A0A087WWN9_HUMAN Loading...

Fatty acid desaturase 6

AlphaFold DB , UniProt , Accession A0A087WWN9, Species HUMAN (Homo sapiens, Human), Gene FADS6, Length 123 aa.

						>A0A087WWN9_HUMAN|A0A087WWN9|FADS6
MEPTEPMEPTEPMEPTEPMEPTEPMEPTEPMEPARSAHRGGEALLRELEVLVQDVVRTSSWWERHGVDCAILALSLFALPAGVHSLHCRARHAWARQDAPCLHQRGGPGGLQHVEAALPQPLC
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	43	Very low	66.8	Low	245 Å²	245	162.4 Å²	162.4	100%	1.207	86%	0.864	S	S	*	*				0	102.4	0	-74.5	170.6	173.2	0	0	105.4
2	E	48.4	Very low	67.4	Low	187 Å²	187	158.8 Å²	158.8	87%	0.874	86%	0.857	S	S	*	*	P	Polyproline II helix	trans	-87.5	139.3	176.3	-73.7	-156.5	109.8	0	0	109.7
3	P	62.3	Low	68.2	Low	123 Å²	123	161.2 Å²	161.2	80%	0.799	86%	0.863	S	S	*	*	P	Polyproline II helix	trans	-69.9	129.6	175.8	-13.6	28.6	0	0	0	110.8	E5	P3-E5 PolarHBondContact O-N 3.37Å
4	T	60.4	Low	69	Low	139 Å²	139	162.1 Å²	162.1	85%	0.853	86%	0.86	S	S	*	*	P	Polyproline II helix	trans	-69.3	122.9	169.8	-40.8	0	0	0	0	109.1
5	E	73.1	Confident	69.3	Low	178 Å²	178	158.7 Å²	158.7	83%	0.832	85%	0.85	S	S	*	*	P	Polyproline II helix	trans	-65.5	144.2	176.3	-63.7	-147.5	124.3	0	0	111.5	P3	P3-E5 PolarHBondContact O-N 3.37Å
6	P	69.2	Low	69.9	Low	121 Å²	121	157.5 Å²	157.5	79%	0.786	85%	0.85	S	S	*	*	P	Polyproline II helix	trans	-73.2	141.9	-177.8	29.9	-32.2	0	0	0	110.8
7	M	71.8	Confident	70.5	Confident	192 Å²	192	158.7 Å²	158.7	95%	0.946	85%	0.849	S	S	*	*	P	Polyproline II helix	trans	-63.9	137.5	169.3	-106.2	-177.9	157.7	0	0	110.3
8	E	75.3	Confident	70.7	Confident	177 Å²	177	156.5 Å²	156.5	83%	0.827	85%	0.845	S	S	*	*	P	Polyproline II helix	trans	-60.7	141.5	173.3	-81.5	-91.7	111.2	0	0	111.4
9	P	73	Confident	70.8	Confident	108 Å²	108	158.1 Å²	158.1	70%	0.701	85%	0.849	S	S	*	*	P	Polyproline II helix	trans	-73.5	138.2	-179.6	28.5	-31.9	0	0	0	111.8	E11	P9-E11 PolarHBondContact O-N 2.97Å
10	T	77.8	Confident	71.1	Confident	140 Å²	140	159 Å²	159	86%	0.859	85%	0.847	S	S	*	*	P	Polyproline II helix	trans	-65.6	129.9	171	-48.4	0	0	0	0	110.1
11	E	80.5	Confident	71	Confident	176 Å²	176	156.6 Å²	156.6	82%	0.822	84%	0.841	S	S	*	*	P	Polyproline II helix	trans	-62.2	143.3	176.4	-65.9	-136.2	121.3	0	0	111.8	P9	P9-E11 PolarHBondContact O-N 2.97Å
12	P	74.6	Confident	72.4	Confident	120 Å²	120	151.7 Å²	151.7	78%	0.779	83%	0.825	S	S	*	*	P	Polyproline II helix	trans	-70.7	144.5	-178.7	29.3	-33	0	0	0	110.9
13	M	77.2	Confident	73.7	Confident	189 Å²	189	151 Å²	151	93%	0.931	82%	0.822	S	S	*	*	P	Polyproline II helix	trans	-68.7	138.4	172.8	-154.3	173.9	179.7	0	0	109.6
14	E	79	Confident	73.8	Confident	175 Å²	175	151 Å²	151	82%	0.818	82%	0.821	S	S	*	*	P	Polyproline II helix	trans	-59.2	140.5	177.9	-79.3	-101.4	109.2	0	0	111.5
15	P	74.3	Confident	74	Confident	110 Å²	110	153.4 Å²	153.4	71%	0.714	83%	0.825	S	S	*	*	P	Polyproline II helix	trans	-70.4	138.2	-179.4	27.6	-32	0	0	0	111.4	E17	P15-E17 PolarHBondContact O-N 2.93Å
16	T	78	Confident	73.6	Confident	140 Å²	140	153.3 Å²	153.3	86%	0.859	83%	0.825	S	S	*	*	P	Polyproline II helix	trans	-65	130.2	170.7	-47.9	0	0	0	0	109.8
17	E	81.4	Confident	73.3	Confident	178 Å²	178	153 Å²	153	83%	0.832	82%	0.823	S	S	*	*	P	Polyproline II helix	trans	-60.4	143.2	176	-65.8	-132.1	117	0	0	111.7	P15	P15-E17 PolarHBondContact O-N 2.93Å
18	P	73.1	Confident	73	Confident	119 Å²	119	150.4 Å²	150.4	77%	0.773	82%	0.818	S	S	*	*	P	Polyproline II helix	trans	-68.7	145.2	-179.2	28.3	-32.8	0	0	0	111
19	M	73.4	Confident	72.6	Confident	187 Å²	187	150.3 Å²	150.3	92%	0.921	82%	0.818	S	S	*	*	P	Polyproline II helix	trans	-67.1	136.5	172.8	-153	174.7	-170.8	0	0	109.5
20	E	76.8	Confident	72.2	Confident	175 Å²	175	150 Å²	150	82%	0.818	82%	0.816	S	S	*	*	P	Polyproline II helix	trans	-56.6	138.8	177.3	-78.4	-106	109.1	0	0	111.3
21	P	68.7	Low	71.6	Confident	110 Å²	110	152.4 Å²	152.4	71%	0.714	82%	0.819	S	S	*	*	P	Polyproline II helix	trans	-67.4	137.3	-179.9	26.7	-32	0	0	0	111.2	E23	P21-E23 PolarHBondContact O-N 2.86Å
22	T	72.2	Confident	70.6	Confident	141 Å²	141	152 Å²	152	87%	0.865	82%	0.817	S	S	*	*	P	Polyproline II helix	trans	-59.7	127.8	171.2	-48.1	0	0	0	0	110
23	E	76.1	Confident	70	Confident	174 Å²	174	149.5 Å²	149.5	81%	0.813	80%	0.801	S	S	*	*	P	Polyproline II helix	trans	-59.8	143.7	176.5	-66	-152.2	124.2	0	0	111.7	P21	P21-E23 PolarHBondContact O-N 2.86Å
24	P	64.8	Low	69.1	Low	121 Å²	121	144.6 Å²	144.6	79%	0.786	79%	0.791	S	S	*	*	P	Polyproline II helix	trans	-65.2	143.1	178.9	27	-32.4	0	0	0	110.7	E26	P24-E26 PolarHBondContact O-N 3.36Å
25	M	63.3	Low	68	Low	190 Å²	190	147.6 Å²	147.6	94%	0.936	79%	0.794	S	S	*	*	P	Polyproline II helix	trans	-60	131.7	174.3	-161.2	172.1	-176.7	0	0	109.6
26	E	64.6	Low	67	Low	177 Å²	177	147.8 Å²	147.8	83%	0.827	80%	0.799	S	S	*	*	P	Polyproline II helix	trans	-58.8	140.5	-179.8	-81.2	-139.7	120.5	0	0	111.7	P24 T28	P24-E26 PolarHBondContact O-N 3.36Å; E26-T28 PolarHBondContact O-N 3.26Å
27	P	64	Low	65.8	Low	113 Å²	113	143.9 Å²	143.9	73%	0.734	78%	0.78	S	S	*	*	P	Polyproline II helix	trans	-62.1	138	176.6	25.8	-31.8	0	0	0	110.2	E29	P27-E29 PolarHBondContact O-N 3.36Å
28	T	64.8	Low	64.7	Low	138 Å²	138	142.6 Å²	142.6	85%	0.847	77%	0.774	S	S	*	*	P	Polyproline II helix	trans	-59.2	126.6	174.1	-54.7	0	0	0	0	109.7	E26	E26-T28 PolarHBondContact O-N 3.26Å
29	E	66.9	Low	64	Low	176 Å²	176	148.1 Å²	148.1	82%	0.822	78%	0.78	S	S	*	*	P	Polyproline II helix	trans	-57.3	137.3	-179.6	-69.4	-162.4	134.2	0	0	111.6	P27	P27-E29 PolarHBondContact O-N 3.36Å
30	P	64.8	Low	63.7	Low	101 Å²	101	141.5 Å²	141.5	66%	0.656	76%	0.759	S	S	*	*	P	Polyproline II helix	trans	-68.8	135.6	179.3	27.1	-31.3	0	0	0	110.6	E32	P30-E32 PolarHBondContact O-N 3.46Å
31	M	64.6	Low	63.6	Low	190 Å²	190	134.3 Å²	134.3	94%	0.936	73%	0.732	S	S	*	*	P	Polyproline II helix	trans	-63.4	126	177.9	-160.2	167.4	-164	0	0	110.3
32	E	60.9	Low	64	Low	167 Å²	167	132.9 Å²	132.9	78%	0.78	72%	0.715	S	S	*	*	P	Polyproline II helix	trans	-52.9	129.6	-177.4	-81.1	-164	126.3	0	0	112	P30	P30-E32 PolarHBondContact O-N 3.46Å
33	P	60.5	Low	64.5	Low	68 Å²	68	129 Å²	129	44%	0.442	70%	0.698	S	S	.	*	P	Polyproline II helix	trans	-70.5	134.6	176.4	28	-31.5	0	0	0	110.5	R35 L45	P33-R35 PolarHBondContact O-N 3.5Å; P33-L45 HydrophobicContact CB-CD1 4.1Å; P33-L45 HydrophobicContact CG-CD1 4.41Å
34	A	58.3	Low	64.9	Low	86 Å²	86	126.1 Å²	126.1	71%	0.711	69%	0.688	S	S	*	*	P	Polyproline II helix	trans	-56.4	130.6	177.7	0	0	0	0	0	111.3	S36	A34-S36 PolarHBondContact O-N 3.12Å
35	R	56	Low	65.8	Low	238 Å²	238	124.5 Å²	124.5	90%	0.898	67%	0.672	S	S	*	*	T	Hydrogen-bonded Turn	trans	-60.7	37.7	-165.5	-70.3	-178.7	176.2	152.9	1.9	118.5	P33	P33-R35 PolarHBondContact O-N 3.5Å
36	S	52.8	Low	66.8	Low	115 Å²	115	124.3 Å²	124.3	80%	0.804	66%	0.661	S	S	*	*	T	Hydrogen-bonded Turn	trans	-127.9	3.1	-179.1	58.5	0	0	0	0	116.7	A34	A34-S36 PolarHBondContact O-N 3.12Å
37	A	53.9	Low	68.1	Low	57 Å²	57	121.7 Å²	121.7	47%	0.471	65%	0.649	S	S	.	*			trans	-117.1	32.2	-177.9	0	0	0	0	0	114.8	R39 G41	A37-R39 PolarHBondContact O-N 3.44Å; A37-G41 PolarHBondContact O-N 2.82Å
38	H	57.8	Low	69.4	Low	152 Å²	152	121.2 Å²	121.2	70%	0.704	64%	0.639	S	S	*	*	T	Hydrogen-bonded Turn	trans	-73.3	30	-159.9	-168.4	52.5	0	0	0	117.6	E42	H38-E42 IonicContact CE1-OE2 3.44Å; H38-E42 PolarHBondContact CE1-OE2 2.84Å; H38-E42 IonicContact CG-OE2 3.95Å; H38-E42 IonicContact ND1-OE2 2.82Å; H38-E42 PolarHBondContact ND1-OE2 3.19Å
39	R	59	Low	70.7	Confident	235 Å²	235	119.1 Å²	119.1	89%	0.887	62%	0.62	S	S	*	*	T	Hydrogen-bonded Turn	trans	-150	-40	166	-148.8	173.8	-146.4	-178	6.1	114.7	A37	A37-R39 PolarHBondContact O-N 3.44Å
40	G	66.5	Low	71.9	Confident	48 Å²	48	115.3 Å²	115.3	50%	0.495	61%	0.608	S	S	.	*	T	Hydrogen-bonded Turn	trans	-92.6	-39.6	177	0	0	0	0	0	113	A43 L44	G40-A43 PolarHBondContact O-N 3.43Å; G40-L44 WeakPolarHBondContact O-CG 3.37Å; G40-L44 PolarHBondContact O-N 3.41Å
41	G	75.6	Confident	73	Confident	23 Å²	23	115.3 Å²	115.3	24%	0.237	60%	0.602	C	S	.	*	H	α-helix	trans	-67.8	-41.1	-176.2	0	0	0	0	0	112.6	A37 A43 L44 L45	A37-G41 PolarHBondContact O-N 2.82Å; G41-A43 PolarHBondContact O-N 2.93Å; G41-L44 PolarHBondContact O-N 3.36Å; G41-L45 WeakPolarHBondContact O-CB 3.46Å; G41-L45 VanDerWaalsContact O-CG 3.3Å; G41-L45 WeakPolarHBondContact O-CG 3.27Å; G41-L45 PolarHBondContact O-N 2.88Å
42	E	77	Confident	74.3	Confident	80 Å²	80	110 Å²	110	37%	0.374	58%	0.58	S	S	.	*	H	α-helix	trans	-69.7	-32	-178.9	-55	-156.4	116	0	0	112.7	H38 R46	H38-E42 IonicContact CE1-OE2 3.44Å; H38-E42 PolarHBondContact CE1-OE2 2.84Å; H38-E42 IonicContact CG-OE2 3.95Å; H38-E42 IonicContact ND1-OE2 2.82Å; H38-E42 PolarHBondContact ND1-OE2 3.19Å; E42-R46 VanDerWaalsContact O-CG 3.3Å; E42-R46 WeakPolarHBondContact O-CG 3.3Å; E42-R46 PolarHBondContact O-N 2.86Å; E42-R46 VanDerWaalsContact O-N 3.12Å
43	A	82.6	Confident	75.4	Confident	61 Å²	61	107.1 Å²	107.1	50%	0.504	57%	0.567	S	S	.	*	H	α-helix	trans	-67.7	-43.8	174	0	0	0	0	0	111.7	G40 G41 R46 E47	G40-A43 PolarHBondContact O-N 3.43Å; G41-A43 PolarHBondContact O-N 2.93Å; A43-R46 PolarHBondContact O-N 3.4Å; A43-E47 WeakPolarHBondContact O-CB 3.45Å; A43-E47 PolarHBondContact O-N 3.29Å
44	L	83.8	Confident	76.7	Confident	113 Å²	113	107.9 Å²	107.9	59%	0.592	57%	0.567	S	S	*	*	H	α-helix	trans	-66.7	-37.1	177	-70.6	170	0	0	0	112.4	G40 G41 E47 L48	G40-L44 WeakPolarHBondContact O-CG 3.37Å; G40-L44 PolarHBondContact O-N 3.41Å; G41-L44 PolarHBondContact O-N 3.36Å; L44-E47 PolarHBondContact O-N 2.97Å; L44-L48 VanDerWaalsContact O-CB 3.27Å; L44-L48 WeakPolarHBondContact O-CB 3.47Å; L44-L48 PolarHBondContact O-N 2.82Å
45	L	84.3	Confident	78.1	Confident	86 Å²	86	107.7 Å²	107.7	45%	0.45	56%	0.557	S	S	.	*	H	α-helix	trans	-64	-42.6	175	-76.1	168.6	0	0	0	111.5	P33 G41 L48 E49	P33-L45 HydrophobicContact CB-CD1 4.1Å; P33-L45 HydrophobicContact CG-CD1 4.41Å; G41-L45 WeakPolarHBondContact O-CB 3.46Å; G41-L45 VanDerWaalsContact O-CG 3.3Å; G41-L45 WeakPolarHBondContact O-CG 3.27Å; G41-L45 PolarHBondContact O-N 2.88Å; L45-L48 PolarHBondContact O-N 2.88Å; L45-E49 WeakPolarHBondContact O-CB 3.49Å; L45-E49 PolarHBondContact O-N 3.44Å
46	R	84.2	Confident	79.5	Confident	187 Å²	187	100.7 Å²	100.7	71%	0.706	54%	0.54	S	S	*	.	H	α-helix	trans	-66.4	-38.3	175.3	-68.2	-173.6	99.9	-128.6	-0.3	112.3	E42 A43 E49 V50	E42-R46 VanDerWaalsContact O-CG 3.3Å; E42-R46 WeakPolarHBondContact O-CG 3.3Å; E42-R46 PolarHBondContact O-N 2.86Å; E42-R46 VanDerWaalsContact O-N 3.12Å; A43-R46 PolarHBondContact O-N 3.4Å; R46-E49 PolarHBondContact O-N 3.49Å; R46-V50 WeakPolarHBondContact O-CB 3.3Å; R46-V50 VanDerWaalsContact O-CG2 3.25Å; R46-V50 WeakPolarHBondContact O-CG2 3.28Å; R46-V50 PolarHBondContact O-N 2.76Å
47	E	91.8	Very high	80.8	Confident	122 Å²	122	103.6 Å²	103.6	57%	0.57	53%	0.534	S	S	*	.	H	α-helix	trans	-66.9	-42.5	177	-158.5	178.9	-152.7	0	0	111.4	A43 L44 V50 L51	A43-E47 WeakPolarHBondContact O-CB 3.45Å; A43-E47 PolarHBondContact O-N 3.29Å; L44-E47 PolarHBondContact O-N 2.97Å; E47-V50 PolarHBondContact O-N 3.35Å; E47-L51 WeakPolarHBondContact O-CG 3.33Å; E47-L51 PolarHBondContact O-N 2.84Å
48	L	91.9	Very high	82.1	Confident	103 Å²	103	104.8 Å²	104.8	54%	0.539	54%	0.535	S	S	.	.	H	α-helix	trans	-61.6	-43.4	173	-178.3	65.7	0	0	0	111.5	L44 L45 L51 V52	L44-L48 VanDerWaalsContact O-CB 3.27Å; L44-L48 WeakPolarHBondContact O-CB 3.47Å; L44-L48 PolarHBondContact O-N 2.82Å; L45-L48 PolarHBondContact O-N 2.88Å; L48-L51 PolarHBondContact O-N 3.38Å; L48-V52 HydrophobicContact CD1-CG2 4.41Å; L48-V52 HydrophobicContact CG-CG2 4.45Å; L48-V52 WeakPolarHBondContact O-CB 3.32Å; L48-V52 VanDerWaalsContact O-CG2 3.29Å; L48-V52 WeakPolarHBondContact O-CG2 3.25Å; L48-V52 PolarHBondContact O-N 3.34Å
49	E	91.5	Very high	82.6	Confident	93 Å²	93	100.4 Å²	100.4	44%	0.435	52%	0.522	S	S	.	.	H	α-helix	trans	-65.9	-40.5	178.7	-175.1	162.8	-164.3	0	0	112.1	L45 R46 L51 V52 Q53	L45-E49 WeakPolarHBondContact O-CB 3.49Å; L45-E49 PolarHBondContact O-N 3.44Å; R46-E49 PolarHBondContact O-N 3.49Å; E49-L51 VanDerWaalsContact C-N 3.34Å; E49-L51 PolarHBondContact O-N 3.14Å; E49-V52 PolarHBondContact O-N 2.89Å; E49-Q53 HydrophobicContact CG-CG 4.48Å; E49-Q53 WeakPolarHBondContact O-CB 3.23Å; E49-Q53 VanDerWaalsContact O-CG 3.27Å; E49-Q53 WeakPolarHBondContact O-CG 3.47Å; E49-Q53 PolarHBondContact O-N 3.44Å
50	V	92.1	Very high	82.9	Confident	96 Å²	96	91.9 Å²	91.9	58%	0.582	50%	0.498	S	S	*	.	H	α-helix	trans	-60.9	-44.1	172.7	168.7	0	0	0	0	110.9	R46 E47 Q53 D54	R46-V50 WeakPolarHBondContact O-CB 3.3Å; R46-V50 VanDerWaalsContact O-CG2 3.25Å; R46-V50 WeakPolarHBondContact O-CG2 3.28Å; R46-V50 PolarHBondContact O-N 2.76Å; E47-V50 PolarHBondContact O-N 3.35Å; V50-Q53 PolarHBondContact O-N 2.67Å; V50-D54 VanDerWaalsContact O-CB 3.32Å; V50-D54 WeakPolarHBondContact O-CB 3.24Å; V50-D54 PolarHBondContact O-N 3.1Å
51	L	88.4	Confident	83	Confident	101 Å²	101	97.3 Å²	97.3	53%	0.529	50%	0.504	S	S	.	.	H	α-helix	trans	-65.2	-42.9	176.9	-75.6	166.8	0	0	0	112.3	E47 L48 E49 D54 V55	E47-L51 WeakPolarHBondContact O-CG 3.33Å; E47-L51 PolarHBondContact O-N 2.84Å; L48-L51 PolarHBondContact O-N 3.38Å; E49-L51 VanDerWaalsContact C-N 3.34Å; E49-L51 PolarHBondContact O-N 3.14Å; L51-D54 PolarHBondContact O-N 3.3Å; L51-V55 WeakPolarHBondContact O-CB 3.47Å; L51-V55 VanDerWaalsContact O-CG2 3.28Å; L51-V55 WeakPolarHBondContact O-CG2 3.42Å; L51-V55 PolarHBondContact O-N 3.17Å
52	V	91.6	Very high	82.5	Confident	79 Å²	79	104.9 Å²	104.9	48%	0.479	53%	0.525	S	S	.	.	H	α-helix	trans	-63.2	-45.1	175.9	168.5	0	0	0	0	110.2	L48 E49 D54 V55 V56	L48-V52 HydrophobicContact CD1-CG2 4.41Å; L48-V52 HydrophobicContact CG-CG2 4.45Å; L48-V52 WeakPolarHBondContact O-CB 3.32Å; L48-V52 VanDerWaalsContact O-CG2 3.29Å; L48-V52 WeakPolarHBondContact O-CG2 3.25Å; L48-V52 PolarHBondContact O-N 3.34Å; E49-V52 PolarHBondContact O-N 2.89Å; V52-D54 VanDerWaalsContact C-N 3.31Å; V52-D54 PolarHBondContact O-N 2.7Å; V52-V55 PolarHBondContact O-N 2.83Å; V52-V56 HydrophobicContact CG1-CG2 4.27Å; V52-V56 WeakPolarHBondContact O-CB 3.29Å; V52-V56 VanDerWaalsContact O-CG2 3.23Å; V52-V56 WeakPolarHBondContact O-CG2 3.46Å; V52-V56 PolarHBondContact O-N 2.82Å
53	Q	84.4	Confident	82.1	Confident	106 Å²	106	107.6 Å²	107.6	50%	0.495	54%	0.538	S	S	.	.	H	α-helix	trans	-63.3	-37.1	176.3	-75.1	-177.6	10.1	0	0	112.1	E49 V50 R57	E49-Q53 HydrophobicContact CG-CG 4.48Å; E49-Q53 WeakPolarHBondContact O-CB 3.23Å; E49-Q53 VanDerWaalsContact O-CG 3.27Å; E49-Q53 WeakPolarHBondContact O-CG 3.47Å; E49-Q53 PolarHBondContact O-N 3.44Å; V50-Q53 PolarHBondContact O-N 2.67Å; Q53-R57 VanDerWaalsContact O-CB 3.24Å; Q53-R57 WeakPolarHBondContact O-CB 3.27Å; Q53-R57 PolarHBondContact O-N 3.1Å
54	D	87.9	Confident	81.5	Confident	85 Å²	85	113.9 Å²	113.9	46%	0.455	55%	0.549	S	S	.	.	H	α-helix	trans	-66.8	-44.2	175.9	-168	66.3	0	0	0	111.7	V50 L51 V52 R57 T58	V50-D54 VanDerWaalsContact O-CB 3.32Å; V50-D54 WeakPolarHBondContact O-CB 3.24Å; V50-D54 PolarHBondContact O-N 3.1Å; L51-D54 PolarHBondContact O-N 3.3Å; V52-D54 VanDerWaalsContact C-N 3.31Å; V52-D54 PolarHBondContact O-N 2.7Å; D54-R57 PolarHBondContact O-N 2.72Å; D54-T58 PolarHBondContact O-N 3.12Å; D54-T58 PolarHBondContact O-OG1 3.23Å
55	V	86.7	Confident	81.1	Confident	82 Å²	82	113 Å²	113	50%	0.497	54%	0.541	S	S	.	.	H	α-helix	trans	-63.6	-43.4	174.6	171.3	0	0	0	0	111.5	L51 V52 R57 T58 S59	L51-V55 WeakPolarHBondContact O-CB 3.47Å; L51-V55 VanDerWaalsContact O-CG2 3.28Å; L51-V55 WeakPolarHBondContact O-CG2 3.42Å; L51-V55 PolarHBondContact O-N 3.17Å; V52-V55 PolarHBondContact O-N 2.83Å; V55-R57 VanDerWaalsContact C-N 3.35Å; V55-T58 VanDerWaalsContact CA-OG1 3.23Å; V55-T58 WeakPolarHBondContact CA-OG1 3.23Å; V55-T58 PolarHBondContact O-N 3.42Å; V55-T58 PolarHBondContact O-OG1 2.72Å; V55-T58 VanDerWaalsContact O-OG1 3.1Å; V55-S59 VanDerWaalsContact O-CB 3.23Å; V55-S59 WeakPolarHBondContact O-CB 3.37Å; V55-S59 PolarHBondContact O-N 2.86Å; V55-S59 PolarHBondContact O-OG 3.42Å
56	V	86.7	Confident	80.9	Confident	90 Å²	90	109.9 Å²	109.9	55%	0.545	53%	0.53	S	S	.	.	H	α-helix	trans	-64.1	-41.9	176.9	167.6	0	0	0	0	110.4	V52 S59 S60	V52-V56 HydrophobicContact CG1-CG2 4.27Å; V52-V56 WeakPolarHBondContact O-CB 3.29Å; V52-V56 VanDerWaalsContact O-CG2 3.23Å; V52-V56 WeakPolarHBondContact O-CG2 3.46Å; V52-V56 PolarHBondContact O-N 2.82Å; V56-S59 PolarHBondContact O-N 3.33Å; V56-S60 VanDerWaalsContact O-CB 3.27Å; V56-S60 WeakPolarHBondContact O-CB 3.29Å; V56-S60 PolarHBondContact O-N 2.83Å; V56-S60 PolarHBondContact O-OG 3.38Å
57	R	79.1	Confident	80.8	Confident	177 Å²	177	105 Å²	105	67%	0.668	52%	0.521	S	S	*	.	H	α-helix	trans	-65.5	-42.6	175.8	-175.1	-175.5	-79.5	143.3	-5.5	111.9	Q53 D54 V55 S59 S60 W61	Q53-R57 VanDerWaalsContact O-CB 3.24Å; Q53-R57 WeakPolarHBondContact O-CB 3.27Å; Q53-R57 PolarHBondContact O-N 3.1Å; D54-R57 PolarHBondContact O-N 2.72Å; V55-R57 VanDerWaalsContact C-N 3.35Å; R57-S59 VanDerWaalsContact C-N 3.35Å; R57-S60 WeakPolarHBondContact CA-OG 3.32Å; R57-S60 PolarHBondContact O-OG 3.04Å; R57-S60 VanDerWaalsContact O-OG 3.14Å; R57-W61 WeakPolarHBondContact O-CB 3.23Å; R57-W61 PolarHBondContact O-N 3.24Å; R57-W61 VanDerWaalsContact O-N 3.17Å
58	T	80.8	Confident	80.4	Confident	81 Å²	81	103.3 Å²	103.3	50%	0.497	52%	0.516	S	S	.	.	H	α-helix	trans	-67.9	-34.9	176.5	31.2	0	0	0	0	112.3	D54 V55	D54-T58 PolarHBondContact O-N 3.12Å; D54-T58 PolarHBondContact O-OG1 3.23Å; V55-T58 VanDerWaalsContact CA-OG1 3.23Å; V55-T58 WeakPolarHBondContact CA-OG1 3.23Å; V55-T58 PolarHBondContact O-N 3.42Å; V55-T58 PolarHBondContact O-OG1 2.72Å; V55-T58 VanDerWaalsContact O-OG1 3.1Å
59	S	69.8	Low	80	Confident	60 Å²	60	102.3 Å²	102.3	42%	0.42	52%	0.517	S	S	.	.	H	α-helix	trans	-72.8	-45	177.5	-56.7	0	0	0	0	112.1	V55 V56 R57 W61 W62 E63	V55-S59 VanDerWaalsContact O-CB 3.23Å; V55-S59 WeakPolarHBondContact O-CB 3.37Å; V55-S59 PolarHBondContact O-N 2.86Å; V55-S59 PolarHBondContact O-OG 3.42Å; V56-S59 PolarHBondContact O-N 3.33Å; R57-S59 VanDerWaalsContact C-N 3.35Å; S59-W61 VanDerWaalsContact C-N 3.33Å; S59-W61 PolarHBondContact O-N 2.88Å; S59-W62 PolarHBondContact O-N 3.46Å; S59-W62 VanDerWaalsContact O-N 3.12Å; S59-E63 PolarHBondContact O-N 3.36Å
60	S	65.1	Low	79.7	Confident	56 Å²	56	100.8 Å²	100.8	39%	0.392	52%	0.52	S	S	.	.	H	α-helix	trans	-67.2	-30.8	-180	53.4	0	0	0	0	113.3	V56 R57 W62 R64	V56-S60 VanDerWaalsContact O-CB 3.27Å; V56-S60 WeakPolarHBondContact O-CB 3.29Å; V56-S60 PolarHBondContact O-N 2.83Å; V56-S60 PolarHBondContact O-OG 3.38Å; R57-S60 WeakPolarHBondContact CA-OG 3.32Å; R57-S60 PolarHBondContact O-OG 3.04Å; R57-S60 VanDerWaalsContact O-OG 3.14Å; S60-W62 VanDerWaalsContact C-N 3.34Å; S60-R64 PolarHBondContact O-N 2.98Å
61	W	68.6	Low	79.5	Confident	163 Å²	163	100.5 Å²	100.5	62%	0.617	51%	0.514	S	S	*	.	H	α-helix	trans	-63.8	-39.7	170.9	-175	81.4	0	0	0	111.9	R57 S59 H65	R57-W61 WeakPolarHBondContact O-CB 3.23Å; R57-W61 PolarHBondContact O-N 3.24Å; R57-W61 VanDerWaalsContact O-N 3.17Å; S59-W61 VanDerWaalsContact C-N 3.33Å; S59-W61 PolarHBondContact O-N 2.88Å; W61-H65 AromaticContact CE2-CD2 3.76Å; W61-H65 AromaticContact NE1-CD2 3.62Å; W61-H65 AromaticContact NE1-NE2 3.86Å; W61-H65 PolarHBondContact O-N 2.88Å
62	W	63.9	Low	79.5	Confident	181 Å²	181	101.4 Å²	101.4	69%	0.686	52%	0.519	S	S	*	.	H	α-helix	trans	-75.1	-31.9	178.8	-131.8	87.7	0	0	0	112.8	S59 S60 G66	S59-W62 PolarHBondContact O-N 3.46Å; S59-W62 VanDerWaalsContact O-N 3.12Å; S60-W62 VanDerWaalsContact C-N 3.34Å; W62-G66 WeakPolarHBondContact O-CA 3.27Å; W62-G66 PolarHBondContact O-N 2.88Å
63	E	68.9	Low	79.5	Confident	138 Å²	138	100.5 Å²	100.5	65%	0.645	52%	0.519	S	S	*	.	H	α-helix	trans	-68.5	-40.4	175.4	-77.7	178	149.4	0	0	112.2	S59 V67	S59-E63 PolarHBondContact O-N 3.36Å; E63-V67 WeakPolarHBondContact O-CB 3.16Å; E63-V67 WeakPolarHBondContact O-CG2 3.41Å; E63-V67 PolarHBondContact O-N 3.28Å
64	R	70.9	Confident	79.8	Confident	193 Å²	193	101.5 Å²	101.5	73%	0.728	53%	0.528	S	S	*	.	H	α-helix	trans	-78.4	-21.1	-179.8	-163.9	175.3	-106.7	-102.5	5.2	113.7	S60	S60-R64 PolarHBondContact O-N 2.98Å
65	H	73.7	Confident	80	Confident	93 Å²	93	100.1 Å²	100.1	43%	0.431	52%	0.524	S	S	.	.	H	α-helix	trans	-107.5	-29.5	177.3	-68.2	-9.4	0	0	0	113	W61 C69	W61-H65 AromaticContact CE2-CD2 3.76Å; W61-H65 AromaticContact NE1-CD2 3.62Å; W61-H65 AromaticContact NE1-NE2 3.86Å; W61-H65 PolarHBondContact O-N 2.88Å; H65-C69 VanDerWaalsContact O-CB 3.29Å; H65-C69 WeakPolarHBondContact O-CB 3.24Å; H65-C69 PolarHBondContact O-N 3.48Å; H65-C69 PolarHBondContact O-SG 3.31Å
66	G	81.2	Confident	80.3	Confident	21 Å²	21	102.7 Å²	102.7	22%	0.216	53%	0.534	C	S	.	.	H	α-helix	trans	-71.6	-43.6	179.1	0	0	0	0	0	112.5	W62 A70	W62-G66 WeakPolarHBondContact O-CA 3.27Å; W62-G66 PolarHBondContact O-N 2.88Å; G66-A70 VanDerWaalsContact O-CB 3.27Å; G66-A70 WeakPolarHBondContact O-CB 3.27Å; G66-A70 PolarHBondContact O-N 3.08Å
67	V	82.4	Confident	80.4	Confident	84 Å²	84	106 Å²	106	51%	0.509	54%	0.542	S	S	.	.	H	α-helix	trans	-66.5	-44.9	178.8	175	0	0	0	0	110.9	E63 A70 I71	E63-V67 WeakPolarHBondContact O-CB 3.16Å; E63-V67 WeakPolarHBondContact O-CG2 3.41Å; E63-V67 PolarHBondContact O-N 3.28Å; V67-A70 PolarHBondContact O-N 3.35Å; V67-I71 HydrophobicContact CG1-CD1 3.72Å; V67-I71 HydrophobicContact CG1-CG1 4.35Å; V67-I71 VanDerWaalsContact O-CG1 3.26Å; V67-I71 WeakPolarHBondContact O-CG1 3.36Å; V67-I71 PolarHBondContact O-N 3.49Å
68	D	83.5	Confident	80.9	Confident	88 Å²	88	100.2 Å²	100.2	47%	0.471	53%	0.532	S	S	.	.	H	α-helix	trans	-62.9	-45.3	176.9	-73.2	-37.8	0	0	0	111.7	A70 I71 L72	D68-A70 VanDerWaalsContact C-N 3.31Å; D68-A70 PolarHBondContact O-N 3.39Å; D68-I71 PolarHBondContact O-N 3.49Å; D68-L72 WeakPolarHBondContact O-CB 3.26Å; D68-L72 VanDerWaalsContact O-CG 3.24Å; D68-L72 WeakPolarHBondContact O-CG 3.35Å; D68-L72 PolarHBondContact O-N 2.9Å
69	C	83.8	Confident	81.2	Confident	82 Å²	82	102 Å²	102	55%	0.554	54%	0.538	S	S	*	.	H	α-helix	trans	-61.3	-39.2	174.8	-71.5	0	0	0	0	112.3	H65 L72 A73	H65-C69 VanDerWaalsContact O-CB 3.29Å; H65-C69 WeakPolarHBondContact O-CB 3.24Å; H65-C69 PolarHBondContact O-N 3.48Å; H65-C69 PolarHBondContact O-SG 3.31Å; C69-L72 PolarHBondContact O-N 3.42Å; C69-A73 VanDerWaalsContact O-CB 3.24Å; C69-A73 WeakPolarHBondContact O-CB 3.24Å; C69-A73 PolarHBondContact O-N 2.9Å
70	A	85.1	Confident	82	Confident	60 Å²	60	102.7 Å²	102.7	50%	0.496	54%	0.541	S	S	.	.	H	α-helix	trans	-66.1	-42.8	177.1	0	0	0	0	0	111.7	G66 V67 D68 A73 L74	G66-A70 VanDerWaalsContact O-CB 3.27Å; G66-A70 WeakPolarHBondContact O-CB 3.27Å; G66-A70 PolarHBondContact O-N 3.08Å; V67-A70 PolarHBondContact O-N 3.35Å; D68-A70 VanDerWaalsContact C-N 3.31Å; D68-A70 PolarHBondContact O-N 3.39Å; A70-A73 PolarHBondContact O-N 3.44Å; A70-L74 VanDerWaalsContact O-CB 3.27Å; A70-L74 WeakPolarHBondContact O-CB 3.27Å; A70-L74 PolarHBondContact O-N 3.06Å
71	I	86.6	Confident	82.9	Confident	91 Å²	91	102.2 Å²	102.2	47%	0.467	54%	0.54	S	S	.	.	H	α-helix	trans	-63.3	-44.8	175.6	-68.3	166.1	0	0	0	110.5	V67 D68 L74 S75	V67-I71 HydrophobicContact CG1-CD1 3.72Å; V67-I71 HydrophobicContact CG1-CG1 4.35Å; V67-I71 VanDerWaalsContact O-CG1 3.26Å; V67-I71 WeakPolarHBondContact O-CG1 3.36Å; V67-I71 PolarHBondContact O-N 3.49Å; D68-I71 PolarHBondContact O-N 3.49Å; I71-L74 PolarHBondContact O-N 3.35Å; I71-S75 VanDerWaalsContact O-CB 3.3Å; I71-S75 WeakPolarHBondContact O-CB 3.42Å; I71-S75 PolarHBondContact O-N 3.3Å; I71-S75 PolarHBondContact O-OG 3.45Å
72	L	89.9	Confident	83.7	Confident	120 Å²	120	96.2 Å²	96.2	63%	0.628	53%	0.53	S	S	*	.	H	α-helix	trans	-64.1	-44.1	178.2	-70.4	175	0	0	0	111.6	D68 C69 S75 L76	D68-L72 WeakPolarHBondContact O-CB 3.26Å; D68-L72 VanDerWaalsContact O-CG 3.24Å; D68-L72 WeakPolarHBondContact O-CG 3.35Å; D68-L72 PolarHBondContact O-N 2.9Å; C69-L72 PolarHBondContact O-N 3.42Å; L72-S75 PolarHBondContact O-N 2.88Å; L72-L76 WeakPolarHBondContact O-CB 2.85Å; L72-L76 PolarHBondContact O-N 3.24Å
73	A	91	Very high	84.8	Confident	59 Å²	59	92.3 Å²	92.3	49%	0.488	53%	0.525	S	S	.	.	H	α-helix	trans	-63.5	-43.8	176.6	0	0	0	0	0	111.8	C69 A70 S75 L76 F77	C69-A73 VanDerWaalsContact O-CB 3.24Å; C69-A73 WeakPolarHBondContact O-CB 3.24Å; C69-A73 PolarHBondContact O-N 2.9Å; A70-A73 PolarHBondContact O-N 3.44Å; A73-S75 VanDerWaalsContact C-N 3.34Å; A73-S75 PolarHBondContact O-N 3.42Å; A73-L76 PolarHBondContact O-N 3.49Å; A73-F77 PolarHBondContact O-N 2.87Å; A73-F77 VanDerWaalsContact O-N 3.08Å
74	L	90.6	Very high	85.5	Confident	128 Å²	128	91.3 Å²	91.3	67%	0.67	52%	0.521	S	S	*	.	H	α-helix	trans	-64.1	-41.2	177.3	-162.8	73.2	0	0	0	111.1	A70 I71 F77 A78	A70-L74 VanDerWaalsContact O-CB 3.27Å; A70-L74 WeakPolarHBondContact O-CB 3.27Å; A70-L74 PolarHBondContact O-N 3.06Å; I71-L74 PolarHBondContact O-N 3.35Å; L74-F77 PolarHBondContact O-N 2.82Å; L74-A78 WeakPolarHBondContact O-CB 3.3Å; L74-A78 PolarHBondContact O-N 2.81Å
75	S	91.8	Very high	86.1	Confident	55 Å²	55	84.8 Å²	84.8	39%	0.385	51%	0.505	S	S	.	.	H	α-helix	trans	-64.7	-45.3	176.8	-58.9	0	0	0	0	111.9	I71 L72 A73 F77 A78 L79	I71-S75 VanDerWaalsContact O-CB 3.3Å; I71-S75 WeakPolarHBondContact O-CB 3.42Å; I71-S75 PolarHBondContact O-N 3.3Å; I71-S75 PolarHBondContact O-OG 3.45Å; L72-S75 PolarHBondContact O-N 2.88Å; A73-S75 VanDerWaalsContact C-N 3.34Å; A73-S75 PolarHBondContact O-N 3.42Å; S75-F77 PolarHBondContact O-N 2.74Å; S75-A78 PolarHBondContact O-N 3.42Å; S75-L79 WeakPolarHBondContact O-CB 3.2Å; S75-L79 VanDerWaalsContact O-CG 3.25Å; S75-L79 WeakPolarHBondContact O-CG 3.49Å; S75-L79 PolarHBondContact O-N 3.39Å
76	L	94	Very high	86.5	Confident	136 Å²	136	86 Å²	86	71%	0.712	51%	0.513	S	S	*	.	H	α-helix	trans	-60.2	-34.1	176.7	-179.8	64.8	0	0	0	112.2	L72 A73 P80	L72-L76 WeakPolarHBondContact O-CB 2.85Å; L72-L76 PolarHBondContact O-N 3.24Å; A73-L76 PolarHBondContact O-N 3.49Å; L76-P80 WeakPolarHBondContact O-CD 3.25Å; L76-P80 VanDerWaalsContact O-CG 3.23Å; L76-P80 WeakPolarHBondContact O-CG 3.23Å
77	F	88.8	Confident	86.7	Confident	159 Å²	159	90.1 Å²	90.1	70%	0.697	53%	0.527	S	S	*	.	H	α-helix	trans	-85.9	-34.6	178.7	-167.2	-97.6	0	0	0	113.1	A73 L74 S75 P80 A81	A73-F77 PolarHBondContact O-N 2.87Å; A73-F77 VanDerWaalsContact O-N 3.08Å; L74-F77 PolarHBondContact O-N 2.82Å; S75-F77 PolarHBondContact O-N 2.74Å; F77-P80 WeakPolarHBondContact O-CD 3.34Å; F77-P80 WeakPolarHBondContact O-CG 3.33Å; F77-A81 PolarHBondContact O-N 3.13Å
78	A	89.4	Confident	86.7	Confident	57 Å²	57	87.6 Å²	87.6	47%	0.471	51%	0.512	S	S	.	.	H	α-helix	trans	-70.4	-34.5	179.7	0	0	0	0	0	112.6	L74 S75 A81 G82	L74-A78 WeakPolarHBondContact O-CB 3.3Å; L74-A78 PolarHBondContact O-N 2.81Å; S75-A78 PolarHBondContact O-N 3.42Å; A78-A81 PolarHBondContact O-N 3.48Å; A78-G82 PolarHBondContact O-N 2.88Å
79	L	86.7	Confident	86.6	Confident	119 Å²	119	91.2 Å²	91.2	62%	0.623	52%	0.52	S	S	*	.	H	α-helix	trans	-59.7	-54.9	176.9	-74	169.6	0	0	0	113.6	S75 A81 G82 V83	S75-L79 WeakPolarHBondContact O-CB 3.2Å; S75-L79 VanDerWaalsContact O-CG 3.25Å; S75-L79 WeakPolarHBondContact O-CG 3.49Å; S75-L79 PolarHBondContact O-N 3.39Å; L79-A81 VanDerWaalsContact C-N 3.34Å; L79-A81 PolarHBondContact O-N 2.84Å; L79-G82 PolarHBondContact O-N 3.32Å; L79-V83 WeakPolarHBondContact O-CG2 3.45Å; L79-V83 PolarHBondContact O-N 2.89Å
80	P	85.8	Confident	86.5	Confident	73 Å²	73	89.6 Å²	89.6	47%	0.474	51%	0.512	S	S	.	.	H	α-helix	trans	-65.2	-36	177.9	23.5	-32	0	0	0	112.1	L76 F77 H84	L76-P80 WeakPolarHBondContact O-CD 3.25Å; L76-P80 VanDerWaalsContact O-CG 3.23Å; L76-P80 WeakPolarHBondContact O-CG 3.23Å; F77-P80 WeakPolarHBondContact O-CD 3.34Å; F77-P80 WeakPolarHBondContact O-CG 3.33Å; P80-H84 WeakPolarHBondContact O-CB 3.32Å; P80-H84 PolarHBondContact O-N 3.35Å
81	A	83.9	Confident	86.2	Confident	46 Å²	46	93.3 Å²	93.3	38%	0.38	51%	0.513	S	S	.	.	H	α-helix	trans	-64	-41	173.8	0	0	0	0	0	112	F77 A78 L79 S85	F77-A81 PolarHBondContact O-N 3.13Å; A78-A81 PolarHBondContact O-N 3.48Å; L79-A81 VanDerWaalsContact C-N 3.34Å; L79-A81 PolarHBondContact O-N 2.84Å; A81-S85 VanDerWaalsContact O-CB 3.3Å; A81-S85 WeakPolarHBondContact O-CB 3.25Å; A81-S85 PolarHBondContact O-N 3.16Å; A81-S85 PolarHBondContact O-OG 3.34Å
82	G	86	Confident	85.5	Confident	38 Å²	38	95.3 Å²	95.3	39%	0.392	52%	0.52	S	S	.	.	H	α-helix	trans	-65.7	-46.4	175.8	0	0	0	0	0	112.7	A78 L79 S85 L86	A78-G82 PolarHBondContact O-N 2.88Å; L79-G82 PolarHBondContact O-N 3.32Å; G82-S85 PolarHBondContact O-N 3.45Å; G82-L86 WeakPolarHBondContact O-CB 3.14Å; G82-L86 PolarHBondContact O-N 2.88Å
83	V	86.5	Confident	84.7	Confident	98 Å²	98	92 Å²	92	59%	0.594	51%	0.51	S	S	*	.	H	α-helix	trans	-62.4	-44.4	175.8	171.8	0	0	0	0	110.7	L79 S85 L86 H87	L79-V83 WeakPolarHBondContact O-CG2 3.45Å; L79-V83 PolarHBondContact O-N 2.89Å; V83-S85 VanDerWaalsContact C-N 3.34Å; V83-S85 PolarHBondContact O-N 3.29Å; V83-L86 PolarHBondContact O-N 3.24Å; V83-H87 VanDerWaalsContact O-CB 3.25Å; V83-H87 WeakPolarHBondContact O-CB 3.46Å; V83-H87 PolarHBondContact O-N 3.01Å
84	H	84.8	Confident	83.3	Confident	118 Å²	118	97.1 Å²	97.1	55%	0.546	52%	0.517	S	S	.	.	H	α-helix	trans	-62.7	-41.3	176.5	-166.7	84.7	0	0	0	111.7	P80 H87 C88	P80-H84 WeakPolarHBondContact O-CB 3.32Å; P80-H84 PolarHBondContact O-N 3.35Å; H84-H87 PolarHBondContact O-N 2.69Å; H84-C88 WeakPolarHBondContact O-CB 3.3Å; H84-C88 PolarHBondContact O-N 2.92Å; H84-C88 PolarHBondContact O-SG 3.38Å; H84-C88 VanDerWaalsContact O-SG 3.34Å
85	S	82.8	Confident	82.1	Confident	56 Å²	56	94.1 Å²	94.1	39%	0.392	51%	0.511	S	S	.	.	H	α-helix	trans	-66.3	-38	176.9	-59.3	0	0	0	0	112.8	A81 G82 V83 R89	A81-S85 VanDerWaalsContact O-CB 3.3Å; A81-S85 WeakPolarHBondContact O-CB 3.25Å; A81-S85 PolarHBondContact O-N 3.16Å; A81-S85 PolarHBondContact O-OG 3.34Å; G82-S85 PolarHBondContact O-N 3.45Å; V83-S85 VanDerWaalsContact C-N 3.34Å; V83-S85 PolarHBondContact O-N 3.29Å; S85-R89 WeakPolarHBondContact O-CB 3.46Å; S85-R89 WeakPolarHBondContact O-CG 3.34Å; S85-R89 PolarHBondContact O-N 2.82Å; S85-R89 PolarHBondContact O-NE 2.98Å
86	L	82.9	Confident	80.6	Confident	118 Å²	118	101.4 Å²	101.4	62%	0.618	53%	0.53	S	S	*	.	H	α-helix	trans	-70.5	-41	175.4	-157.5	76.3	0	0	0	110.9	G82 V83 R89 A90	G82-L86 WeakPolarHBondContact O-CB 3.14Å; G82-L86 PolarHBondContact O-N 2.88Å; V83-L86 PolarHBondContact O-N 3.24Å; L86-R89 PolarHBondContact O-N 2.83Å; L86-A90 WeakPolarHBondContact O-CB 3.44Å; L86-A90 PolarHBondContact O-N 2.93Å
87	H	85	Confident	78.9	Confident	107 Å²	107	102.6 Å²	102.6	50%	0.495	53%	0.532	S	S	.	.	H	α-helix	trans	-65.9	-41.8	176.6	-165	83	0	0	0	111.8	V83 H84 A90 R91	V83-H87 VanDerWaalsContact O-CB 3.25Å; V83-H87 WeakPolarHBondContact O-CB 3.46Å; V83-H87 PolarHBondContact O-N 3.01Å; H84-H87 PolarHBondContact O-N 2.69Å; H87-A90 PolarHBondContact O-N 2.84Å; H87-R91 PolarHBondContact CD2-NE 2.92Å; H87-R91 WeakPolarHBondContact O-CB 3.36Å; H87-R91 VanDerWaalsContact O-CG 3.28Å; H87-R91 WeakPolarHBondContact O-CG 3.37Å; H87-R91 PolarHBondContact O-N 3.46Å
88	C	81.8	Confident	77.3	Confident	31 Å²	31	100.2 Å²	100.2	21%	0.209	53%	0.526	C	S	.	.	H	α-helix	trans	-60.1	-46.9	171.1	-76.4	0	0	0	0	111.8	H84 A90 R91 H92	H84-C88 WeakPolarHBondContact O-CB 3.3Å; H84-C88 PolarHBondContact O-N 2.92Å; H84-C88 PolarHBondContact O-SG 3.38Å; H84-C88 VanDerWaalsContact O-SG 3.34Å; C88-A90 PolarHBondContact O-N 3.5Å; C88-R91 PolarHBondContact O-N 3.34Å; C88-R91 PolarHBondContact SG-NH2 3.48Å; C88-H92 PolarHBondContact O-CD2 3.41Å; C88-H92 PolarHBondContact O-N 2.83Å
89	R	82.3	Confident	75.6	Confident	165 Å²	165	100.1 Å²	100.1	62%	0.623	53%	0.525	S	S	*	.	H	α-helix	trans	-63.6	-39.7	177.1	-80.8	-175.7	-74	-152.6	0.8	112.9	S85 L86 H92 A93	S85-R89 WeakPolarHBondContact O-CB 3.46Å; S85-R89 WeakPolarHBondContact O-CG 3.34Å; S85-R89 PolarHBondContact O-N 2.82Å; S85-R89 PolarHBondContact O-NE 2.98Å; L86-R89 PolarHBondContact O-N 2.83Å; R89-H92 PolarHBondContact O-N 3.05Å; R89-A93 VanDerWaalsContact O-CB 3.31Å; R89-A93 WeakPolarHBondContact O-CB 3.28Å; R89-A93 PolarHBondContact O-N 3.29Å
90	A	82	Confident	74	Confident	48 Å²	48	99.5 Å²	99.5	40%	0.397	53%	0.529	S	S	.	.	H	α-helix	trans	-64.9	-42.7	176	0	0	0	0	0	111.6	L86 H87 C88 H92 A93 W94	L86-A90 WeakPolarHBondContact O-CB 3.44Å; L86-A90 PolarHBondContact O-N 2.93Å; H87-A90 PolarHBondContact O-N 2.84Å; C88-A90 PolarHBondContact O-N 3.5Å; A90-H92 PolarHBondContact O-N 3.14Å; A90-A93 PolarHBondContact O-N 3.38Å; A90-W94 PolarHBondContact O-N 2.94Å
91	R	77.6	Confident	72.7	Confident	137 Å²	137	102.1 Å²	102.1	52%	0.517	55%	0.547	S	S	.	.	H	α-helix	trans	-61.1	-43.2	173.7	-73.2	-172.5	-61.7	174.3	0.1	112.1	H87 C88 A95	H87-R91 PolarHBondContact CD2-NE 2.92Å; H87-R91 WeakPolarHBondContact O-CB 3.36Å; H87-R91 VanDerWaalsContact O-CG 3.28Å; H87-R91 WeakPolarHBondContact O-CG 3.37Å; H87-R91 PolarHBondContact O-N 3.46Å; C88-R91 PolarHBondContact O-N 3.34Å; C88-R91 PolarHBondContact SG-NH2 3.48Å; R91-A95 WeakPolarHBondContact O-CB 3.31Å; R91-A95 PolarHBondContact O-N 3.24Å
92	H	71.3	Confident	71.2	Confident	133 Å²	133	107.1 Å²	107.1	62%	0.616	57%	0.567	S	S	*	*	H	α-helix	trans	-68.7	-32.8	175	-79.9	-69.2	0	0	0	113.4	C88 R89 A90 R96	C88-H92 PolarHBondContact O-CD2 3.41Å; C88-H92 PolarHBondContact O-N 2.83Å; R89-H92 PolarHBondContact O-N 3.05Å; A90-H92 PolarHBondContact O-N 3.14Å; H92-R96 PolarHBondContact O-N 3.38Å; H92-R96 VanDerWaalsContact O-N 3.08Å
93	A	74.8	Confident	69.3	Low	50 Å²	50	112.3 Å²	112.3	41%	0.413	58%	0.58	S	S	.	*	H	α-helix	trans	-69.6	-43.4	176.5	0	0	0	0	0	111.5	R89 A90 R96 Q97	R89-A93 VanDerWaalsContact O-CB 3.31Å; R89-A93 WeakPolarHBondContact O-CB 3.28Å; R89-A93 PolarHBondContact O-N 3.29Å; A90-A93 PolarHBondContact O-N 3.38Å; A93-R96 PolarHBondContact O-N 2.86Å; A93-Q97 PolarHBondContact O-N 3.12Å; A93-Q97 VanDerWaalsContact O-N 3.11Å
94	W	60.8	Low	67.4	Low	168 Å²	168	115.5 Å²	115.5	64%	0.636	59%	0.589	S	S	*	*	H	α-helix	trans	-59.3	-46.9	170.7	-99.4	91.7	0	0	0	111.7	A90 R96 Q97 D98	A90-W94 PolarHBondContact O-N 2.94Å; W94-R96 PolarHBondContact O-N 3.18Å; W94-Q97 PolarHBondContact O-N 3.48Å; W94-D98 PolarHBondContact O-N 2.99Å
95	A	64.6	Low	65.8	Low	65 Å²	65	120 Å²	120	54%	0.537	60%	0.601	S	S	.	*	H	α-helix	trans	-61.9	-26.2	176.8	0	0	0	0	0	114	R91	R91-A95 WeakPolarHBondContact O-CB 3.31Å; R91-A95 PolarHBondContact O-N 3.24Å
96	R	60.4	Low	64	Low	207 Å²	207	120.2 Å²	120.2	78%	0.781	61%	0.612	S	S	*	*	H	α-helix	trans	-82	-21.9	172.6	-79.4	-143.6	-65.6	-109.2	2.1	113.6	H92 A93 W94	H92-R96 PolarHBondContact O-N 3.38Å; H92-R96 VanDerWaalsContact O-N 3.08Å; A93-R96 PolarHBondContact O-N 2.86Å; W94-R96 PolarHBondContact O-N 3.18Å
97	Q	58.8	Low	62.4	Low	162 Å²	162	118 Å²	118	76%	0.757	62%	0.618	S	S	*	*	H	α-helix	trans	-88.3	-29.2	-178.2	-149.4	147.2	78.9	0	0	111.5	A93 W94 A99	A93-Q97 PolarHBondContact O-N 3.12Å; A93-Q97 VanDerWaalsContact O-N 3.11Å; W94-Q97 PolarHBondContact O-N 3.48Å; Q97-A99 VanDerWaalsContact C-N 3.3Å
98	D	54.9	Low	60.8	Low	109 Å²	109	119.4 Å²	119.4	58%	0.583	64%	0.637	S	S	*	*	S	Bend	trans	-82.8	0.1	170	-72.5	-45.4	0	0	0	114	W94 P100	W94-D98 PolarHBondContact O-N 2.99Å; D98-P100 WeakPolarHBondContact O-CD 3.45Å
99	A	53.4	Low	59.5	Low	54 Å²	54	122 Å²	122	45%	0.446	67%	0.669	S	S	.	*	S	Bend	trans	-62.8	110.5	166.6	0	0	0	0	0	106.4	Q97 C101	Q97-A99 VanDerWaalsContact C-N 3.3Å; A99-C101 PolarHBondContact O-N 2.94Å
100	P	54.8	Low	57.8	Low	107 Å²	107	117.9 Å²	117.9	70%	0.695	68%	0.677	S	S	*	*			trans	-56.3	125	-176.3	22.6	-31.7	0	0	0	106.5	D98 L102	D98-P100 WeakPolarHBondContact O-CD 3.45Å; P100-L102 PolarHBondContact O-N 3.18Å
101	C	57.2	Low	56.5	Low	127 Å²	127	123.4 Å²	123.4	86%	0.858	70%	0.699	S	S	*	*			trans	-57.6	85	166.2	-67.1	0	0	0	0	106.6	A99 H103	A99-C101 PolarHBondContact O-N 2.94Å; C101-H103 PolarHBondContact O-N 3.11Å
102	L	52	Low	55.1	Low	152 Å²	152	125.1 Å²	125.1	80%	0.796	71%	0.713	S	S	*	*			trans	-65.5	84.5	162.3	-97	165.6	0	0	0	104.3	P100 Q104	P100-L102 PolarHBondContact O-N 3.18Å; L102-Q104 PolarHBondContact O-N 3.08Å
103	H	47.3	Very low	53.7	Low	147 Å²	147	126.6 Å²	126.6	68%	0.681	72%	0.72	S	S	*	*			trans	-50.5	88.2	158.6	-170.7	75.7	0	0	0	105.9	C101 R105	C101-H103 PolarHBondContact O-N 3.11Å; H103-R105 VanDerWaalsContact CD2-CB 3.42Å; H103-R105 WeakPolarHBondContact CD2-CB 3.45Å; H103-R105 PolarHBondContact O-N 3.23Å
104	Q	46.7	Very low	52.5	Low	165 Å²	165	131 Å²	131	77%	0.771	74%	0.742	S	S	*	*			trans	-76.2	72.5	173.7	-121.3	-75	26.2	0	0	106.8	L102	L102-Q104 PolarHBondContact O-N 3.08Å
105	R	51.7	Low	51.9	Low	211 Å²	211	130.6 Å²	130.6	80%	0.796	75%	0.747	S	S	*	*			trans	-88.8	99.6	163.8	-173.7	-175.7	-149.1	-170.9	6.6	106.5	H103	H103-R105 VanDerWaalsContact CD2-CB 3.42Å; H103-R105 WeakPolarHBondContact CD2-CB 3.45Å; H103-R105 PolarHBondContact O-N 3.23Å
106	G	44.7	Very low	51.2	Low	61 Å²	61	131.4 Å²	131.4	63%	0.629	75%	0.753	S	S	*	*			trans	96.8	117.8	145.5	0	0	0	0	0	117.1
107	G	47.9	Very low	50.7	Low	72 Å²	72	126 Å²	126	74%	0.742	75%	0.753	S	S	*	*				89.4	148.5	119.9	0	0	0	0	0	117.7
108	P	52.1	Low	50.5	Low	137 Å²	137	124.4 Å²	124.4	89%	0.89	75%	0.749	S	S	*	*			trans	-92.3	141.1	-160.3	36.1	-31.2	0	0	0	113
109	G	55	Low	50.2	Low	85 Å²	85	124.8 Å²	124.8	88%	0.876	76%	0.757	S	S	*	*			trans	106.5	129.2	159.5	0	0	0	0	0	114.9
110	G	45.8	Very low	50.4	Low	78 Å²	78	129 Å²	129	80%	0.804	77%	0.768	S	S	*	*			trans	132.8	92.1	165.9	0	0	0	0	0	113.3	Q112	G110-Q112 PolarHBondContact O-N 3.41Å
111	L	55.3	Low	50.3	Low	164 Å²	164	129.8 Å²	129.8	86%	0.859	77%	0.773	S	S	*	*			trans	-46.4	128.7	156.9	-71.3	153.5	0	0	0	109.3
112	Q	47.7	Very low	50.2	Low	173 Å²	173	131.2 Å²	131.2	81%	0.808	77%	0.771	S	S	*	*				-172.3	130.9	129.8	-70	-40.2	22.1	0	0	111.1	G110	G110-Q112 PolarHBondContact O-N 3.41Å
113	H	42.7	Very low	49.7	Very low	164 Å²	164	133.5 Å²	133.5	76%	0.759	80%	0.798	S	S	*	*			trans	58.3	88.5	150.6	-109.7	-115.1	0	0	0	118.6	E115	H113-E115 VanDerWaalsContact C-N 3.28Å; H113-E115 PolarHBondContact O-N 3.44Å; H113-E115 VanDerWaalsContact O-N 3.12Å
114	V	49	Very low	49.8	Very low	143 Å²	143	132.9 Å²	132.9	87%	0.867	80%	0.803	S	S	*	*			trans	-76.7	86.5	153.8	175.8	0	0	0	0	107.3	A116	V114-A116 PolarHBondContact O-N 2.64Å
115	E	47.7	Very low	50	Low	160 Å²	160	131.2 Å²	131.2	75%	0.748	81%	0.805	S	S	*	*			trans	-75.3	97.4	160.3	-173	133.2	85.5	0	0	107	H113 A117	H113-E115 VanDerWaalsContact C-N 3.28Å; H113-E115 PolarHBondContact O-N 3.44Å; H113-E115 VanDerWaalsContact O-N 3.12Å; E115-A117 VanDerWaalsContact C-N 3.26Å; E115-A117 PolarHBondContact O-N 3.03Å
116	A	49.8	Very low	49.9	Very low	81 Å²	81	126.7 Å²	126.7	67%	0.669	81%	0.806	S	S	*	*			trans	-64.7	90.5	171.6	0	0	0	0	0	108.4	V114 L118	V114-A116 PolarHBondContact O-N 2.64Å; A116-L118 PolarHBondContact O-N 2.72Å
117	A	51.1	Low	50.2	Low	93 Å²	93	130.6 Å²	130.6	77%	0.769	82%	0.816	S	S	*	*			trans	-64.1	90.6	167.3	0	0	0	0	0	108.1	E115 P119	E115-A117 VanDerWaalsContact C-N 3.26Å; E115-A117 PolarHBondContact O-N 3.03Å; A117-P119 WeakPolarHBondContact O-CD 3.12Å
118	L	52.9	Low	50.3	Low	130 Å²	130	134.3 Å²	134.3	68%	0.681	82%	0.821	S	S	*	*			trans	-59.2	120.7	170.2	-146.7	101.9	0	0	0	107.5	A116 Q120	A116-L118 PolarHBondContact O-N 2.72Å; L118-Q120 PolarHBondContact O-N 2.76Å
119	P	49.3	Very low	50.2	Low	116 Å²	116	134.1 Å²	134.1	75%	0.753	82%	0.816	S	S	*	*			trans	-70.5	106.7	175.6	27.6	-30.6	0	0	0	107.9	A117 P121	A117-P119 WeakPolarHBondContact O-CD 3.12Å; P119-P121 WeakPolarHBondContact O-CD 3.42Å
120	Q	57.9	Low	49.8	Very low	144 Å²	144	137.6 Å²	137.6	67%	0.673	81%	0.812	S	S	*	*			trans	-67.4	124.6	169.4	-64.7	-68	-30.5	0	0	108.2	L118 L122	L118-Q120 PolarHBondContact O-N 2.76Å; Q120-L122 PolarHBondContact O-N 2.81Å; Q120-L122 VanDerWaalsContact O-N 3.13Å
121	P	52.9	Low	50.2	Low	123 Å²	123	142.2 Å²	142.2	80%	0.799	81%	0.812	S	S	*	*			trans	-77.3	98	169.4	30.9	-29.2	0	0	0	107.9	P119	P119-P121 WeakPolarHBondContact O-CD 3.42Å
122	L	53.9	Low	49.7	Very low	156 Å²	156	140.3 Å²	140.3	82%	0.817	81%	0.808	S	S	*	*			trans	-89.2	110.6	164.2	-85.6	156.2	0	0	0	107.9	Q120	Q120-L122 PolarHBondContact O-N 2.81Å; Q120-L122 VanDerWaalsContact O-N 3.13Å
123	C	41.9	Very low	49.9	Very low	201 Å²	201	137.4 Å²	137.4	100%	1.358	81%	0.808	S	S	*	*			trans	38.6	0	160.1	-64.3	0	0	0	0	119.1

Retrieved 123 of 123 residues in 94.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).