43-R48 PolarHBondContact O-NH2 3.41Å; P44-R48 PolarHBondContact O-N 3.39Å; Q45-R48 PolarHBondContact O-N 3.4Å
49	L	77.1	Confident	77.2	Confident	106 Å²	106	120 Å²	120	56%	0.555	66%	0.664	S	S	*	*	P	Polyproline II helix	trans	-59.2	141.4	169.6	-65.5	-179.5	0	0	0	109.2	F36 V38	F36-L49 HydrophobicContact CB-CD1 4.2Å; F36-L49 WeakPolarHBondContact O-CD1 3.35Å; F36-L49 VanDerWaalsContact O-CG 3.23Å; F36-L49 WeakPolarHBondContact O-CG 3.49Å; V38-L49 WeakPolarHBondContact CA-O 3.21Å; V38-L49 HydrophobicContact CG2-CB 4.41Å; V38-L49 WeakPolarHBondContact CG2-O 3.33Å
50	Q	77.8	Confident	77.1	Confident	176 Å²	176	117.7 Å²	117.7	82%	0.822	67%	0.669	S	S	*	*	P	Polyproline II helix	trans	-90.7	134.6	170.1	-67.8	-165.6	-31.6	0	0	109.3	K52	Q50-K52 PolarHBondContact O-N 3.23Å; Q50-K52 VanDerWaalsContact O-N 3.16Å
51	A	72.9	Confident	75.8	Confident	73 Å²	73	129.2 Å²	129.2	60%	0.603	72%	0.722	S	S	*	*	P	Polyproline II helix	trans	-63.3	117.3	168.8	0	0	0	0	0	108.3	V38 R53	V38-A51 HydrophobicContact CG2-CB 4.28Å; A51-R53 VanDerWaalsContact C-N 3.26Å
52	K	72.5	Confident	75.8	Confident	211 Å²	211	130.9 Å²	130.9	92%	0.917	73%	0.727	S	S	*	*			trans	-89.7	10.6	174.7	-71.4	-178.3	176	-75.9	0	112.8	Q50	Q50-K52 PolarHBondContact O-N 3.23Å; Q50-K52 VanDerWaalsContact O-N 3.16Å
53	R	70.9	Confident	75.5	Confident	207 Å²	207	127.9 Å²	127.9	78%	0.781	72%	0.722	S	S	*	*	S	Bend	trans	-127.3	141.1	-176.3	-177.2	179.1	172.9	119.9	-0.7	108.8	A51	A51-R53 VanDerWaalsContact C-N 3.26Å
54	D	78.2	Confident	75.3	Confident	141 Å²	141	132.3 Å²	132.3	75%	0.754	75%	0.748	S	S	*	*	P	Polyproline II helix	trans	-58.7	145.1	175	-63.4	-54.3	0	0	0	111.5	S56	D54-S56 PolarHBondContact O-N 2.94Å
55	P	74.6	Confident	74.9	Confident	121 Å²	121	135.1 Å²	135.1	79%	0.786	76%	0.759	S	S	*	*	P	Polyproline II helix	trans	-59.1	141.5	179.2	25.4	-33.4	0	0	0	110.2
56	S	76.6	Confident	74.7	Confident	93 Å²	93	133 Å²	133	65%	0.65	76%	0.757	S	S	*	*	P	Polyproline II helix	trans	-70.1	146.7	171.7	-63.9	0	0	0	0	109.7	D54	D54-S56 PolarHBondContact O-N 2.94Å
57	P	82.4	Confident	74.4	Confident	120 Å²	120	135 Å²	135	78%	0.779	75%	0.751	S	S	*	*	P	Polyproline II helix	trans	-58.8	143.7	177.6	23	-31.3	0	0	0	110.7	S59	P57-S59 PolarHBondContact O-N 2.92Å
58	V	79.7	Confident	74.2	Confident	141 Å²	141	139.1 Å²	139.1	86%	0.855	77%	0.766	S	S	*	*	P	Polyproline II helix	trans	-62.4	132.6	174.5	176.1	0	0	0	0	108.3
59	S	78	Confident	73.7	Confident	123 Å²	123	142.6 Å²	142.6	86%	0.86	80%	0.798	S	S	*	*	P	Polyproline II helix	trans	-101	126	179.7	-158.6	0	0	0	0	110.2	P57	P57-S59 PolarHBondContact O-N 2.92Å
60	G	68.4	Low	73.5	Confident	73 Å²	73	145.7 Å²	145.7	75%	0.753	82%	0.818	S	S	*	*			trans	89.4	101.3	175.4	0	0	0	0	0	113.1
61	E	49.4	Very low	73.1	Confident	269 Å²	269	142.9 Å²	142.9	100%	1.257	82%	0.818	S	S	*	*			trans	-104.9	0	166	45.6	-167	87.9	0	0	110.7

Retrieved 61 of 61 residues in 49 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).