A0A087WWE7_HUMAN Loading...

Ribosomal biogenesis factor

AlphaFold DB , UniProt , Accession A0A087WWE7, Species HUMAN (Homo sapiens, Human), Gene RBIS, Length 61 aa.

						>A0A087WWE7_HUMAN|A0A087WWE7|RBIS
MAKNKLRGPKSRNVFHIASQKNFKAKNKAKPVTTNLKKIPQQRHESKPVNVDEATRLMALL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	43	Very low	67.7	Low	245 Å²	245	156.5 Å²	156.5	100%	1.207	83%	0.829	S	S	*	*				0	119.8	0	-64.5	-147.4	-71.7	0	0	109.1
2	A	60.9	Low	68.4	Low	106 Å²	106	156.4 Å²	156.4	88%	0.876	81%	0.809	S	S	*	*			trans	-87.5	117.1	-176	0	0	0	0	0	110.7	N4	A2-N4 PolarHBondContact O-N 3.48Å
3	K	68	Low	69.3	Low	207 Å²	207	150.6 Å²	150.6	90%	0.9	78%	0.78	S	S	*	*			trans	-83.5	98.5	-179.2	-148.7	177.1	-169.5	-179.9	0	108.7	K5	K3-K5 PolarHBondContact O-N 3.3Å
4	N	69.4	Low	69.5	Low	130 Å²	130	147.8 Å²	147.8	70%	0.695	77%	0.772	S	S	*	*			trans	-73.2	126.4	171.3	59.8	35.1	0	0	0	109	A2 L6	A2-N4 PolarHBondContact O-N 3.48Å; N4-L6 PolarHBondContact O-N 2.99Å; N4-L6 VanDerWaalsContact O-N 3.16Å
5	K	66.1	Low	69.7	Low	201 Å²	201	148.9 Å²	148.9	87%	0.874	77%	0.769	S	S	*	*			trans	-75.9	105.6	177.6	-66.3	-177.8	-178.5	-179.1	0	107.1	K3 R7	K3-K5 PolarHBondContact O-N 3.3Å; K5-R7 PolarHBondContact O-N 3.16Å
6	L	68.1	Low	69.8	Low	157 Å²	157	147.1 Å²	147.1	82%	0.822	76%	0.755	S	S	*	*			trans	-56.4	110.6	170.5	-66.5	171.5	0	0	0	107.6	N4 G8	N4-L6 PolarHBondContact O-N 2.99Å; N4-L6 VanDerWaalsContact O-N 3.16Å; L6-G8 PolarHBondContact O-N 3.17Å; L6-G8 VanDerWaalsContact O-N 3.17Å
7	R	70.6	Confident	70	Confident	207 Å²	207	143.4 Å²	143.4	78%	0.781	74%	0.737	S	S	*	*	P	Polyproline II helix	trans	-58.1	121.3	176.8	-77.2	168.3	72.7	-162.7	14.7	107.6	K5 K10	K5-R7 PolarHBondContact O-N 3.16Å; R7-K10 VanDerWaalsContact NH2-CE 3.34Å
8	G	75	Confident	69.8	Low	54 Å²	54	139.4 Å²	139.4	56%	0.557	73%	0.729	S	S	*	*	P	Polyproline II helix	trans	-60.2	168	179	0	0	0	0	0	112.5	L6 K10	L6-G8 PolarHBondContact O-N 3.17Å; L6-G8 VanDerWaalsContact O-N 3.17Å; G8-K10 PolarHBondContact O-N 3.13Å; G8-K10 VanDerWaalsContact O-N 3.13Å
9	P	74.6	Confident	69.6	Low	138 Å²	138	136.8 Å²	136.8	90%	0.896	72%	0.723	S	S	*	*	P	Polyproline II helix	trans	-53.6	121.6	176.6	-21.3	31.5	0	0	0	110.1	S11	P9-S11 PolarHBondContact O-N 3.16Å
10	K	74.3	Confident	69.4	Low	160 Å²	160	136 Å²	136	70%	0.696	72%	0.715	S	S	*	*	P	Polyproline II helix	trans	-63.8	128.7	176.4	-71.6	179.3	-179.9	172.9	0	108.8	R7 G8 R12	R7-K10 VanDerWaalsContact NH2-CE 3.34Å; G8-K10 PolarHBondContact O-N 3.13Å; G8-K10 VanDerWaalsContact O-N 3.13Å; K10-R12 PolarHBondContact O-N 3.35Å; K10-R12 VanDerWaalsContact O-N 3.16Å
11	S	74.3	Confident	69.5	Low	117 Å²	117	138.2 Å²	138.2	82%	0.818	72%	0.719	S	S	*	*	P	Polyproline II helix	trans	-57.4	119.6	170.4	54.3	0	0	0	0	109.3	P9 N13	P9-S11 PolarHBondContact O-N 3.16Å; S11-N13 PolarHBondContact O-N 3.36Å
12	R	75.9	Confident	70.6	Confident	155 Å²	155	132.7 Å²	132.7	59%	0.585	69%	0.694	S	S	*	*	P	Polyproline II helix	trans	-71.5	121.7	173.6	-76.6	171.6	59.2	112.3	-1.2	108.3	K10 I17	K10-R12 PolarHBondContact O-N 3.35Å; K10-R12 VanDerWaalsContact O-N 3.16Å; R12-I17 HydrophobicContact CB-CD1 3.99Å; R12-I17 HydrophobicContact CB-CG1 4.21Å
13	N	80.4	Confident	70.7	Confident	81 Å²	81	137 Å²	137	43%	0.433	69%	0.693	S	S	.	*	P	Polyproline II helix	trans	-65.6	134.5	179.3	178.8	-53.6	0	0	0	110.3	S11 F15 H16 I17	S11-N13 PolarHBondContact O-N 3.36Å; N13-F15 PolarHBondContact O-N 2.91Å; N13-F15 VanDerWaalsContact O-N 3.16Å; N13-F15 VanDerWaalsContact OD1-CB 3.27Å; N13-F15 WeakPolarHBondContact OD1-CB 3.42Å; N13-F15 WeakPolarHBondContact OD1-CD2 3.36Å; N13-F15 PolarHBondContact OD1-N 3.3Å; N13-H16 WeakPolarHBondContact O-CB 3.46Å; N13-H16 PolarHBondContact O-N 3.16Å; N13-I17 PolarHBondContact O-N 2.84Å
14	V	72.1	Confident	70.5	Confident	111 Å²	111	135.1 Å²	135.1	67%	0.673	69%	0.685	S	S	*	*	H	α-helix	trans	-54.1	-34.2	-177.5	-178.7	0	0	0	0	112.6	H16 I17 A18	V14-H16 VanDerWaalsContact C-N 3.3Å; V14-H16 PolarHBondContact O-N 3.38Å; V14-I17 PolarHBondContact O-N 2.87Å; V14-I17 VanDerWaalsContact O-N 3.1Å; V14-A18 WeakPolarHBondContact O-CB 3.06Å; V14-A18 PolarHBondContact O-N 3.1Å
15	F	72.8	Confident	70.4	Confident	164 Å²	164	132.4 Å²	132.4	72%	0.719	68%	0.681	S	S	*	*	H	α-helix	trans	-62.1	-35.9	175.6	-63.1	-66.2	0	0	0	112.6	N13 S19	N13-F15 PolarHBondContact O-N 2.91Å; N13-F15 VanDerWaalsContact O-N 3.16Å; N13-F15 VanDerWaalsContact OD1-CB 3.27Å; N13-F15 WeakPolarHBondContact OD1-CB 3.42Å; N13-F15 WeakPolarHBondContact OD1-CD2 3.36Å; N13-F15 PolarHBondContact OD1-N 3.3Å; F15-S19 WeakPolarHBondContact O-CB 3.27Å; F15-S19 PolarHBondContact O-N 3.47Å; F15-S19 PolarHBondContact O-OG 3.2Å; F15-S19 VanDerWaalsContact O-OG 3.09Å
16	H	71.9	Confident	70.6	Confident	120 Å²	120	132.6 Å²	132.6	56%	0.556	68%	0.682	S	S	*	*	H	α-helix	trans	-75.4	-26.1	175.4	-68.1	73	0	0	0	112.2	N13 V14 S19 Q20	N13-H16 WeakPolarHBondContact O-CB 3.46Å; N13-H16 PolarHBondContact O-N 3.16Å; V14-H16 VanDerWaalsContact C-N 3.3Å; V14-H16 PolarHBondContact O-N 3.38Å; H16-S19 PolarHBondContact O-OG 3.28Å; H16-Q20 VanDerWaalsContact O-CG 3.22Å; H16-Q20 WeakPolarHBondContact O-CG 3.22Å
17	I	71.7	Confident	70.6	Confident	85 Å²	85	131 Å²	131	44%	0.436	67%	0.674	S	S	.	*	H	α-helix	trans	-78.3	-43.9	177.9	-62	171	0	0	0	110.2	R12 N13 V14 Q20	R12-I17 HydrophobicContact CB-CD1 3.99Å; R12-I17 HydrophobicContact CB-CG1 4.21Å; N13-I17 PolarHBondContact O-N 2.84Å; V14-I17 PolarHBondContact O-N 2.87Å; V14-I17 VanDerWaalsContact O-N 3.1Å; I17-Q20 PolarHBondContact O-N 3.09Å
18	A	67.8	Low	70.5	Confident	72 Å²	72	131.3 Å²	131.3	60%	0.595	68%	0.681	S	S	*	*	H	α-helix	trans	-67.3	-34.5	178.7	0	0	0	0	0	112.5	V14	V14-A18 WeakPolarHBondContact O-CB 3.06Å; V14-A18 PolarHBondContact O-N 3.1Å
19	S	66.2	Low	70.7	Confident	89 Å²	89	132 Å²	132	62%	0.622	68%	0.681	S	S	*	*	H	α-helix	trans	-75.3	-26.2	179.1	66.4	0	0	0	0	113.9	F15 H16 K21	F15-S19 WeakPolarHBondContact O-CB 3.27Å; F15-S19 PolarHBondContact O-N 3.47Å; F15-S19 PolarHBondContact O-OG 3.2Å; F15-S19 VanDerWaalsContact O-OG 3.09Å; H16-S19 PolarHBondContact O-OG 3.28Å; S19-K21 VanDerWaalsContact C-N 3.33Å
20	Q	65.6	Low	70.6	Confident	120 Å²	120	134.1 Å²	134.1	56%	0.561	68%	0.677	S	S	*	*	H	α-helix	trans	-78.6	-15.5	178.9	-76.8	-179	5.9	0	0	113.6	H16 I17 N22	H16-Q20 VanDerWaalsContact O-CG 3.22Å; H16-Q20 WeakPolarHBondContact O-CG 3.22Å; I17-Q20 PolarHBondContact O-N 3.09Å; Q20-N22 PolarHBondContact O-N 3.18Å
21	K	70	Confident	70.6	Confident	184 Å²	184	131.8 Å²	131.8	80%	0.8	68%	0.678	S	S	*	*	S	Bend	trans	-79.8	73.5	178.4	-156.3	-178.7	-171.3	-173.8	0	109.8	S19 F23	S19-K21 VanDerWaalsContact C-N 3.33Å; K21-F23 PolarHBondContact O-N 2.88Å
22	N	65.8	Low	70.7	Confident	128 Å²	128	132.4 Å²	132.4	68%	0.684	68%	0.676	S	S	*	*			trans	18.1	84.7	166.3	-70.4	-76.4	0	0	0	114.7	Q20 K24	Q20-N22 PolarHBondContact O-N 3.18Å; N22-K24 HydrophobicContact CB-CG 4.25Å; N22-K24 PolarHBondContact O-N 2.86Å
23	F	63.3	Low	70.7	Confident	196 Å²	196	130.2 Å²	130.2	86%	0.86	68%	0.68	S	S	*	*			trans	-68	80	160	-167.6	-99.1	0	0	0	107.3	K21 A25	K21-F23 PolarHBondContact O-N 2.88Å; F23-A25 HydrophobicContact CD1-CB 4.27Å; F23-A25 HydrophobicContact CE1-CB 4.19Å; F23-A25 PolarHBondContact O-N 2.77Å
24	K	65.3	Low	70.6	Confident	168 Å²	168	130.9 Å²	130.9	73%	0.73	69%	0.687	S	S	*	*			trans	-66.2	93.4	168.6	-68.1	-109.1	-177.2	-179	0	104.7	N22 K26	N22-K24 HydrophobicContact CB-CG 4.25Å; N22-K24 PolarHBondContact O-N 2.86Å; K24-K26 PolarHBondContact O-N 2.72Å
25	A	67.6	Low	70.7	Confident	74 Å²	74	133.2 Å²	133.2	61%	0.612	70%	0.696	S	S	*	*			trans	-59.9	90.6	166.8	0	0	0	0	0	106.9	F23 N27	F23-A25 HydrophobicContact CD1-CB 4.27Å; F23-A25 HydrophobicContact CE1-CB 4.19Å; F23-A25 PolarHBondContact O-N 2.77Å; A25-N27 PolarHBondContact O-N 2.9Å
26	K	69.7	Low	70.9	Confident	205 Å²	205	131.9 Å²	131.9	89%	0.891	70%	0.696	S	S	*	*			trans	-76.5	67.7	174.3	-103.8	-169.4	176.5	-175.4	0	107.5	K24	K24-K26 PolarHBondContact O-N 2.72Å
27	N	67.8	Low	71.3	Confident	122 Å²	122	135.8 Å²	135.8	65%	0.652	71%	0.711	S	S	*	*			trans	-160.6	101.1	153.6	-149.5	-46.1	0	0	0	110.2	A25 A29	A25-N27 PolarHBondContact O-N 2.9Å; N27-A29 WeakPolarHBondContact OD1-CA 2.87Å; N27-A29 WeakPolarHBondContact OD1-CB 3.33Å; N27-A29 PolarHBondContact OD1-N 2.8Å
28	K	68.8	Low	71.5	Confident	215 Å²	215	141.4 Å²	141.4	94%	0.935	73%	0.733	S	S	*	*			trans	-82	3.1	168.4	-73.8	-173.8	177.2	-177.6	0	112.1	K30	K28-K30 PolarHBondContact O-N 3.07Å
29	A	78	Confident	72	Confident	67 Å²	67	145 Å²	145	55%	0.554	74%	0.74	S	S	*	*	S	Bend	trans	-65.6	137.3	176	0	0	0	0	0	108.4	N27	N27-A29 WeakPolarHBondContact OD1-CA 2.87Å; N27-A29 WeakPolarHBondContact OD1-CB 3.33Å; N27-A29 PolarHBondContact OD1-N 2.8Å
30	K	73.7	Confident	72.7	Confident	184 Å²	184	146.3 Å²	146.3	80%	0.8	75%	0.746	S	S	*	*	P	Polyproline II helix	trans	-55.4	134.8	167.9	-63.1	-179.7	179.6	179.3	0	107.2	K28 V32	K28-K30 PolarHBondContact O-N 3.07Å; K30-V32 PolarHBondContact O-N 3.45Å
31	P	73.4	Confident	73.1	Confident	110 Å²	110	148.3 Å²	148.3	71%	0.714	76%	0.756	S	S	*	*	P	Polyproline II helix	trans	-54.9	122.5	172.6	23.7	-32.1	0	0	0	107.5	T33	P31-T33 VanDerWaalsContact C-N 3.35Å; P31-T33 PolarHBondContact O-N 2.74Å
32	V	76.6	Confident	73.5	Confident	130 Å²	130	148.5 Å²	148.5	79%	0.788	76%	0.759	S	S	*	*			trans	-71.1	100.6	171.1	177.4	0	0	0	0	105.8	K30 T34	K30-V32 PolarHBondContact O-N 3.45Å; V32-T34 HydrophobicContact CG1-CG2 4.24Å; V32-T34 PolarHBondContact O-N 2.95Å; V32-T34 VanDerWaalsContact O-N 3.08Å
33	T	76.6	Confident	73.9	Confident	110 Å²	110	151.8 Å²	151.8	68%	0.675	76%	0.762	S	S	*	*			trans	-76.7	92.5	173.6	56.4	0	0	0	0	107.7	P31 N35	P31-T33 VanDerWaalsContact C-N 3.35Å; P31-T33 PolarHBondContact O-N 2.74Å; T33-N35 PolarHBondContact O-N 3.45Å
34	T	77.4	Confident	74.4	Confident	94 Å²	94	150.6 Å²	150.6	58%	0.577	76%	0.759	S	S	*	*			trans	-70.8	118	165.5	48.8	0	0	0	0	107.9	V32 L36	V32-T34 HydrophobicContact CG1-CG2 4.24Å; V32-T34 PolarHBondContact O-N 2.95Å; V32-T34 VanDerWaalsContact O-N 3.08Å; T34-L36 PolarHBondContact O-N 2.97Å
35	N	75.4	Confident	75.1	Confident	160 Å²	160	150.5 Å²	150.5	86%	0.856	76%	0.761	S	S	*	*			trans	-69.8	74.6	171.7	-69.8	-59.5	0	0	0	109.3	T33 K37	T33-N35 PolarHBondContact O-N 3.45Å; N35-K37 PolarHBondContact O-N 3.14Å
36	L	76.3	Confident	75.7	Confident	137 Å²	137	151.4 Å²	151.4	72%	0.717	76%	0.763	S	S	*	*			trans	-73.5	114.2	173.4	-62.1	177	0	0	0	107.6	T34 K38	T34-L36 PolarHBondContact O-N 2.97Å; L36-K38 PolarHBondContact O-N 3.05Å; L36-K38 VanDerWaalsContact O-N 3.09Å
37	K	80	Confident	76.5	Confident	202 Å²	202	150.5 Å²	150.5	88%	0.878	76%	0.759	S	S	*	*			trans	-57.8	116.6	167.6	-76.7	-178	177.1	179	0	107.3	N35 I39	N35-K37 PolarHBondContact O-N 3.14Å; K37-I39 PolarHBondContact O-N 3.38Å
38	K	75.4	Confident	77.4	Confident	203 Å²	203	151 Å²	151	88%	0.883	77%	0.769	S	S	*	*			trans	-67.3	106.9	174.2	-67.7	-179.1	-179.1	179.2	0	107.4	L36 P40	L36-K38 PolarHBondContact O-N 3.05Å; L36-K38 VanDerWaalsContact O-N 3.09Å; K38-P40 WeakPolarHBondContact O-CD 3.39Å
39	I	80.1	Confident	78.5	Confident	147 Å²	147	144.5 Å²	144.5	75%	0.754	75%	0.747	S	S	*	*			trans	-65	123.2	166.9	-57.8	176.1	0	0	0	105.8	K37 Q41	K37-I39 PolarHBondContact O-N 3.38Å; I39-Q41 PolarHBondContact O-N 3.02Å
40	P	78.9	Confident	79.3	Confident	116 Å²	116	145.6 Å²	145.6	75%	0.753	74%	0.744	S	S	*	*			trans	-61.1	114.9	174.5	23.1	-29.5	0	0	0	108	K38 Q42	K38-P40 WeakPolarHBondContact O-CD 3.39Å; P40-Q42 PolarHBondContact O-N 2.87Å; P40-Q42 VanDerWaalsContact O-N 3.08Å
41	Q	75.6	Confident	80.2	Confident	163 Å²	163	142.7 Å²	142.7	76%	0.762	74%	0.741	S	S	*	*			trans	-68.9	104.9	167.1	-69.4	-179.7	-35.4	0	0	106.1	I39 R43	I39-Q41 PolarHBondContact O-N 3.02Å; Q41-R43 PolarHBondContact O-N 3.38Å
42	Q	77	Confident	81.3	Confident	187 Å²	187	142.6 Å²	142.6	87%	0.874	74%	0.735	S	S	*	*			trans	-64.3	92.9	170.2	-170.4	-179.4	14.1	0	0	106.9	P40 H44	P40-Q42 PolarHBondContact O-N 2.87Å; P40-Q42 VanDerWaalsContact O-N 3.08Å; Q42-H44 PolarHBondContact O-N 3.17Å; Q42-H44 VanDerWaalsContact O-N 3.08Å
43	R	74.5	Confident	82	Confident	198 Å²	198	141 Å²	141	75%	0.747	72%	0.718	S	S	*	*			trans	-67.3	108.1	170.5	-72.4	-129.3	-159.2	-121.1	6.1	106.7	Q41 E45	Q41-R43 PolarHBondContact O-N 3.38Å; R43-E45 VanDerWaalsContact C-N 3.29Å; R43-E45 HydrophobicContact CB-CG 4.41Å; R43-E45 PolarHBondContact O-N 3.33Å; R43-E45 VanDerWaalsContact O-N 3.08Å
44	H	75.2	Confident	82.8	Confident	171 Å²	171	137.4 Å²	137.4	79%	0.792	70%	0.7	S	S	*	*			trans	-74.8	94.3	162.1	-164.7	74.8	0	0	0	106.5	Q42 S46	Q42-H44 PolarHBondContact O-N 3.17Å; Q42-H44 VanDerWaalsContact O-N 3.08Å; H44-S46 PolarHBondContact O-N 3.08Å; H44-S46 VanDerWaalsContact O-N 3.09Å
45	E	78.2	Confident	83.6	Confident	166 Å²	166	137.1 Å²	137.1	78%	0.776	70%	0.698	S	S	*	*			trans	-71.9	100	169.5	-68	-176.1	-172.4	0	0	107.1	R43	R43-E45 VanDerWaalsContact C-N 3.29Å; R43-E45 HydrophobicContact CB-CG 4.41Å; R43-E45 PolarHBondContact O-N 3.33Å; R43-E45 VanDerWaalsContact O-N 3.08Å
46	S	81.9	Confident	84.6	Confident	92 Å²	92	138.2 Å²	138.2	64%	0.643	69%	0.69	S	S	*	*	P	Polyproline II helix	trans	-66.8	141.2	164.6	52.5	0	0	0	0	108.3	H44	H44-S46 PolarHBondContact O-N 3.08Å; H44-S46 VanDerWaalsContact O-N 3.09Å
47	K	86.3	Confident	85.3	Confident	187 Å²	187	136.6 Å²	136.6	81%	0.813	68%	0.682	S	S	*	*	P	Polyproline II helix	trans	-60.1	131.4	172	-66.1	-178.8	-178.6	178.6	0	108	V49	K47-V49 PolarHBondContact O-N 2.99Å
48	P	86.4	Confident	85.9	Confident	131 Å²	131	133.4 Å²	133.4	85%	0.851	67%	0.672	S	S	*	*	P	Polyproline II helix	trans	-63.4	121.8	173.4	26.9	-32.6	0	0	0	108.1
49	V	91.3	Very high	86.6	Confident	79 Å²	79	127.7 Å²	127.7	48%	0.479	66%	0.662	S	S	.	*	P	Polyproline II helix	trans	-95.2	148.6	171.8	-64.6	0	0	0	0	109	K47 A54	K47-V49 PolarHBondContact O-N 2.99Å; V49-A54 HydrophobicContact CG2-CB 4.08Å
50	N	94.7	Very high	86.7	Confident	91 Å²	91	128 Å²	128	49%	0.487	66%	0.664	S	S	.	*	P	Polyproline II helix	trans	-77.9	167	174.3	68.9	67.1	0	0	0	110.7	D52 E53 A54	N50-D52 VanDerWaalsContact C-N 3.32Å; N50-D52 PolarHBondContact O-N 3.38Å; N50-D52 WeakPolarHBondContact OD1-CB 3.45Å; N50-D52 PolarHBondContact OD1-N 3.36Å; N50-E53 PolarHBondContact O-N 3.02Å; N50-E53 WeakPolarHBondContact OD1-CB 3.41Å; N50-E53 PolarHBondContact OD1-N 3.34Å; N50-A54 WeakPolarHBondContact O-CB 3.42Å; N50-A54 PolarHBondContact O-N 3.01Å
51	V	93.6	Very high	86.5	Confident	122 Å²	122	132 Å²	132	74%	0.739	68%	0.678	S	S	*	*	H	α-helix	trans	-63.5	-36.7	-174.9	179.3	0	0	0	0	112.5	T55	V51-T55 WeakPolarHBondContact O-CB 3.45Å; V51-T55 PolarHBondContact O-N 3.41Å; V51-T55 PolarHBondContact O-OG1 3.08Å
52	D	95.1	Very high	87	Confident	109 Å²	109	130.4 Å²	130.4	58%	0.583	67%	0.674	S	S	*	*	H	α-helix	trans	-66.8	-47.2	179.3	-174.8	80.3	0	0	0	110.9	N50 A54 T55 R56	N50-D52 VanDerWaalsContact C-N 3.32Å; N50-D52 PolarHBondContact O-N 3.38Å; N50-D52 WeakPolarHBondContact OD1-CB 3.45Å; N50-D52 PolarHBondContact OD1-N 3.36Å; D52-A54 PolarHBondContact O-N 3.45Å; D52-T55 WeakPolarHBondContact O-CB 3.28Å; D52-T55 PolarHBondContact O-N 3.01Å; D52-T55 VanDerWaalsContact O-N 3.14Å; D52-R56 WeakPolarHBondContact O-CG 3.47Å; D52-R56 PolarHBondContact O-N 3.39Å
53	E	92.9	Very high	87.5	Confident	95 Å²	95	127.4 Å²	127.4	44%	0.444	66%	0.664	S	S	.	*	H	α-helix	trans	-63.8	-40.6	178.1	-166	170.6	-142.4	0	0	111.7	N50 T55 R56 L57	N50-E53 PolarHBondContact O-N 3.02Å; N50-E53 WeakPolarHBondContact OD1-CB 3.41Å; N50-E53 PolarHBondContact OD1-N 3.34Å; E53-T55 VanDerWaalsContact C-N 3.32Å; E53-T55 PolarHBondContact O-N 3.09Å; E53-R56 PolarHBondContact O-N 3.08Å; E53-L57 WeakPolarHBondContact O-CG 3.44Å; E53-L57 PolarHBondContact O-N 3.03Å
54	A	92.9	Very high	88.3	Confident	36 Å²	36	123.5 Å²	123.5	30%	0.298	66%	0.659	S	S	.	*	H	α-helix	trans	-60.8	-41.4	173.1	0	0	0	0	0	112.1	V49 N50 D52 L57 M58	V49-A54 HydrophobicContact CG2-CB 4.08Å; N50-A54 WeakPolarHBondContact O-CB 3.42Å; N50-A54 PolarHBondContact O-N 3.01Å; D52-A54 PolarHBondContact O-N 3.45Å; A54-L57 PolarHBondContact O-N 3.06Å; A54-M58 VanDerWaalsContact O-CG 3.28Å; A54-M58 WeakPolarHBondContact O-CG 3.37Å; A54-M58 PolarHBondContact O-N 3.09Å
55	T	94.7	Very high	89	Confident	87 Å²	87	120.7 Å²	120.7	53%	0.534	65%	0.651	S	S	.	*	H	α-helix	trans	-66	-41.1	178.9	-55.7	0	0	0	0	111.2	V51 D52 E53 M58 A59	V51-T55 WeakPolarHBondContact O-CB 3.45Å; V51-T55 PolarHBondContact O-N 3.41Å; V51-T55 PolarHBondContact O-OG1 3.08Å; D52-T55 WeakPolarHBondContact O-CB 3.28Å; D52-T55 PolarHBondContact O-N 3.01Å; D52-T55 VanDerWaalsContact O-N 3.14Å; E53-T55 VanDerWaalsContact C-N 3.32Å; E53-T55 PolarHBondContact O-N 3.09Å; T55-M58 PolarHBondContact O-N 3.3Å; T55-A59 WeakPolarHBondContact O-CB 3.46Å; T55-A59 PolarHBondContact O-N 2.79Å
56	R	95.1	Very high	89.7	Confident	184 Å²	184	117.9 Å²	117.9	69%	0.694	64%	0.644	S	S	*	*	H	α-helix	trans	-64.7	-40.1	176.3	-68.1	179.3	73.6	-168.5	2.6	112.5	D52 E53 A59 L60	D52-R56 WeakPolarHBondContact O-CG 3.47Å; D52-R56 PolarHBondContact O-N 3.39Å; E53-R56 PolarHBondContact O-N 3.08Å; R56-A59 PolarHBondContact O-N 2.82Å; R56-L60 PolarHBondContact O-N 3.08Å
57	L	91.8	Very high	90.2	Very high	102 Å²	102	119.6 Å²	119.6	53%	0.534	64%	0.644	S	S	.	*	H	α-helix	trans	-65.7	-40.8	175.8	-71.2	174.8	0	0	0	111.9	E53 A54 A59 L60	E53-L57 WeakPolarHBondContact O-CG 3.44Å; E53-L57 PolarHBondContact O-N 3.03Å; A54-L57 PolarHBondContact O-N 3.06Å; L57-A59 VanDerWaalsContact C-N 3.3Å; L57-A59 PolarHBondContact O-N 3.33Å; L57-L60 PolarHBondContact O-N 3.47Å
58	M	91.4	Very high	90.5	Very high	136 Å²	136	114.8 Å²	114.8	67%	0.67	63%	0.631	S	S	*	*	H	α-helix	trans	-65.5	-33.1	176	-73.3	-69.7	-66	0	0	112.8	A54 T55 L60 L61	A54-M58 VanDerWaalsContact O-CG 3.28Å; A54-M58 WeakPolarHBondContact O-CG 3.37Å; A54-M58 PolarHBondContact O-N 3.09Å; T55-M58 PolarHBondContact O-N 3.3Å; M58-L60 VanDerWaalsContact C-N 3.27Å; M58-L60 PolarHBondContact O-N 3.45Å; M58-L61 HydrophobicContact SD-CD1 4.4Å
59	A	90.1	Very high	90.8	Very high	83 Å²	83	113.5 Å²	113.5	69%	0.686	62%	0.615	S	S	*	*	T	Hydrogen-bonded Turn	trans	-75.8	-12.9	179.2	0	0	0	0	0	114.1	T55 R56 L57	T55-A59 WeakPolarHBondContact O-CB 3.46Å; T55-A59 PolarHBondContact O-N 2.79Å; R56-A59 PolarHBondContact O-N 2.82Å; L57-A59 VanDerWaalsContact C-N 3.3Å; L57-A59 PolarHBondContact O-N 3.33Å
60	L	83.9	Confident	90.8	Very high	152 Å²	152	116.4 Å²	116.4	80%	0.796	63%	0.626	S	S	*	*	T	Hydrogen-bonded Turn	trans	-91.6	-5.7	178.2	-166.9	64.8	0	0	0	112.9	R56 L57 M58	R56-L60 PolarHBondContact O-N 3.08Å; L57-L60 PolarHBondContact O-N 3.47Å; M58-L60 VanDerWaalsContact C-N 3.27Å; M58-L60 PolarHBondContact O-N 3.45Å
61	L	73.1	Confident	90.4	Very high	200 Å²	200	118.7 Å²	118.7	100%	1.047	64%	0.639	S	S	*	*			trans	-89.5	0	175.6	-66.6	172.2	0	0	0	111	M58	M58-L61 HydrophobicContact SD-CD1 4.4Å

Retrieved 61 of 61 residues in 80 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).