A0A087WWL4_HUMAN Loading...

Signal peptide peptidase like 2B

AlphaFold DB , UniProt , Accession A0A087WWL4, Species HUMAN (Homo sapiens, Human), Gene SPPL2B, Length 81 aa.

						>A0A087WWL4_HUMAN|A0A087WWL4|SPPL2B
MAAAVAAALARLLAAFLLLAAQVACEYGMVHVVSQAGGPEGKDYCILYNPQWAHLPHDLSKAMPGRGGAAVGTHLVLLSDL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	60.8	Low	75.1	Confident	205 Å²	205	89.7 Å²	89.7	100%	1.01	57%	0.566	S	S	*	*				0	-53	0	-145.7	165.4	-78.4	0	0	111.7	A3 A4 V5	M1-A3 PolarHBondContact O-N 3.5Å; M1-A4 PolarHBondContact O-N 3.28Å; M1-V5 WeakPolarHBondContact O-CG2 3.28Å; M1-V5 PolarHBondContact O-N 2.64Å
2	A	66.6	Low	75.7	Confident	84 Å²	84	92.3 Å²	92.3	69%	0.694	57%	0.571	S	S	*	*	H	α-helix	trans	-55.2	-43.5	178.4	0	0	0	0	0	115.1	A4 V5 A6	A2-A4 PolarHBondContact O-N 3.07Å; A2-V5 PolarHBondContact O-N 2.89Å; A2-A6 PolarHBondContact O-N 2.76Å
3	A	69.4	Low	76	Confident	82 Å²	82	93.8 Å²	93.8	68%	0.678	57%	0.573	S	S	*	*	H	α-helix	trans	-64.7	-36.9	179	0	0	0	0	0	113.5	M1 A6 A7	M1-A3 PolarHBondContact O-N 3.5Å; A3-A6 PolarHBondContact O-N 3.19Å; A3-A7 PolarHBondContact O-N 3.1Å
4	A	73.9	Confident	75.9	Confident	67 Å²	67	89.9 Å²	89.9	55%	0.554	55%	0.554	S	S	*	*	H	α-helix	trans	-69.1	-36.7	177.6	0	0	0	0	0	111.8	M1 A2 A7 A8	M1-A4 PolarHBondContact O-N 3.28Å; A2-A4 PolarHBondContact O-N 3.07Å; A4-A7 PolarHBondContact O-N 3.34Å; A4-A8 WeakPolarHBondContact O-CB 3.21Å; A4-A8 PolarHBondContact O-N 2.84Å
5	V	81.5	Confident	75.8	Confident	82 Å²	82	87.6 Å²	87.6	50%	0.497	55%	0.548	S	S	.	.	H	α-helix	trans	-66.2	-43.9	174.8	176.9	0	0	0	0	110.5	M1 A2 A7 A8 L9	M1-V5 WeakPolarHBondContact O-CG2 3.28Å; M1-V5 PolarHBondContact O-N 2.64Å; A2-V5 PolarHBondContact O-N 2.89Å; V5-A7 PolarHBondContact O-N 3.44Å; V5-A8 PolarHBondContact O-N 3.34Å; V5-L9 HydrophobicContact CG1-CD1 4.1Å; V5-L9 HydrophobicContact CG1-CG 4.5Å; V5-L9 WeakPolarHBondContact O-CG 3.46Å; V5-L9 PolarHBondContact O-N 2.66Å
6	A	77.4	Confident	75.8	Confident	57 Å²	57	91.1 Å²	91.1	47%	0.471	55%	0.553	S	S	.	*	H	α-helix	trans	-60.5	-43.8	176.2	0	0	0	0	0	112.2	A2 A3 A8 L9 A10	A2-A6 PolarHBondContact O-N 2.76Å; A3-A6 PolarHBondContact O-N 3.19Å; A6-A8 PolarHBondContact O-N 3.16Å; A6-L9 PolarHBondContact O-N 3.45Å; A6-A10 WeakPolarHBondContact O-CB 3.47Å; A6-A10 PolarHBondContact O-N 2.95Å
7	A	75.4	Confident	75.5	Confident	37 Å²	37	92.6 Å²	92.6	31%	0.306	56%	0.556	S	S	.	*	H	α-helix	trans	-66.5	-36.1	177.2	0	0	0	0	0	112.7	A3 A4 V5 R11	A3-A7 PolarHBondContact O-N 3.1Å; A4-A7 PolarHBondContact O-N 3.34Å; V5-A7 PolarHBondContact O-N 3.44Å; A7-R11 VanDerWaalsContact O-CG 3.3Å; A7-R11 WeakPolarHBondContact O-CG 3.14Å; A7-R11 PolarHBondContact O-N 3.21Å; A7-R11 VanDerWaalsContact O-N 3.11Å
8	A	79.8	Confident	75.1	Confident	46 Å²	46	92.2 Å²	92.2	38%	0.38	55%	0.551	S	S	.	*	H	α-helix	trans	-66.4	-43.3	174.9	0	0	0	0	0	111.7	A4 V5 A6 R11 L12	A4-A8 WeakPolarHBondContact O-CB 3.21Å; A4-A8 PolarHBondContact O-N 2.84Å; V5-A8 PolarHBondContact O-N 3.34Å; A6-A8 PolarHBondContact O-N 3.16Å; A8-R11 PolarHBondContact O-N 3.3Å; A8-L12 WeakPolarHBondContact O-CG 3.49Å; A8-L12 PolarHBondContact O-N 3.45Å
9	L	80.2	Confident	74.7	Confident	99 Å²	99	92.8 Å²	92.8	52%	0.518	55%	0.55	S	S	.	*	H	α-helix	trans	-63.5	-42.9	176	-69.5	172	0	0	0	111.9	V5 A6 R11 L12 L13	V5-L9 HydrophobicContact CG1-CD1 4.1Å; V5-L9 HydrophobicContact CG1-CG 4.5Å; V5-L9 WeakPolarHBondContact O-CG 3.46Å; V5-L9 PolarHBondContact O-N 2.66Å; A6-L9 PolarHBondContact O-N 3.45Å; L9-R11 VanDerWaalsContact C-N 3.32Å; L9-R11 PolarHBondContact O-N 3.15Å; L9-L12 PolarHBondContact O-N 3.1Å; L9-L13 WeakPolarHBondContact O-CB 3.25Å; L9-L13 VanDerWaalsContact O-CG 3.32Å; L9-L13 WeakPolarHBondContact O-CG 3.48Å; L9-L13 PolarHBondContact O-N 3.43Å
10	A	79.8	Confident	74.1	Confident	57 Å²	57	90.5 Å²	90.5	47%	0.471	54%	0.541	S	S	.	.	H	α-helix	trans	-59.9	-41.8	176.1	0	0	0	0	0	112.1	A6 L13 A14	A6-A10 WeakPolarHBondContact O-CB 3.47Å; A6-A10 PolarHBondContact O-N 2.95Å; A10-L13 PolarHBondContact O-N 3.27Å; A10-A14 WeakPolarHBondContact O-CB 3.4Å; A10-A14 PolarHBondContact O-N 3.09Å
11	R	81.4	Confident	73.3	Confident	171 Å²	171	87.1 Å²	87.1	65%	0.645	52%	0.523	S	S	*	.	H	α-helix	trans	-65.1	-41.3	176.4	-73.4	176.5	178.2	110.4	2.1	112.4	A7 A8 L9 A14 A15	A7-R11 VanDerWaalsContact O-CG 3.3Å; A7-R11 WeakPolarHBondContact O-CG 3.14Å; A7-R11 PolarHBondContact O-N 3.21Å; A7-R11 VanDerWaalsContact O-N 3.11Å; A8-R11 PolarHBondContact O-N 3.3Å; L9-R11 VanDerWaalsContact C-N 3.32Å; L9-R11 PolarHBondContact O-N 3.15Å; R11-A14 PolarHBondContact O-N 3.28Å; R11-A15 WeakPolarHBondContact O-CB 3.31Å; R11-A15 PolarHBondContact O-N 3.35Å
12	L	82.3	Confident	73.2	Confident	120 Å²	120	83.7 Å²	83.7	63%	0.628	51%	0.505	S	S	*	.	H	α-helix	trans	-65.1	-42.6	176.6	-71.3	170.5	0	0	0	111.8	A8 L9 A15 F16	A8-L12 WeakPolarHBondContact O-CG 3.49Å; A8-L12 PolarHBondContact O-N 3.45Å; L9-L12 PolarHBondContact O-N 3.1Å; L12-A15 PolarHBondContact O-N 3.4Å; L12-F16 WeakPolarHBondContact O-CB 3.39Å; L12-F16 PolarHBondContact O-N 3.37Å
13	L	80	Confident	72.6	Confident	113 Å²	113	85.4 Å²	85.4	59%	0.592	51%	0.506	S	S	*	.	H	α-helix	trans	-64.2	-43.7	175.9	-70.4	172.3	0	0	0	111.7	L9 A10 F16 L17	L9-L13 WeakPolarHBondContact O-CB 3.25Å; L9-L13 VanDerWaalsContact O-CG 3.32Å; L9-L13 WeakPolarHBondContact O-CG 3.48Å; L9-L13 PolarHBondContact O-N 3.43Å; A10-L13 PolarHBondContact O-N 3.27Å; L13-F16 PolarHBondContact O-N 3.24Å; L13-L17 WeakPolarHBondContact O-CB 3.25Å; L13-L17 VanDerWaalsContact O-CG 3.28Å; L13-L17 WeakPolarHBondContact O-CG 3.49Å; L13-L17 PolarHBondContact O-N 2.64Å
14	A	73.6	Confident	71.7	Confident	38 Å²	38	84.2 Å²	84.2	31%	0.314	50%	0.497	S	S	.	.	H	α-helix	trans	-61.5	-44.7	175.7	0	0	0	0	0	112	A10 R11 F16 L17 L18	A10-A14 WeakPolarHBondContact O-CB 3.4Å; A10-A14 PolarHBondContact O-N 3.09Å; R11-A14 PolarHBondContact O-N 3.28Å; A14-F16 VanDerWaalsContact C-N 3.34Å; A14-F16 PolarHBondContact O-N 3.11Å; A14-L17 PolarHBondContact O-N 3.33Å; A14-L18 VanDerWaalsContact O-CG 3.3Å; A14-L18 WeakPolarHBondContact O-CG 3.44Å; A14-L18 PolarHBondContact O-N 2.94Å
15	A	74.3	Confident	70.7	Confident	56 Å²	56	82.3 Å²	82.3	46%	0.463	48%	0.479	S	S	.	.	H	α-helix	trans	-62	-41.5	176.4	0	0	0	0	0	112.1	R11 L12 L18 L19	R11-A15 WeakPolarHBondContact O-CB 3.31Å; R11-A15 PolarHBondContact O-N 3.35Å; L12-A15 PolarHBondContact O-N 3.4Å; A15-L18 PolarHBondContact O-N 3.49Å; A15-L19 WeakPolarHBondContact O-CB 3.39Å; A15-L19 PolarHBondContact O-N 3.3Å
16	F	77.1	Confident	69	Low	144 Å²	144	83.8 Å²	83.8	63%	0.632	48%	0.481	S	S	*	.	H	α-helix	trans	-64.1	-43.4	176.4	-176.9	-98.7	0	0	0	112.2	L12 L13 A14 L19 A20	L12-F16 WeakPolarHBondContact O-CB 3.39Å; L12-F16 PolarHBondContact O-N 3.37Å; L13-F16 PolarHBondContact O-N 3.24Å; A14-F16 VanDerWaalsContact C-N 3.34Å; A14-F16 PolarHBondContact O-N 3.11Å; F16-L19 PolarHBondContact O-N 2.99Å; F16-A20 WeakPolarHBondContact O-CB 3.4Å; F16-A20 PolarHBondContact O-N 3.01Å
17	L	69.3	Low	67.6	Low	116 Å²	116	87.8 Å²	87.8	61%	0.607	48%	0.484	S	S	*	.	H	α-helix	trans	-64.6	-39.2	176.7	-71.5	171.2	0	0	0	112.2	L13 A14 A20 A21	L13-L17 WeakPolarHBondContact O-CB 3.25Å; L13-L17 VanDerWaalsContact O-CG 3.28Å; L13-L17 WeakPolarHBondContact O-CG 3.49Å; L13-L17 PolarHBondContact O-N 2.64Å; A14-L17 PolarHBondContact O-N 3.33Å; L17-A20 PolarHBondContact O-N 3.36Å; L17-A21 WeakPolarHBondContact O-CB 3.35Å; L17-A21 PolarHBondContact O-N 2.78Å
18	L	69.6	Low	66.4	Low	86 Å²	86	86.8 Å²	86.8	45%	0.45	48%	0.478	S	S	.	.	H	α-helix	trans	-64.5	-41.3	174.6	-72.9	170.3	0	0	0	111.8	A14 A15 A21 Q22 L75	A14-L18 VanDerWaalsContact O-CG 3.3Å; A14-L18 WeakPolarHBondContact O-CG 3.44Å; A14-L18 PolarHBondContact O-N 2.94Å; A15-L18 PolarHBondContact O-N 3.49Å; L18-A21 PolarHBondContact O-N 3.12Å; L18-Q22 WeakPolarHBondContact O-CG 3.33Å; L18-Q22 PolarHBondContact O-N 3.07Å; L18-L75 HydrophobicContact CD1-CD1 4.38Å
19	L	67.3	Low	64.6	Low	104 Å²	104	89.5 Å²	89.5	55%	0.545	48%	0.484	S	S	.	.	H	α-helix	trans	-66.9	-42.5	176.9	-162.1	70.8	0	0	0	111.2	A15 F16 A21 Q22 V23	A15-L19 WeakPolarHBondContact O-CB 3.39Å; A15-L19 PolarHBondContact O-N 3.3Å; F16-L19 PolarHBondContact O-N 2.99Å; L19-A21 VanDerWaalsContact C-N 3.32Å; L19-A21 PolarHBondContact O-N 3.04Å; L19-Q22 WeakPolarHBondContact O-CB 3.3Å; L19-Q22 PolarHBondContact O-N 3.26Å; L19-V23 WeakPolarHBondContact O-CG2 3.3Å; L19-V23 PolarHBondContact O-N 3.21Å
20	A	61.8	Low	63.1	Low	45 Å²	45	86.7 Å²	86.7	37%	0.372	47%	0.471	S	S	.	.	H	α-helix	trans	-62.8	-38.5	174.6	0	0	0	0	0	111.7	F16 L17 V23 A24	F16-A20 WeakPolarHBondContact O-CB 3.4Å; F16-A20 PolarHBondContact O-N 3.01Å; L17-A20 PolarHBondContact O-N 3.36Å; A20-V23 PolarHBondContact O-N 3.46Å; A20-A24 WeakPolarHBondContact O-CB 3.48Å; A20-A24 PolarHBondContact O-N 2.86Å
21	A	58.4	Low	61.6	Low	20 Å²	20	89.4 Å²	89.4	17%	0.165	47%	0.473	C	S	.	.	H	α-helix	trans	-66.3	-34.9	174.6	0	0	0	0	0	112.7	L17 L18 L19 C25	L17-A21 WeakPolarHBondContact O-CB 3.35Å; L17-A21 PolarHBondContact O-N 2.78Å; L18-A21 PolarHBondContact O-N 3.12Å; L19-A21 VanDerWaalsContact C-N 3.32Å; L19-A21 PolarHBondContact O-N 3.04Å; A21-C25 PolarHBondContact O-N 3.42Å; A21-C25 PolarHBondContact O-SG 3.27Å
22	Q	58.2	Low	60.1	Low	133 Å²	133	84.4 Å²	84.4	62%	0.621	46%	0.462	S	S	*	.	H	α-helix	trans	-66.1	-38.2	172	-73	-179.6	3.1	0	0	112.1	L18 L19 C25	L18-Q22 WeakPolarHBondContact O-CG 3.33Å; L18-Q22 PolarHBondContact O-N 3.07Å; L19-Q22 WeakPolarHBondContact O-CB 3.3Å; L19-Q22 PolarHBondContact O-N 3.26Å; Q22-C25 WeakPolarHBondContact O-CB 3.45Å; Q22-C25 PolarHBondContact O-N 3.49Å
23	V	53.5	Low	58.4	Low	120 Å²	120	83.9 Å²	83.9	73%	0.727	46%	0.464	S	S	*	.	H	α-helix	trans	-77.2	-29.4	177.8	177.7	0	0	0	0	112.1	L19 A20 C25	L19-V23 WeakPolarHBondContact O-CG2 3.3Å; L19-V23 PolarHBondContact O-N 3.21Å; A20-V23 PolarHBondContact O-N 3.46Å; V23-C25 PolarHBondContact O-N 3.28Å
24	A	51.8	Low	56.9	Low	57 Å²	57	81.4 Å²	81.4	47%	0.471	46%	0.455	S	S	.	.	T	Hydrogen-bonded Turn	trans	-79.3	-0.4	174.5	0	0	0	0	0	113.4	A20 E26	A20-A24 WeakPolarHBondContact O-CB 3.48Å; A20-A24 PolarHBondContact O-N 2.86Å; A24-E26 PolarHBondContact O-N 3.22Å; A24-E26 VanDerWaalsContact O-N 3.16Å
25	C	51.4	Low	55.7	Low	27 Å²	27	89.3 Å²	89.3	18%	0.182	49%	0.486	C	S	.	.	S	Bend	trans	-63.8	113.5	163.2	-65.2	0	0	0	0	107.8	A21 Q22 V23 Y27 Y48 N49	A21-C25 PolarHBondContact O-N 3.42Å; A21-C25 PolarHBondContact O-SG 3.27Å; Q22-C25 WeakPolarHBondContact O-CB 3.45Å; Q22-C25 PolarHBondContact O-N 3.49Å; V23-C25 PolarHBondContact O-N 3.28Å; C25-Y27 PolarHBondContact O-N 3.46Å; C25-Y48 CarbonylContact C-O 3.46Å; C25-Y48 WeakPolarHBondContact CA-O 3.39Å; C25-Y48 WeakPolarHBondContact CB-O 3.41Å; C25-N49 VanDerWaalsContact SG-CB 3.57Å
26	E	47.2	Very low	54.5	Low	114 Å²	114	90.5 Å²	90.5	53%	0.533	50%	0.496	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-66.9	128.5	-177.8	-166.6	-179.1	105.9	0	0	109.4	A24 G28 Y48	A24-E26 PolarHBondContact O-N 3.22Å; A24-E26 VanDerWaalsContact O-N 3.16Å; E26-G28 PolarHBondContact O-N 3.16Å; E26-G28 VanDerWaalsContact O-N 3.09Å; E26-Y48 HydrophobicContact CB-CE1 3.83Å; E26-Y48 HydrophobicContact CG-CE1 4.25Å; E26-Y48 PolarHBondContact N-O 3.49Å; E26-Y48 VanDerWaalsContact N-O 3.11Å; E26-Y48 VanDerWaalsContact O-CD1 3.25Å; E26-Y48 WeakPolarHBondContact O-CD1 3.35Å; E26-Y48 WeakPolarHBondContact O-CE1 3.2Å; E26-Y48 PolarHBondContact OE1-OH 3.26Å
27	Y	47.2	Very low	53	Low	140 Å²	140	87.6 Å²	87.6	55%	0.549	51%	0.506	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-77.4	95.4	178.5	-171.7	-93.1	0	0	0	109.3	C25 M29 C45 L47	C25-Y27 PolarHBondContact O-N 3.46Å; Y27-M29 HydrophobicContact CD1-CG 4.19Å; Y27-M29 HydrophobicContact CE1-CG 3.56Å; Y27-M29 HydrophobicContact CE1-SD 3.66Å; Y27-C45 HydrophobicContact CE2-CB 4.19Å; Y27-C45 WeakPolarHBondContact OH-CB 3.32Å; Y27-C45 PolarHBondContact OH-SG 3Å; Y27-L47 HydrophobicContact CD2-CD1 3.85Å; Y27-L47 HydrophobicContact CE2-CD1 4.17Å
28	G	50.2	Low	52.2	Low	16 Å²	16	83.8 Å²	83.8	17%	0.165	50%	0.495	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-94.1	113.3	174.9	0	0	0	0	0	111.3	E26 I46	E26-G28 PolarHBondContact O-N 3.16Å; E26-G28 VanDerWaalsContact O-N 3.09Å; G28-I46 PolarHBondContact O-N 3.49Å
29	M	41.7	Very low	51.3	Low	103 Å²	103	86.6 Å²	86.6	51%	0.507	52%	0.519	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-82.1	113.9	166.2	-74.2	-67.9	-69.5	0	0	108.6	Y27 D43 C45	Y27-M29 HydrophobicContact CD1-CG 4.19Å; Y27-M29 HydrophobicContact CE1-CG 3.56Å; Y27-M29 HydrophobicContact CE1-SD 3.66Å; M29-D43 HydrophobicContact CE-CB 4.22Å; M29-C45 HydrophobicContact SD-CB 3.93Å; M29-C45 PolarHBondContact SD-SG 3.26Å
30	V	48.4	Very low	50.6	Low	41 Å²	41	88.4 Å²	88.4	25%	0.248	52%	0.524	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.2	114.4	177.5	179	0	0	0	0	109.1	V32 Y44	V30-V32 HydrophobicContact CG1-CG2 4.32Å; V30-V32 PolarHBondContact O-N 2.95Å; V30-Y44 PolarHBondContact N-O 2.92Å
31	H	48.3	Very low	50.2	Low	113 Å²	113	87.4 Å²	87.4	52%	0.523	52%	0.519	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-82.7	107.5	175.2	-167.8	77.6	0	0	0	109.1	V33 D43	H31-V33 VanDerWaalsContact CD2-CG2 3.48Å; H31-V33 WeakPolarHBondContact CD2-CG2 3.37Å; H31-V33 PolarHBondContact O-N 2.95Å; H31-D43 IonicContact CE1-OD1 3.62Å; H31-D43 IonicContact CG-OD1 3.57Å; H31-D43 IonicContact ND1-OD1 2.66Å; H31-D43 PolarHBondContact ND1-OD1 3.34Å; H31-D43 IonicContact ND1-OD2 3.91Å
32	V	51.3	Low	49.8	Very low	67 Å²	67	91.7 Å²	91.7	41%	0.406	53%	0.534	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-89.4	104.2	176.8	-176.8	0	0	0	0	108.7	V30 G41 Y44	V30-V32 HydrophobicContact CG1-CG2 4.32Å; V30-V32 PolarHBondContact O-N 2.95Å; V32-G41 WeakPolarHBondContact O-CA 3.48Å; V32-Y44 HydrophobicContact CG2-CD2 4.41Å
33	V	45.7	Very low	49.4	Very low	109 Å²	109	90 Å²	90	66%	0.661	53%	0.529	S	S	*	.			trans	-81	117.9	170	-170.6	0	0	0	0	108.2	H31 Q35	H31-V33 VanDerWaalsContact CD2-CG2 3.48Å; H31-V33 WeakPolarHBondContact CD2-CG2 3.37Å; H31-V33 PolarHBondContact O-N 2.95Å; V33-Q35 PolarHBondContact O-N 3.32Å
34	S	49.4	Very low	49.1	Very low	60 Å²	60	90.4 Å²	90.4	42%	0.42	52%	0.518	S	S	.	.			trans	-61.7	122.9	173.9	-176.2	0	0	0	0	109.6	A36	S34-A36 PolarHBondContact O-N 3.42Å; S34-A36 PolarHBondContact OG-N 3.47Å
35	Q	47.6	Very low	49	Very low	204 Å²	204	91.2 Å²	91.2	95%	0.953	52%	0.519	S	S	*	.	S	Bend	trans	-59.1	-19.9	175.5	-170.5	-179.3	65	0	0	111.9	V33 G37	V33-Q35 PolarHBondContact O-N 3.32Å; Q35-G37 VanDerWaalsContact C-N 3.3Å; Q35-G37 PolarHBondContact O-N 3.41Å
36	A	48.7	Very low	49.1	Very low	81 Å²	81	92.5 Å²	92.5	67%	0.669	52%	0.524	S	S	*	.	S	Bend	trans	-87.5	54.7	176.5	0	0	0	0	0	112.4	S34 G38	S34-A36 PolarHBondContact O-N 3.42Å; S34-A36 PolarHBondContact OG-N 3.47Å; A36-G38 PolarHBondContact O-N 2.85Å
37	G	47.1	Very low	49.2	Very low	83 Å²	83	92.7 Å²	92.7	86%	0.856	53%	0.528	S	S	*	.			trans	43.7	16.6	156.8	0	0	0	0	0	120.3	Q35	Q35-G37 VanDerWaalsContact C-N 3.3Å; Q35-G37 PolarHBondContact O-N 3.41Å
38	G	52.1	Low	49.3	Very low	36 Å²	36	88 Å²	88	37%	0.371	51%	0.51	S	S	.	.			trans	-104.5	139.9	-174.1	0	0	0	0	0	110.1	A36 E40	A36-G38 PolarHBondContact O-N 2.85Å; G38-E40 PolarHBondContact O-N 3.44Å
39	P	50.2	Low	49.1	Very low	146 Å²	146	88.1 Å²	88.1	95%	0.948	51%	0.506	S	S	*	.	S	Bend	trans	-69.5	8.8	-168.6	28.3	-36	0	0	0	115.6
40	E	53.5	Low	49.4	Very low	141 Å²	141	85.7 Å²	85.7	66%	0.659	50%	0.498	S	S	*	.			trans	-111	72.2	-175.6	-135.6	-168.1	128.5	0	0	110.5	G38 K42	G38-E40 PolarHBondContact O-N 3.44Å; E40-K42 PolarHBondContact O-N 2.95Å; E40-K42 VanDerWaalsContact OE1-CE 3.28Å; E40-K42 WeakPolarHBondContact OE1-CE 3.28Å
41	G	52.3	Low	49.4	Very low	25 Å²	25	90.6 Å²	90.6	26%	0.258	52%	0.519	S	S	.	.			trans	-69.4	113.3	161	0	0	0	0	0	108.2	V32	V32-G41 WeakPolarHBondContact O-CA 3.48Å
42	K	50.5	Low	49.2	Very low	110 Å²	110	94.4 Å²	94.4	48%	0.478	53%	0.528	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-82.9	121.7	177.2	-75.6	-158.8	176.8	-167.6	0	109.6	E40 Y44	E40-K42 PolarHBondContact O-N 2.95Å; E40-K42 VanDerWaalsContact OE1-CE 3.28Å; E40-K42 WeakPolarHBondContact OE1-CE 3.28Å; K42-Y44 HydrophobicContact CB-CD2 4.18Å; K42-Y44 HydrophobicContact CB-CE2 3.45Å; K42-Y44 VanDerWaalsContact CB-CE2 3.45Å; K42-Y44 WeakPolarHBondContact CD-OH 3.44Å; K42-Y44 VanDerWaalsContact O-CD2 3.25Å; K42-Y44 WeakPolarHBondContact O-CD2 3.36Å; K42-Y44 PolarHBondContact O-N 2.92Å
43	D	49.3	Very low	48.9	Very low	96 Å²	96	93.8 Å²	93.8	51%	0.513	53%	0.53	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-73.5	118.3	171.2	-70.5	-52.3	0	0	0	109.7	M29 H31	M29-D43 HydrophobicContact CE-CB 4.22Å; H31-D43 IonicContact CE1-OD1 3.62Å; H31-D43 IonicContact CG-OD1 3.57Å; H31-D43 IonicContact ND1-OD1 2.66Å; H31-D43 PolarHBondContact ND1-OD1 3.34Å; H31-D43 IonicContact ND1-OD2 3.91Å
44	Y	48.1	Very low	49.1	Very low	129 Å²	129	96.9 Å²	96.9	51%	0.506	54%	0.537	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.4	124	172.4	-64.2	-82.3	0	0	0	109.2	V30 V32 K42	V30-Y44 PolarHBondContact N-O 2.92Å; V32-Y44 HydrophobicContact CG2-CD2 4.41Å; K42-Y44 HydrophobicContact CB-CD2 4.18Å; K42-Y44 HydrophobicContact CB-CE2 3.45Å; K42-Y44 VanDerWaalsContact CB-CE2 3.45Å; K42-Y44 WeakPolarHBondContact CD-OH 3.44Å; K42-Y44 VanDerWaalsContact O-CD2 3.25Å; K42-Y44 WeakPolarHBondContact O-CD2 3.36Å; K42-Y44 PolarHBondContact O-N 2.92Å
45	C	48.7	Very low	49	Very low	74 Å²	74	97.8 Å²	97.8	50%	0.5	54%	0.537	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-79	119.1	170.3	-45.2	0	0	0	0	108.2	Y27 M29	Y27-C45 HydrophobicContact CE2-CB 4.19Å; Y27-C45 WeakPolarHBondContact OH-CB 3.32Å; Y27-C45 PolarHBondContact OH-SG 3Å; M29-C45 HydrophobicContact SD-CB 3.93Å; M29-C45 PolarHBondContact SD-SG 3.26Å
46	I	52.8	Low	48.9	Very low	55 Å²	55	91.9 Å²	91.9	28%	0.282	52%	0.517	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.9	115.8	176.4	-55.9	176.5	0	0	0	107.5	G28 Y48 L59	G28-I46 PolarHBondContact O-N 3.49Å; I46-Y48 PolarHBondContact O-N 3.11Å; I46-L59 HydrophobicContact CD1-CD2 3.33Å
47	L	49.3	Very low	49	Very low	117 Å²	117	97.3 Å²	97.3	61%	0.613	53%	0.527	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-72.9	110.9	163.1	-103.2	75.7	0	0	0	107.1	Y27	Y27-L47 HydrophobicContact CD2-CD1 3.85Å; Y27-L47 HydrophobicContact CE2-CD1 4.17Å
48	Y	49.7	Very low	49	Very low	43 Å²	43	98.8 Å²	98.8	17%	0.169	52%	0.516	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.8	138.5	175.2	85.3	-84.7	0	0	0	109.7	C25 E26 I46 P50 L55	C25-Y48 CarbonylContact C-O 3.46Å; C25-Y48 WeakPolarHBondContact CA-O 3.39Å; C25-Y48 WeakPolarHBondContact CB-O 3.41Å; E26-Y48 HydrophobicContact CB-CE1 3.83Å; E26-Y48 HydrophobicContact CG-CE1 4.25Å; E26-Y48 PolarHBondContact N-O 3.49Å; E26-Y48 VanDerWaalsContact N-O 3.11Å; E26-Y48 VanDerWaalsContact O-CD1 3.25Å; E26-Y48 WeakPolarHBondContact O-CD1 3.35Å; E26-Y48 WeakPolarHBondContact O-CE1 3.2Å; E26-Y48 PolarHBondContact OE1-OH 3.26Å; I46-Y48 PolarHBondContact O-N 3.11Å; Y48-P50 HydrophobicContact CE2-CB 3.95Å; Y48-P50 HydrophobicContact CE2-CG 4.45Å; Y48-P50 WeakPolarHBondContact O-CD 3.5Å; Y48-L55 HydrophobicContact CD2-CB 4.37Å; Y48-L55 HydrophobicContact CE2-CB 4.48Å; Y48-L55 HydrophobicContact CG-CD1 4.39Å
49	N	46.6	Very low	48.8	Very low	17 Å²	17	99.7 Å²	99.7	9%	0.091	51%	0.512	C	S	.	.			trans	-98.9	106.4	175.3	-171.4	-6.3	0	0	0	108.7	C25 Q51 W52 A53	C25-N49 VanDerWaalsContact SG-CB 3.57Å; N49-Q51 PolarHBondContact O-N 3.02Å; N49-Q51 VanDerWaalsContact O-N 3.07Å; N49-Q51 PolarHBondContact OD1-N 3.41Å; N49-W52 WeakPolarHBondContact ND2-CZ3 3.45Å; N49-W52 PolarHBondContact O-N 3.33Å; N49-W52 VanDerWaalsContact O-N 3.12Å; N49-A53 PolarHBondContact O-N 2.92Å
50	P	47.5	Very low	48.6	Very low	53 Å²	53	98.2 Å²	98.2	34%	0.344	51%	0.505	S	S	.	.	T	Hydrogen-bonded Turn	trans	-63	-16.8	-177.4	23.6	-32.3	0	0	0	113.4	Y48	Y48-P50 HydrophobicContact CE2-CB 3.95Å; Y48-P50 HydrophobicContact CE2-CG 4.45Å; Y48-P50 WeakPolarHBondContact O-CD 3.5Å
51	Q	48.9	Very low	48	Very low	144 Å²	144	100 Å²	100	67%	0.673	51%	0.511	S	S	*	.	T	Hydrogen-bonded Turn	trans	-81	-19.3	178	-61.8	-172.5	-93.1	0	0	113.8	N49	N49-Q51 PolarHBondContact O-N 3.02Å; N49-Q51 VanDerWaalsContact O-N 3.07Å; N49-Q51 PolarHBondContact OD1-N 3.41Å
52	W	44.5	Very low	47.5	Very low	192 Å²	192	102.7 Å²	102.7	73%	0.727	53%	0.53	S	S	*	.	T	Hydrogen-bonded Turn	trans	-129.8	-15.9	-176.3	-55.6	-32.3	0	0	0	115.3	N49	N49-W52 WeakPolarHBondContact ND2-CZ3 3.45Å; N49-W52 PolarHBondContact O-N 3.33Å; N49-W52 VanDerWaalsContact O-N 3.12Å
53	A	44.2	Very low	46.9	Very low	54 Å²	54	105.1 Å²	105.1	45%	0.446	55%	0.545	S	S	.	.			trans	-138.4	95.5	175.8	0	0	0	0	0	108.2	N49 L55	N49-A53 PolarHBondContact O-N 2.92Å; A53-L55 PolarHBondContact O-N 3.37Å; A53-L55 VanDerWaalsContact O-N 3.1Å
54	H	49.2	Very low	46.6	Very low	175 Å²	175	107.1 Å²	107.1	81%	0.81	56%	0.563	S	S	*	*			trans	-54.3	120.4	161.4	-80.1	-64.8	0	0	0	107.2	P56	H54-P56 WeakPolarHBondContact O-CD 3.44Å
55	L	48.2	Very low	46.2	Very low	78 Å²	78	103.4 Å²	103.4	41%	0.408	57%	0.565	S	S	.	*			trans	-59.3	111.6	177.8	-168.5	70.7	0	0	0	107.2	Y48 A53 H57 L59	Y48-L55 HydrophobicContact CD2-CB 4.37Å; Y48-L55 HydrophobicContact CE2-CB 4.48Å; Y48-L55 HydrophobicContact CG-CD1 4.39Å; A53-L55 PolarHBondContact O-N 3.37Å; A53-L55 VanDerWaalsContact O-N 3.1Å; L55-H57 PolarHBondContact O-N 2.96Å; L55-L59 HydrophobicContact CD1-CD1 3.81Å; L55-L59 HydrophobicContact CG-CD1 4.33Å
56	P	46.4	Very low	45.6	Very low	81 Å²	81	111.9 Å²	111.9	53%	0.526	59%	0.586	S	S	.	*			trans	-64.6	129.9	179.5	24.4	-28.9	0	0	0	107.6	H54 D58 L59	H54-P56 WeakPolarHBondContact O-CD 3.44Å; P56-D58 PolarHBondContact O-N 3.44Å; P56-L59 HydrophobicContact CG-CD1 4.31Å
57	H	50.3	Low	44.9	Very low	194 Å²	194	113 Å²	113	90%	0.898	61%	0.611	S	S	*	*	S	Bend	trans	-57.4	-16.5	-177.8	-155.7	70.9	0	0	0	112.7	L55	L55-H57 PolarHBondContact O-N 2.96Å
58	D	46.4	Very low	44.5	Very low	114 Å²	114	111.4 Å²	111.4	61%	0.61	62%	0.624	S	S	*	*			trans	-117.5	78.5	176.8	-77.2	-52.6	0	0	0	112.4	P56 S60 K61	P56-D58 PolarHBondContact O-N 3.44Å; D58-S60 PolarHBondContact O-N 2.95Å; D58-S60 VanDerWaalsContact O-N 3.16Å; D58-K61 PolarHBondContact O-N 3.22Å
59	L	49.2	Very low	44.1	Very low	55 Å²	55	114.4 Å²	114.4	29%	0.288	66%	0.657	S	S	.	*	G	3₁₀ helix	trans	-65.8	-10.2	171.5	-127.3	88.3	0	0	0	113.7	I46 L55 P56 K61 A62	I46-L59 HydrophobicContact CD1-CD2 3.33Å; L55-L59 HydrophobicContact CD1-CD1 3.81Å; L55-L59 HydrophobicContact CG-CD1 4.33Å; P56-L59 HydrophobicContact CG-CD1 4.31Å; L59-K61 PolarHBondContact O-N 3.03Å; L59-K61 VanDerWaalsContact O-N 3.1Å; L59-A62 PolarHBondContact O-N 3.42Å
60	S	44.8	Very low	43.8	Very low	115 Å²	115	117.9 Å²	117.9	80%	0.804	69%	0.688	S	S	*	*	G	3₁₀ helix	trans	-57.7	-17.6	171.7	165	0	0	0	0	113.3	D58	D58-S60 PolarHBondContact O-N 2.95Å; D58-S60 VanDerWaalsContact O-N 3.16Å
61	K	41.3	Very low	43.6	Very low	180 Å²	180	121.9 Å²	121.9	78%	0.783	71%	0.711	S	S	*	*	G	3₁₀ helix	trans	-98.2	9.7	-179.1	-70.7	-88.4	-175.4	169.5	0	114.4	D58 L59 M63	D58-K61 PolarHBondContact O-N 3.22Å; L59-K61 PolarHBondContact O-N 3.03Å; L59-K61 VanDerWaalsContact O-N 3.1Å; K61-M63 VanDerWaalsContact C-N 3.34Å; K61-M63 PolarHBondContact O-N 3.45Å
62	A	41.7	Very low	43.2	Very low	81 Å²	81	117.3 Å²	117.3	67%	0.669	70%	0.703	S	S	*	*			trans	-68.1	91	176.8	0	0	0	0	0	110.7	L59	L59-A62 PolarHBondContact O-N 3.42Å
63	M	38.9	Very low	43.1	Very low	160 Å²	160	113.2 Å²	113.2	79%	0.788	70%	0.699	S	S	*	*			trans	-58.4	135.3	170.5	-175.7	-174.3	-65.2	0	0	109.2	K61 G65	K61-M63 VanDerWaalsContact C-N 3.34Å; K61-M63 PolarHBondContact O-N 3.45Å; M63-G65 PolarHBondContact O-N 3.34Å
64	P	41.1	Very low	42.9	Very low	138 Å²	138	118.6 Å²	118.6	90%	0.896	72%	0.715	S	S	*	*			trans	-74.9	73	172.6	32.4	-32.2	0	0	0	108.2
65	G	40	Very low	42.4	Very low	52 Å²	52	115.5 Å²	115.5	54%	0.536	70%	0.704	S	S	.	*			trans	-125	83.9	-173.6	0	0	0	0	0	110.1	M63	M63-G65 PolarHBondContact O-N 3.34Å
66	R	36.9	Very low	42.1	Very low	251 Å²	251	116.8 Å²	116.8	95%	0.947	71%	0.714	S	S	*	*			trans	55.5	104.7	149.6	-140.8	172.9	-172	-166.7	1.4	116.3
67	G	38.5	Very low	41.8	Very low	79 Å²	79	119.3 Å²	119.3	81%	0.814	72%	0.723	S	S	*	*			trans	-57.9	158.2	179.6	0	0	0	0	0	116.1
68	G	40.5	Very low	41.3	Very low	84 Å²	84	116.3 Å²	116.3	87%	0.866	71%	0.713	S	S	*	*			trans	73.6	77.8	146.3	0	0	0	0	0	116.9
69	A	40	Very low	40.9	Very low	105 Å²	105	115.8 Å²	115.8	87%	0.868	72%	0.718	S	S	*	*			trans	-157.2	69.5	162.3	0	0	0	0	0	112.3
70	A	41.2	Very low	40.5	Very low	91 Å²	91	120.5 Å²	120.5	75%	0.752	74%	0.744	S	S	*	*	S	Bend	trans	-149.1	14.2	164.3	0	0	0	0	0	114.5
71	V	44.3	Very low	40.5	Very low	136 Å²	136	125.4 Å²	125.4	82%	0.824	76%	0.76	S	S	*	*	S	Bend	trans	-115.9	12.8	176.2	179.8	0	0	0	0	111.3
72	G	40	Very low	40.5	Very low	49 Å²	49	122.7 Å²	122.7	51%	0.505	76%	0.759	S	S	.	*	S	Bend	trans	-108.3	-14.1	-172.3	0	0	0	0	0	116.7	V76	G72-V76 VanDerWaalsContact O-CG2 3.31Å; G72-V76 WeakPolarHBondContact O-CG2 3.33Å
73	T	42.5	Very low	40.4	Very low	105 Å²	105	124.9 Å²	124.9	64%	0.644	76%	0.763	S	S	*	*	S	Bend	trans	-102	-25.9	-168.9	44.9	0	0	0	0	114.5
74	H	38.6	Very low	40.5	Very low	168 Å²	168	122.9 Å²	122.9	78%	0.778	76%	0.762	S	S	*	*	T	Hydrogen-bonded Turn	trans	-89.5	-25.7	-179.9	-94.7	-90.4	0	0	0	114.4
75	L	39.9	Very low	40.5	Very low	110 Å²	110	122.1 Å²	122.1	58%	0.576	75%	0.754	S	S	*	*	T	Hydrogen-bonded Turn	trans	-80.9	-26.8	-178.2	-154.1	75.5	0	0	0	112.7	L18 L78 S79	L18-L75 HydrophobicContact CD1-CD1 4.38Å; L75-L78 PolarHBondContact O-N 3.22Å; L75-S79 PolarHBondContact O-OG 3.46Å
76	V	41.9	Very low	40.5	Very low	104 Å²	104	126.4 Å²	126.4	63%	0.63	77%	0.768	S	S	*	*	T	Hydrogen-bonded Turn	trans	-71.3	-35.7	178.9	-177.6	0	0	0	0	111.1	G72 L78 S79	G72-V76 VanDerWaalsContact O-CG2 3.31Å; G72-V76 WeakPolarHBondContact O-CG2 3.33Å; V76-L78 VanDerWaalsContact C-N 3.28Å; V76-L78 PolarHBondContact O-N 3.32Å; V76-S79 PolarHBondContact O-N 3.01Å
77	L	40.3	Very low	40.8	Very low	134 Å²	134	118.1 Å²	118.1	70%	0.702	76%	0.756	S	S	*	*	T	Hydrogen-bonded Turn	trans	-67.7	-22.9	178	-97.7	151.8	0	0	0	114.1
78	L	39.5	Very low	40.9	Very low	132 Å²	132	120.9 Å²	120.9	69%	0.691	75%	0.751	S	S	*	*	T	Hydrogen-bonded Turn	trans	-87.3	-7.1	178.8	-143.8	79.7	0	0	0	113.3	L75 V76	L75-L78 PolarHBondContact O-N 3.22Å; V76-L78 VanDerWaalsContact C-N 3.28Å; V76-L78 PolarHBondContact O-N 3.32Å
79	S	37.5	Very low	40.9	Very low	102 Å²	102	123.8 Å²	123.8	71%	0.713	74%	0.743	S	S	*	*	S	Bend	trans	-91.8	-8.8	179.4	-57.3	0	0	0	0	113.3	L75 V76	L75-S79 PolarHBondContact O-OG 3.46Å; V76-S79 PolarHBondContact O-N 3.01Å
80	D	41.3	Very low	41	Very low	155 Å²	155	125.3 Å²	125.3	83%	0.829	73%	0.732	S	S	*	*			trans	-108.3	10.6	-175.1	-137.9	-97.5	0	0	0	113.5
81	L	45.3	Very low	41	Very low	218 Å²	218	128.5 Å²	128.5	100%	1.141	73%	0.73	S	S	*	*			trans	-116.6	0	177	-158.7	81.7	0	0	0	112.7

Retrieved 81 of 81 residues in 22.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).