A0A087WWI1_HUMAN Loading...

Ribonuclease T2

AlphaFold DB , UniProt , Accession A0A087WWI1, Species HUMAN (Homo sapiens, Human), Gene RNASET2, Length 51 aa.

						>A0A087WWI1_HUMAN|A0A087WWI1|RNASET2
MRPAALRGALLGCLCLALLCLGGADKRLRDNHEWKKLIMVQHWPETVCEAR
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	54.5	Low	77.5	Confident	237 Å²	237	118.3 Å²	118.3	100%	1.167	65%	0.646	S	S	*	*				0	119.4	0	-69.4	171.2	175.7	0	0	108.1	P3	M1-P3 VanDerWaalsContact O-CD 3.3Å; M1-P3 WeakPolarHBondContact O-CD 3.2Å
2	R	67.9	Low	78.5	Confident	219 Å²	219	111.3 Å²	111.3	83%	0.826	62%	0.621	S	S	*	*			trans	-77.1	114.3	-170.8	-81.2	-179.4	166.6	174.9	-4.6	110.5	A4 A5	R2-A4 PolarHBondContact O-N 3.49Å; R2-A4 VanDerWaalsContact O-N 3.14Å; R2-A5 PolarHBondContact O-N 3.33Å; R2-A5 VanDerWaalsContact O-N 3.14Å
3	P	66.6	Low	79.4	Confident	90 Å²	90	109.2 Å²	109.2	58%	0.584	62%	0.617	S	S	*	*	H	α-helix	trans	-60.3	-28.2	-176.3	-20	30.5	0	0	0	113.3	M1 L6 R7	M1-P3 VanDerWaalsContact O-CD 3.3Å; M1-P3 WeakPolarHBondContact O-CD 3.2Å; P3-L6 PolarHBondContact O-N 3.38Å; P3-R7 WeakPolarHBondContact O-CG 3.5Å; P3-R7 PolarHBondContact O-N 2.85Å; P3-R7 VanDerWaalsContact O-N 3.07Å
4	A	71.6	Confident	80.2	Confident	75 Å²	75	108.9 Å²	108.9	62%	0.62	61%	0.612	S	S	*	*	H	α-helix	trans	-65.7	-37.3	178.8	0	0	0	0	0	113.3	R2 R7 G8	R2-A4 PolarHBondContact O-N 3.49Å; R2-A4 VanDerWaalsContact O-N 3.14Å; A4-R7 PolarHBondContact O-N 3.36Å; A4-G8 PolarHBondContact O-N 3.41Å
5	A	74.2	Confident	80.7	Confident	70 Å²	70	106.5 Å²	106.5	58%	0.579	60%	0.604	S	S	*	*	H	α-helix	trans	-68.9	-38.5	178.4	0	0	0	0	0	111.3	R2 G8 A9	R2-A5 PolarHBondContact O-N 3.33Å; R2-A5 VanDerWaalsContact O-N 3.14Å; A5-G8 PolarHBondContact O-N 2.93Å; A5-A9 WeakPolarHBondContact O-CB 3.42Å; A5-A9 PolarHBondContact O-N 3.39Å
6	L	79.8	Confident	81.1	Confident	119 Å²	119	106.7 Å²	106.7	62%	0.623	60%	0.603	S	S	*	*	H	α-helix	trans	-65.4	-42.7	175.8	-167.5	79.8	0	0	0	111.5	P3 A9 L10	P3-L6 PolarHBondContact O-N 3.38Å; L6-A9 PolarHBondContact O-N 3.24Å; L6-L10 HydrophobicContact CG-CD1 4.21Å; L6-L10 WeakPolarHBondContact O-CB 3.09Å; L6-L10 WeakPolarHBondContact O-CG 3.16Å; L6-L10 PolarHBondContact O-N 2.78Å
7	R	83.6	Confident	81.5	Confident	178 Å²	178	103.3 Å²	103.3	67%	0.672	59%	0.591	S	S	*	*	H	α-helix	trans	-63.6	-42.7	175.9	-74.1	175	175.5	-179.9	-1.9	112	P3 A4 L10 L11	P3-R7 WeakPolarHBondContact O-CG 3.5Å; P3-R7 PolarHBondContact O-N 2.85Å; P3-R7 VanDerWaalsContact O-N 3.07Å; A4-R7 PolarHBondContact O-N 3.36Å; R7-L10 PolarHBondContact O-N 3.46Å; R7-L11 WeakPolarHBondContact O-CB 3.44Å; R7-L11 VanDerWaalsContact O-CG 3.32Å; R7-L11 WeakPolarHBondContact O-CG 3.13Å; R7-L11 PolarHBondContact O-N 3.09Å
8	G	86.8	Confident	81.8	Confident	43 Å²	43	104.3 Å²	104.3	44%	0.443	59%	0.594	S	S	.	*	H	α-helix	trans	-61.8	-43.7	175.2	0	0	0	0	0	112.5	A4 A5 L11 G12	A4-G8 PolarHBondContact O-N 3.41Å; A5-G8 PolarHBondContact O-N 2.93Å; G8-L11 PolarHBondContact O-N 2.7Å; G8-G12 PolarHBondContact O-N 3.32Å
9	A	88.1	Confident	81.8	Confident	58 Å²	58	105.6 Å²	105.6	48%	0.479	60%	0.598	S	S	.	*	H	α-helix	trans	-63.9	-44.7	176.5	0	0	0	0	0	112.3	A5 L6 L11 G12 C13	A5-A9 WeakPolarHBondContact O-CB 3.42Å; A5-A9 PolarHBondContact O-N 3.39Å; L6-A9 PolarHBondContact O-N 3.24Å; A9-L11 PolarHBondContact O-N 2.99Å; A9-G12 PolarHBondContact O-N 3.2Å; A9-C13 WeakPolarHBondContact O-CB 3.33Å; A9-C13 PolarHBondContact O-N 3Å; A9-C13 PolarHBondContact O-SG 2.89Å
10	L	89.3	Confident	81.7	Confident	100 Å²	100	104.7 Å²	104.7	52%	0.524	60%	0.597	S	S	.	*	H	α-helix	trans	-61	-44.3	176.7	-79.7	162.5	0	0	0	112.1	L6 R7 C13 L14	L6-L10 HydrophobicContact CG-CD1 4.21Å; L6-L10 WeakPolarHBondContact O-CB 3.09Å; L6-L10 WeakPolarHBondContact O-CG 3.16Å; L6-L10 PolarHBondContact O-N 2.78Å; R7-L10 PolarHBondContact O-N 3.46Å; L10-C13 PolarHBondContact O-N 3.28Å; L10-L14 WeakPolarHBondContact O-CB 3.38Å; L10-L14 PolarHBondContact O-N 3.12Å
11	L	90	Very high	81.5	Confident	112 Å²	112	105.8 Å²	105.8	59%	0.586	60%	0.601	S	S	*	*	H	α-helix	trans	-64.1	-42.8	176.2	-74.3	167.4	0	0	0	111.6	R7 G8 A9 L14 C15	R7-L11 WeakPolarHBondContact O-CB 3.44Å; R7-L11 VanDerWaalsContact O-CG 3.32Å; R7-L11 WeakPolarHBondContact O-CG 3.13Å; R7-L11 PolarHBondContact O-N 3.09Å; G8-L11 PolarHBondContact O-N 2.7Å; A9-L11 PolarHBondContact O-N 2.99Å; L11-L14 PolarHBondContact O-N 2.78Å; L11-C15 PolarHBondContact O-N 3.39Å; L11-C15 PolarHBondContact O-SG 3.49Å
12	G	90.3	Very high	82.5	Confident	34 Å²	34	96.4 Å²	96.4	35%	0.351	57%	0.565	S	S	.	*	H	α-helix	trans	-60.2	-45.4	175.2	0	0	0	0	0	112.5	G8 A9 C15 L16	G8-G12 PolarHBondContact O-N 3.32Å; A9-G12 PolarHBondContact O-N 3.2Å; G12-C15 PolarHBondContact O-N 2.81Å; G12-L16 WeakPolarHBondContact O-CG 3.39Å; G12-L16 PolarHBondContact O-N 3.16Å
13	C	90.1	Very high	82.4	Confident	84 Å²	84	87.6 Å²	87.6	57%	0.568	54%	0.542	S	S	*	.	H	α-helix	trans	-61.6	-43.1	175.6	-70.9	0	0	0	0	112.2	A9 L10 L16 A17	A9-C13 WeakPolarHBondContact O-CB 3.33Å; A9-C13 PolarHBondContact O-N 3Å; A9-C13 PolarHBondContact O-SG 2.89Å; L10-C13 PolarHBondContact O-N 3.28Å; C13-L16 PolarHBondContact O-N 3.42Å; C13-A17 WeakPolarHBondContact O-CB 3.49Å; C13-A17 PolarHBondContact O-N 2.92Å
14	L	89.7	Confident	82.2	Confident	105 Å²	105	85.9 Å²	85.9	55%	0.55	54%	0.536	S	S	.	.	H	α-helix	trans	-62.1	-45.3	176.1	-85.1	157.8	0	0	0	111.8	L10 L11 L16 A17 L18	L10-L14 WeakPolarHBondContact O-CB 3.38Å; L10-L14 PolarHBondContact O-N 3.12Å; L11-L14 PolarHBondContact O-N 2.78Å; L14-L16 PolarHBondContact O-N 2.91Å; L14-A17 PolarHBondContact O-N 3.44Å; L14-L18 VanDerWaalsContact O-CG 3.3Å; L14-L18 WeakPolarHBondContact O-CG 3.3Å; L14-L18 PolarHBondContact O-N 3.4Å
15	C	87.8	Confident	81.8	Confident	73 Å²	73	87.6 Å²	87.6	49%	0.493	53%	0.534	S	S	.	.	H	α-helix	trans	-61.3	-44.2	176.7	-70.6	0	0	0	0	112	L11 G12 L18 L19	L11-C15 PolarHBondContact O-N 3.39Å; L11-C15 PolarHBondContact O-SG 3.49Å; G12-C15 PolarHBondContact O-N 2.81Å; C15-L18 PolarHBondContact O-N 2.93Å; C15-L19 WeakPolarHBondContact O-CG 3.44Å; C15-L19 PolarHBondContact O-N 3.25Å
16	L	87.7	Confident	81.1	Confident	110 Å²	110	92.5 Å²	92.5	58%	0.576	54%	0.542	S	S	*	.	H	α-helix	trans	-62.6	-44.9	176.5	-74.1	169.5	0	0	0	111.7	G12 C13 L14 L18 L19 C20	G12-L16 WeakPolarHBondContact O-CG 3.39Å; G12-L16 PolarHBondContact O-N 3.16Å; C13-L16 PolarHBondContact O-N 3.42Å; L14-L16 PolarHBondContact O-N 2.91Å; L16-L18 VanDerWaalsContact C-N 3.31Å; L16-L18 PolarHBondContact O-N 3.47Å; L16-L19 PolarHBondContact O-N 3.14Å; L16-C20 WeakPolarHBondContact O-CB 3.4Å; L16-C20 PolarHBondContact O-N 3.28Å; L16-C20 PolarHBondContact O-SG 2.91Å
17	A	88.4	Confident	80.1	Confident	49 Å²	49	97.3 Å²	97.3	41%	0.405	55%	0.552	S	S	.	*	H	α-helix	trans	-59.8	-41.7	177.7	0	0	0	0	0	112.1	C13 L14 C20 L21	C13-A17 WeakPolarHBondContact O-CB 3.49Å; C13-A17 PolarHBondContact O-N 2.92Å; L14-A17 PolarHBondContact O-N 3.44Å; A17-C20 PolarHBondContact O-N 3.42Å; A17-L21 WeakPolarHBondContact O-CD1 3.41Å; A17-L21 PolarHBondContact O-N 2.98Å
18	L	86	Confident	78.9	Confident	122 Å²	122	96.1 Å²	96.1	64%	0.639	56%	0.558	S	S	*	*	H	α-helix	trans	-66.6	-40.6	176.9	-70.2	169.7	0	0	0	112.5	L14 C15 L16 L21 G22	L14-L18 VanDerWaalsContact O-CG 3.3Å; L14-L18 WeakPolarHBondContact O-CG 3.3Å; L14-L18 PolarHBondContact O-N 3.4Å; C15-L18 PolarHBondContact O-N 2.93Å; L16-L18 VanDerWaalsContact C-N 3.31Å; L16-L18 PolarHBondContact O-N 3.47Å; L18-L21 PolarHBondContact O-N 3.36Å; L18-G22 PolarHBondContact O-N 3.49Å
19	L	82.7	Confident	77.6	Confident	128 Å²	128	102.7 Å²	102.7	67%	0.67	57%	0.57	S	S	*	*	H	α-helix	trans	-64.2	-41.7	174.7	-72.1	170.5	0	0	0	111.6	C15 L16 G23	C15-L19 WeakPolarHBondContact O-CG 3.44Å; C15-L19 PolarHBondContact O-N 3.25Å; L16-L19 PolarHBondContact O-N 3.14Å; L19-G23 PolarHBondContact O-N 2.96Å
20	C	79	Confident	76.4	Confident	87 Å²	87	104.5 Å²	104.5	59%	0.588	57%	0.572	S	S	*	*	H	α-helix	trans	-63.5	-44.8	175.5	-71.4	0	0	0	0	112	L16 A17 A24	L16-C20 WeakPolarHBondContact O-CB 3.4Å; L16-C20 PolarHBondContact O-N 3.28Å; L16-C20 PolarHBondContact O-SG 2.91Å; A17-C20 PolarHBondContact O-N 3.42Å; C20-A24 WeakPolarHBondContact O-CB 3.45Å; C20-A24 PolarHBondContact O-N 2.92Å
21	L	78.5	Confident	75.1	Confident	129 Å²	129	106.2 Å²	106.2	68%	0.675	58%	0.581	S	S	*	*	H	α-helix	trans	-63.6	-48.2	176.7	-104.4	89.1	0	0	0	112.1	A17 L18 G23 A24 D25	A17-L21 WeakPolarHBondContact O-CD1 3.41Å; A17-L21 PolarHBondContact O-N 2.98Å; L18-L21 PolarHBondContact O-N 3.36Å; L21-G23 VanDerWaalsContact C-N 3.35Å; L21-G23 PolarHBondContact O-N 3.35Å; L21-A24 PolarHBondContact O-N 3.02Å; L21-D25 PolarHBondContact O-N 2.92Å; L21-D25 VanDerWaalsContact O-N 3.14Å
22	G	73.6	Confident	73.8	Confident	40 Å²	40	106.9 Å²	106.9	41%	0.412	58%	0.581	S	S	.	*	H	α-helix	trans	-70.2	-29.8	-177.8	0	0	0	0	0	113.9	L18	L18-G22 PolarHBondContact O-N 3.49Å
23	G	66.9	Low	72.9	Confident	34 Å²	34	114 Å²	114	35%	0.351	61%	0.605	S	S	.	*	H	α-helix	trans	-78.3	-35.7	174	0	0	0	0	0	113.2	L19 L21 R27	L19-G23 PolarHBondContact O-N 2.96Å; L21-G23 VanDerWaalsContact C-N 3.35Å; L21-G23 PolarHBondContact O-N 3.35Å; G23-R27 WeakPolarHBondContact O-CB 3.32Å; G23-R27 WeakPolarHBondContact O-CG 3.43Å; G23-R27 PolarHBondContact O-N 3.41Å; G23-R27 VanDerWaalsContact O-N 3.16Å
24	A	62.4	Low	72	Confident	54 Å²	54	119.7 Å²	119.7	45%	0.446	62%	0.615	S	S	.	*	H	α-helix	trans	-63.8	-48.2	175.5	0	0	0	0	0	110.8	C20 L21 K26 R27 L28	C20-A24 WeakPolarHBondContact O-CB 3.45Å; C20-A24 PolarHBondContact O-N 2.92Å; L21-A24 PolarHBondContact O-N 3.02Å; A24-K26 VanDerWaalsContact C-N 3.35Å; A24-K26 PolarHBondContact O-N 3.39Å; A24-R27 PolarHBondContact O-N 3.01Å; A24-L28 WeakPolarHBondContact O-CB 3.46Å; A24-L28 PolarHBondContact O-N 3.38Å
25	D	62.7	Low	71.3	Confident	110 Å²	110	124.8 Å²	124.8	59%	0.588	63%	0.632	S	S	*	*	H	α-helix	trans	-59.5	-42.5	-177.5	-167.8	-97.9	0	0	0	113	L21 L28 R29	L21-D25 PolarHBondContact O-N 2.92Å; L21-D25 VanDerWaalsContact O-N 3.14Å; D25-L28 PolarHBondContact O-N 2.94Å; D25-R29 PolarHBondContact O-N 2.97Å
26	K	60.5	Low	70.9	Confident	173 Å²	173	129.1 Å²	129.1	75%	0.752	64%	0.643	S	S	*	*	H	α-helix	trans	-73.8	-28.2	178.9	-75.5	177.9	177.9	169.7	0	114.2	A24	A24-K26 VanDerWaalsContact C-N 3.35Å; A24-K26 PolarHBondContact O-N 3.39Å
27	R	58	Low	70.6	Confident	221 Å²	221	132 Å²	132	83%	0.834	66%	0.658	S	S	*	*	H	α-helix	trans	-87.8	-21	175.3	-74	-175.6	167	-168.1	-3	112.9	G23 A24	G23-R27 WeakPolarHBondContact O-CB 3.32Å; G23-R27 WeakPolarHBondContact O-CG 3.43Å; G23-R27 PolarHBondContact O-N 3.41Å; G23-R27 VanDerWaalsContact O-N 3.16Å; A24-R27 PolarHBondContact O-N 3.01Å
28	L	57.6	Low	70.4	Confident	152 Å²	152	135.3 Å²	135.3	80%	0.796	67%	0.668	S	S	*	*	H	α-helix	trans	-88.1	-21.6	176.2	-147.4	92	0	0	0	112.3	A24 D25 D30	A24-L28 WeakPolarHBondContact O-CB 3.46Å; A24-L28 PolarHBondContact O-N 3.38Å; D25-L28 PolarHBondContact O-N 2.94Å; L28-D30 PolarHBondContact O-N 3.45Å
29	R	60.3	Low	70.1	Confident	181 Å²	181	137 Å²	137	68%	0.683	67%	0.674	S	S	*	*	S	Bend	trans	-70.9	61.4	155.5	-77.4	-173.5	71.5	-164.6	2	109.3	D25 N31	D25-R29 PolarHBondContact O-N 2.97Å; R29-N31 PolarHBondContact O-N 3.43Å
30	D	63	Low	70	Confident	97 Å²	97	135.3 Å²	135.3	52%	0.519	67%	0.669	S	S	.	*			trans	-65.3	104.2	169.5	-166	-21.5	0	0	0	104.8	L28 H32	L28-D30 PolarHBondContact O-N 3.45Å; D30-H32 WeakPolarHBondContact CB-CE1 3.37Å; D30-H32 WeakPolarHBondContact CB-ND1 3.3Å; D30-H32 PolarHBondContact O-N 2.96Å; D30-H32 PolarHBondContact O-ND1 3.44Å; D30-H32 VanDerWaalsContact O-ND1 3.09Å; D30-H32 IonicContact OD1-CE1 3.41Å; D30-H32 PolarHBondContact OD1-CE1 3.29Å; D30-H32 IonicContact OD1-CG 3.75Å; D30-H32 IonicContact OD1-ND1 3.12Å; D30-H32 PolarHBondContact OD1-ND1 3.3Å; D30-H32 VanDerWaalsContact OD1-ND1 3.12Å; D30-H32 IonicContact OD2-CE1 2.85Å; D30-H32 PolarHBondContact OD2-CE1 3.3Å; D30-H32 IonicContact OD2-ND1 3.46Å; D30-H32 PolarHBondContact OD2-ND1 2.91Å; D30-H32 IonicContact OD2-NE2 3.57Å
31	N	62.7	Low	69.8	Low	136 Å²	136	139 Å²	139	73%	0.727	68%	0.678	S	S	*	*			trans	-65.5	68.6	172.4	-78.3	-41.4	0	0	0	106.9	R29 E33	R29-N31 PolarHBondContact O-N 3.43Å; N31-E33 PolarHBondContact O-N 3.48Å
32	H	61.9	Low	69.6	Low	125 Å²	125	139.8 Å²	139.8	58%	0.579	68%	0.678	S	S	*	*			trans	-66	89.9	179.2	-79.7	76.4	0	0	0	107.1	D30 W34	D30-H32 WeakPolarHBondContact CB-CE1 3.37Å; D30-H32 WeakPolarHBondContact CB-ND1 3.3Å; D30-H32 PolarHBondContact O-N 2.96Å; D30-H32 PolarHBondContact O-ND1 3.44Å; D30-H32 VanDerWaalsContact O-ND1 3.09Å; D30-H32 IonicContact OD1-CE1 3.41Å; D30-H32 PolarHBondContact OD1-CE1 3.29Å; D30-H32 IonicContact OD1-CG 3.75Å; D30-H32 IonicContact OD1-ND1 3.12Å; D30-H32 PolarHBondContact OD1-ND1 3.3Å; D30-H32 VanDerWaalsContact OD1-ND1 3.12Å; D30-H32 IonicContact OD2-CE1 2.85Å; D30-H32 PolarHBondContact OD2-CE1 3.3Å; D30-H32 IonicContact OD2-ND1 3.46Å; D30-H32 PolarHBondContact OD2-ND1 2.91Å; D30-H32 IonicContact OD2-NE2 3.57Å; H32-W34 PolarHBondContact O-N 3.45Å
33	E	71	Confident	69.4	Low	183 Å²	183	146.4 Å²	146.4	86%	0.855	69%	0.69	S	S	*	*			trans	-58.2	-23.1	160.9	-62.8	-171.6	158.5	0	0	110.1	N31 K35	N31-E33 PolarHBondContact O-N 3.48Å; E33-K35 PolarHBondContact O-N 2.98Å
34	W	71.5	Confident	69.3	Low	205 Å²	205	148.7 Å²	148.7	78%	0.777	70%	0.699	S	S	*	*			trans	-83.6	103.6	176.3	-54.9	98.3	0	0	0	111.4	H32	H32-W34 PolarHBondContact O-N 3.45Å
35	K	74.9	Confident	69.3	Low	211 Å²	211	153.2 Å²	153.2	92%	0.917	71%	0.711	S	S	*	*			trans	-78.3	-19.7	178.3	-169.5	172	-178.7	177	0	113.9	E33	E33-K35 PolarHBondContact O-N 2.98Å
36	K	80.3	Confident	69.1	Low	165 Å²	165	153.7 Å²	153.7	72%	0.717	72%	0.718	S	S	*	*			trans	-157.3	130.6	-174.1	-161.8	175.9	-165.6	-179.7	0	111.4	I38	K36-I38 HydrophobicContact CD-CD1 4.44Å; K36-I38 HydrophobicContact CD-CG1 4.17Å; K36-I38 HydrophobicContact CG-CG1 4.18Å
37	L	80.3	Confident	69.1	Low	169 Å²	169	149.9 Å²	149.9	89%	0.885	71%	0.709	S	S	*	*			trans	-95.3	123.7	165.1	-171.5	72.8	0	0	0	108
38	I	84.3	Confident	69.2	Low	120 Å²	120	144.5 Å²	144.5	62%	0.615	70%	0.704	S	S	*	*			trans	-107.8	110.5	175.6	-55.6	177.1	0	0	0	107.4	K36 V40	K36-I38 HydrophobicContact CD-CD1 4.44Å; K36-I38 HydrophobicContact CD-CG1 4.17Å; K36-I38 HydrophobicContact CG-CG1 4.18Å; I38-V40 HydrophobicContact CG2-CG2 3.85Å; I38-V40 PolarHBondContact O-N 2.97Å
39	M	80.9	Confident	69.4	Low	156 Å²	156	145.8 Å²	145.8	77%	0.768	71%	0.706	S	S	*	*			trans	-80.7	109.4	171.2	-172.5	171.2	68	0	0	108.3
40	V	80.4	Confident	69.5	Low	94 Å²	94	142 Å²	142	57%	0.57	71%	0.714	S	S	*	*	P	Polyproline II helix	trans	-100.1	119.7	177.1	-179.3	0	0	0	0	108.8	I38	I38-V40 HydrophobicContact CG2-CG2 3.85Å; I38-V40 PolarHBondContact O-N 2.97Å
41	Q	74.8	Confident	69	Low	164 Å²	164	152.3 Å²	152.3	77%	0.766	75%	0.745	S	S	*	*	P	Polyproline II helix	trans	-102.5	123.3	166.1	-67.1	-174.4	48.2	0	0	107.8
42	H	72.7	Confident	69.3	Low	146 Å²	146	153.1 Å²	153.1	68%	0.676	75%	0.746	S	S	*	*	P	Polyproline II helix	trans	-84.3	130.5	177.6	-63.6	88.8	0	0	0	109.4
43	W	70	Confident	69.7	Low	179 Å²	179	154.6 Å²	154.6	68%	0.678	76%	0.755	S	S	*	*	P	Polyproline II helix	trans	-82	128.4	166.6	-168.6	-102.8	0	0	0	108.6	E45	W43-E45 PolarHBondContact NE1-OE2 3.14Å; W43-E45 PolarHBondContact O-N 3.14Å
44	P	65.6	Low	69.7	Low	82 Å²	82	153 Å²	153	53%	0.532	75%	0.749	S	S	.	*	G	3₁₀ helix	trans	-68.9	-27.7	-167.9	23.1	-31.8	0	0	0	114.4	T46 C48	P44-T46 PolarHBondContact O-N 3.43Å; P44-C48 PolarHBondContact O-SG 3.07Å
45	E	62.7	Low	69.5	Low	148 Å²	148	149.9 Å²	149.9	69%	0.692	75%	0.748	S	S	*	*	G	3₁₀ helix	trans	-71.1	-26.4	-167.2	-72.3	174	154.7	0	0	114.8	W43	W43-E45 PolarHBondContact NE1-OE2 3.14Å; W43-E45 PolarHBondContact O-N 3.14Å
46	T	58.7	Low	69.2	Low	120 Å²	120	146.1 Å²	146.1	74%	0.736	74%	0.737	S	S	*	*	G	3₁₀ helix	trans	-101.3	-2.9	-175.6	56.6	0	0	0	0	114.4	P44	P44-T46 PolarHBondContact O-N 3.43Å
47	V	59.6	Low	68.5	Low	93 Å²	93	144.9 Å²	144.9	56%	0.564	74%	0.738	S	S	*	*	T	Hydrogen-bonded Turn	trans	-103.5	-20.1	-178.4	-172.5	0	0	0	0	111.8
48	C	60.9	Low	67.6	Low	108 Å²	108	143.1 Å²	143.1	73%	0.73	73%	0.728	S	S	*	*	S	Bend	trans	-86.4	-7.9	-175.7	-68.2	0	0	0	0	115.3	P44	P44-C48 PolarHBondContact O-SG 3.07Å
49	E	61.2	Low	66.3	Low	179 Å²	179	144.9 Å²	144.9	84%	0.836	74%	0.737	S	S	*	*			trans	-118	66.8	175.9	-67.8	-164.5	167.2	0	0	111.8
50	A	62.4	Low	65.1	Low	103 Å²	103	144 Å²	144	85%	0.851	73%	0.734	S	S	*	*			trans	-100	78.7	153.5	0	0	0	0	0	107.4
51	R	52.5	Low	63.7	Low	312 Å²	312	148.5 Å²	148.5	100%	1.177	75%	0.749	S	S	*	*			trans	-130.9	0	169.4	-153.2	-177.8	-162	-137	3.1	110.8

Retrieved 51 of 51 residues in 26.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).