A0A087WWP1_HUMAN Loading...

IQ motif containing GTPase activating protein 1

AlphaFold DB , UniProt , Accession A0A087WWP1, Species HUMAN (Homo sapiens, Human), Gene IQGAP1, Length 107 aa.

						>A0A087WWP1_HUMAN|A0A087WWP1|IQGAP1
VKGGYYYYHNLETQEGGWDEPPNFVQNSMQLSREEIQSSISGVTAAYNREQLWLANEGLITRLQARCRGYLVRQEFRSRMNFLKKQIPAITCIQVFQNLSHRQQAGI
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	V	41.6	Very low	73.2	Confident	199 Å²	199	122.1 Å²	122.1	100%	1.206	62%	0.624	S	S	*	*				0	97.7	0	-171.9	0	0	0	0	107.2
2	K	49.1	Very low	74.2	Confident	221 Å²	221	126.9 Å²	126.9	96%	0.961	64%	0.642	S	S	*	*			trans	-104.1	100.7	177.9	-82.3	-171.8	176.1	-178	0	107
3	G	51.5	Low	75.4	Confident	62 Å²	62	122.8 Å²	122.8	64%	0.639	63%	0.627	S	S	*	*			trans	-173	76.1	178.7	0	0	0	0	0	107.9
4	G	71.8	Confident	76.5	Confident	64 Å²	64	123.4 Å²	123.4	66%	0.66	63%	0.626	S	S	*	*	P	Polyproline II helix	trans	-72.1	149	167.9	0	0	0	0	0	109.4
5	Y	78.9	Confident	77.5	Confident	210 Å²	210	124.3 Å²	124.3	82%	0.824	63%	0.627	S	S	*	*	P	Polyproline II helix	trans	-80	135.5	170	-62.9	-81.9	0	0	0	109.1
6	Y	81.6	Confident	78.4	Confident	178 Å²	178	119.1 Å²	119.1	70%	0.698	61%	0.614	S	S	*	*	P	Polyproline II helix	trans	-85	128.4	174.9	-63.7	-73.1	0	0	0	109.4
7	Y	86.3	Confident	79.1	Confident	129 Å²	129	113.7 Å²	113.7	51%	0.506	60%	0.595	S	S	.	*			trans	-105.7	122.4	169.7	-178.3	-100.8	0	0	0	108.1	H9 G16 W18	Y7-H9 HydrophobicContact CD1-CB 4.23Å; Y7-H9 HydrophobicContact CE1-CB 3.9Å; Y7-G16 VanDerWaalsContact OH-CA 3.31Å; Y7-G16 WeakPolarHBondContact OH-CA 3.49Å; Y7-W18 HydrophobicContact CD2-CD2 4.19Å; Y7-W18 HydrophobicContact CD2-CE3 4.37Å; Y7-W18 HydrophobicContact CD2-CH2 4.4Å; Y7-W18 HydrophobicContact CD2-CZ2 4.21Å; Y7-W18 HydrophobicContact CD2-CZ3 4.47Å
8	Y	87.3	Confident	79.8	Confident	43 Å²	43	116.7 Å²	116.7	17%	0.169	60%	0.597	C	S	.	*	E	Extended strand (participates in β ladder)	trans	-95.1	124.8	178.2	-59.9	-86.2	0	0	0	108.5	G16 G17 D19 E20 P21 F24	Y8-G16 CarbonylContact O-C 3.44Å; Y8-G16 WeakPolarHBondContact O-CA 3.44Å; Y8-G17 PolarHBondContact N-O 3.16Å; Y8-G17 PolarHBondContact O-N 3.39Å; Y8-D19 WeakPolarHBondContact CD2-O 3.31Å; Y8-E20 HydrophobicContact CE1-CB 4.44Å; Y8-E20 HydrophobicContact CE1-CG 4.05Å; Y8-E20 HydrophobicContact CE2-CB 3.91Å; Y8-E20 HydrophobicContact CE2-CG 4.42Å; Y8-P21 HydrophobicContact CG-CG 4.38Å; Y8-F24 HydrophobicContact CD1-CD1 4.49Å; Y8-F24 HydrophobicContact CD1-CD2 4.18Å; Y8-F24 HydrophobicContact CD1-CE1 4.29Å; Y8-F24 AromaticContact CD1-CE2 3.97Å; Y8-F24 HydrophobicContact CD1-CE2 3.97Å; Y8-F24 HydrophobicContact CD1-CG 4.44Å; Y8-F24 HydrophobicContact CD1-CZ 4.02Å; Y8-F24 HydrophobicContact CE1-CD1 4.14Å; Y8-F24 AromaticContact CE1-CE1 4Å; Y8-F24 HydrophobicContact CE1-CE1 4Å; Y8-F24 HydrophobicContact CE1-CE2 4.49Å; Y8-F24 HydrophobicContact CE1-CG 4.45Å; Y8-F24 HydrophobicContact CE1-CZ 4.18Å
9	H	87.3	Confident	80.4	Confident	83 Å²	83	118.3 Å²	118.3	38%	0.384	61%	0.607	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-124.8	124.5	178.2	-178.4	59.3	0	0	0	109.7	Y7 Q14 E15	Y7-H9 HydrophobicContact CD1-CB 4.23Å; Y7-H9 HydrophobicContact CE1-CB 3.9Å; H9-Q14 PolarHBondContact CE1-O 2.84Å; H9-E15 WeakPolarHBondContact CA-O 3.49Å; H9-E15 PolarHBondContact ND1-O 3.13Å; H9-E15 VanDerWaalsContact ND1-O 3.11Å
10	N	86.4	Confident	80.7	Confident	72 Å²	72	118.8 Å²	118.8	39%	0.385	61%	0.606	S	S	.	*			trans	-87	118	175.1	-174.8	-33.8	0	0	0	109.1	E12 T13 Q14 E15	N10-E12 VanDerWaalsContact C-N 3.33Å; N10-E12 PolarHBondContact O-N 3.21Å; N10-E12 WeakPolarHBondContact OD1-CA 3.36Å; N10-E12 WeakPolarHBondContact OD1-CB 3.16Å; N10-E12 PolarHBondContact OD1-N 2.86Å; N10-T13 WeakPolarHBondContact CB-OG1 3.4Å; N10-T13 VanDerWaalsContact CG-OG1 3.28Å; N10-T13 PolarHBondContact OD1-N 3.48Å; N10-T13 VanDerWaalsContact OD1-N 3.13Å; N10-Q14 WeakPolarHBondContact O-CA 3.31Å; N10-Q14 PolarHBondContact O-N 3.19Å; N10-E15 PolarHBondContact N-O 3.48Å
11	L	83.1	Confident	81.1	Confident	82 Å²	82	115.7 Å²	115.7	43%	0.429	59%	0.594	S	S	.	*	T	Hydrogen-bonded Turn	trans	-73.6	-23.4	-177.8	-63.9	173.6	0	0	0	113.4	Q14	L11-Q14 PolarHBondContact O-NE2 2.82Å
12	E	85.9	Confident	83.2	Confident	180 Å²	180	112 Å²	112	84%	0.841	58%	0.575	S	S	*	*	T	Hydrogen-bonded Turn	trans	-80.6	-48.6	177.8	-63.9	-178.4	171.6	0	0	111.1	N10	N10-E12 VanDerWaalsContact C-N 3.33Å; N10-E12 PolarHBondContact O-N 3.21Å; N10-E12 WeakPolarHBondContact OD1-CA 3.36Å; N10-E12 WeakPolarHBondContact OD1-CB 3.16Å; N10-E12 PolarHBondContact OD1-N 2.86Å
13	T	89.8	Confident	84.9	Confident	74 Å²	74	109.2 Å²	109.2	45%	0.454	57%	0.57	S	S	.	*	T	Hydrogen-bonded Turn	trans	-89.4	-13.3	-176.9	68.3	0	0	0	0	113.6	N10 E15	N10-T13 WeakPolarHBondContact CB-OG1 3.4Å; N10-T13 VanDerWaalsContact CG-OG1 3.28Å; N10-T13 PolarHBondContact OD1-N 3.48Å; N10-T13 VanDerWaalsContact OD1-N 3.13Å; T13-E15 PolarHBondContact O-N 3.24Å; T13-E15 PolarHBondContact OG1-N 3.47Å
14	Q	90.1	Very high	86.4	Confident	130 Å²	130	110.6 Å²	110.6	61%	0.607	56%	0.558	S	S	*	*			trans	63.1	10.8	-174.4	-59.5	-71	-57.1	0	0	114.5	H9 N10 L11	H9-Q14 PolarHBondContact CE1-O 2.84Å; N10-Q14 WeakPolarHBondContact O-CA 3.31Å; N10-Q14 PolarHBondContact O-N 3.19Å; L11-Q14 PolarHBondContact O-NE2 2.82Å
15	E	91.9	Very high	86.8	Confident	138 Å²	138	113.4 Å²	113.4	65%	0.645	56%	0.563	S	S	*	*			trans	-83.2	159.6	175.9	-64	178.2	155.4	0	0	111.2	H9 N10 T13	H9-E15 WeakPolarHBondContact CA-O 3.49Å; H9-E15 PolarHBondContact ND1-O 3.13Å; H9-E15 VanDerWaalsContact ND1-O 3.11Å; N10-E15 PolarHBondContact N-O 3.48Å; T13-E15 PolarHBondContact O-N 3.24Å; T13-E15 PolarHBondContact OG1-N 3.47Å
16	G	91.4	Very high	86.7	Confident	41 Å²	41	110.7 Å²	110.7	42%	0.423	56%	0.558	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-161.7	159.2	172.4	0	0	0	0	0	114.5	Y7 Y8	Y7-G16 VanDerWaalsContact OH-CA 3.31Å; Y7-G16 WeakPolarHBondContact OH-CA 3.49Å; Y8-G16 CarbonylContact O-C 3.44Å; Y8-G16 WeakPolarHBondContact O-CA 3.44Å
17	G	91.3	Very high	86.3	Confident	27 Å²	27	105.8 Å²	105.8	28%	0.278	54%	0.543	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-161.4	174.1	-172.6	0	0	0	0	0	113.2	Y8	Y8-G17 PolarHBondContact N-O 3.16Å; Y8-G17 PolarHBondContact O-N 3.39Å
18	W	91.6	Very high	85.6	Confident	168 Å²	168	105 Å²	105	64%	0.636	56%	0.557	S	S	*	*	S	Bend	trans	-94.1	-17.7	179.6	-60	101.1	0	0	0	113	Y7	Y7-W18 HydrophobicContact CD2-CD2 4.19Å; Y7-W18 HydrophobicContact CD2-CE3 4.37Å; Y7-W18 HydrophobicContact CD2-CH2 4.4Å; Y7-W18 HydrophobicContact CD2-CZ2 4.21Å; Y7-W18 HydrophobicContact CD2-CZ3 4.47Å
19	D	90	Very high	85.3	Confident	146 Å²	146	111.3 Å²	111.3	78%	0.781	59%	0.59	S	S	*	*	S	Bend	trans	-84.3	137.6	175.6	-60.6	-54.2	0	0	0	110.4	Y8 P21	Y8-D19 WeakPolarHBondContact CD2-O 3.31Å; D19-P21 WeakPolarHBondContact O-CD 3.41Å
20	E	87.9	Confident	85	Confident	129 Å²	129	113.1 Å²	113.1	60%	0.603	60%	0.598	S	S	*	*	P	Polyproline II helix	trans	-66.2	124.4	177.7	-172.3	174.2	162.9	0	0	110.4	Y8 F24	Y8-E20 HydrophobicContact CE1-CB 4.44Å; Y8-E20 HydrophobicContact CE1-CG 4.05Å; Y8-E20 HydrophobicContact CE2-CB 3.91Å; Y8-E20 HydrophobicContact CE2-CG 4.42Å; E20-F24 HydrophobicContact CG-CB 4.17Å
21	P	88.3	Confident	85.1	Confident	54 Å²	54	115 Å²	115	35%	0.351	61%	0.608	S	S	.	*	P	Polyproline II helix	trans	-64.6	146.8	179.4	-20.4	31	0	0	0	112.5	Y8 D19 N23 F24	Y8-P21 HydrophobicContact CG-CG 4.38Å; D19-P21 WeakPolarHBondContact O-CD 3.41Å; P21-N23 PolarHBondContact O-N 2.93Å; P21-F24 HydrophobicContact CB-CB 4.49Å; P21-F24 HydrophobicContact CG-CD2 4.43Å; P21-F24 WeakPolarHBondContact O-CB 3.41Å; P21-F24 PolarHBondContact O-N 3.38Å
22	P	86.2	Confident	85.2	Confident	122 Å²	122	112.9 Å²	112.9	79%	0.792	60%	0.6	S	S	*	*	T	Hydrogen-bonded Turn	trans	-61.9	133.4	173.7	23.9	-30.8	0	0	0	110.9	F24	P22-F24 VanDerWaalsContact C-N 3.31Å; P22-F24 PolarHBondContact O-N 3.11Å
23	N	84.9	Confident	85.2	Confident	161 Å²	161	113.3 Å²	113.3	86%	0.861	59%	0.594	S	S	*	*	T	Hydrogen-bonded Turn	trans	61.5	30.1	-175.2	-50.2	-48.3	0	0	0	114.6	P21 V25	P21-N23 PolarHBondContact O-N 2.93Å; N23-V25 PolarHBondContact O-N 2.86Å
24	F	82.8	Confident	85.3	Confident	91 Å²	91	115.6 Å²	115.6	40%	0.399	60%	0.599	S	S	.	*			trans	-57.3	125.6	174.8	179.3	-105.5	0	0	0	111.2	Y8 E20 P21 P22 Q26	Y8-F24 HydrophobicContact CD1-CD1 4.49Å; Y8-F24 HydrophobicContact CD1-CD2 4.18Å; Y8-F24 HydrophobicContact CD1-CE1 4.29Å; Y8-F24 AromaticContact CD1-CE2 3.97Å; Y8-F24 HydrophobicContact CD1-CE2 3.97Å; Y8-F24 HydrophobicContact CD1-CG 4.44Å; Y8-F24 HydrophobicContact CD1-CZ 4.02Å; Y8-F24 HydrophobicContact CE1-CD1 4.14Å; Y8-F24 AromaticContact CE1-CE1 4Å; Y8-F24 HydrophobicContact CE1-CE1 4Å; Y8-F24 HydrophobicContact CE1-CE2 4.49Å; Y8-F24 HydrophobicContact CE1-CG 4.45Å; Y8-F24 HydrophobicContact CE1-CZ 4.18Å; E20-F24 HydrophobicContact CG-CB 4.17Å; P21-F24 HydrophobicContact CB-CB 4.49Å; P21-F24 HydrophobicContact CG-CD2 4.43Å; P21-F24 WeakPolarHBondContact O-CB 3.41Å; P21-F24 PolarHBondContact O-N 3.38Å; P22-F24 VanDerWaalsContact C-N 3.31Å; P22-F24 PolarHBondContact O-N 3.11Å; F24-Q26 HydrophobicContact CE1-CB 4.14Å; F24-Q26 HydrophobicContact CZ-CB 4.46Å
25	V	80.4	Confident	85.3	Confident	124 Å²	124	113.9 Å²	113.9	75%	0.752	59%	0.592	S	S	*	*			trans	-116.5	121	169.7	179.9	0	0	0	0	106.6	N23 N27	N23-V25 PolarHBondContact O-N 2.86Å; V25-N27 PolarHBondContact O-N 3.04Å; V25-N27 VanDerWaalsContact O-N 3.16Å
26	Q	76.9	Confident	85.5	Confident	153 Å²	153	111.1 Å²	111.1	72%	0.715	58%	0.58	S	S	*	*			trans	-58.3	122.8	177.5	-174.1	172.4	3.1	0	0	109.4	F24 S28	F24-Q26 HydrophobicContact CE1-CB 4.14Å; F24-Q26 HydrophobicContact CZ-CB 4.46Å; Q26-S28 PolarHBondContact O-N 2.86Å
27	N	72.8	Confident	85.7	Confident	75 Å²	75	114 Å²	114	40%	0.401	58%	0.583	S	S	.	*			trans	-63.2	110.6	-179.4	-174	-3.6	0	0	0	109.8	V25 M29	V25-N27 PolarHBondContact O-N 3.04Å; V25-N27 VanDerWaalsContact O-N 3.16Å; N27-M29 VanDerWaalsContact OD1-CB 3.31Å; N27-M29 WeakPolarHBondContact OD1-CB 2.99Å; N27-M29 PolarHBondContact OD1-N 2.91Å
28	S	71.6	Confident	86	Confident	113 Å²	113	116.7 Å²	116.7	79%	0.79	60%	0.597	S	S	*	*			trans	-93.1	-0.4	177.8	58.4	0	0	0	0	113.3	Q26 Q30	Q26-S28 PolarHBondContact O-N 2.86Å; S28-Q30 VanDerWaalsContact C-N 3.32Å
29	M	79.9	Confident	86.3	Confident	175 Å²	175	112 Å²	112	86%	0.862	59%	0.59	S	S	*	*	S	Bend	trans	-81.1	-15.2	179.1	-54.4	-164.5	75.8	0	0	112.8	N27	N27-M29 VanDerWaalsContact OD1-CB 3.31Å; N27-M29 WeakPolarHBondContact OD1-CB 2.99Å; N27-M29 PolarHBondContact OD1-N 2.91Å
30	Q	82.9	Confident	86.7	Confident	120 Å²	120	109.5 Å²	109.5	56%	0.561	58%	0.576	S	S	*	*	S	Bend	trans	-115.5	144.5	-179.4	-64.4	-179.7	-4.7	0	0	110.2	S28	S28-Q30 VanDerWaalsContact C-N 3.32Å
31	L	86.8	Confident	87.1	Confident	112 Å²	112	106 Å²	106	59%	0.586	57%	0.566	S	S	*	*			trans	-71.5	131.7	175.8	-64	170.5	0	0	0	110	E35 I36	L31-E35 HydrophobicContact CB-CB 4.32Å; L31-E35 HydrophobicContact CD2-CB 4.07Å; L31-I36 HydrophobicContact CB-CD1 4.18Å; L31-I36 HydrophobicContact CB-CG1 3.7Å; L31-I36 HydrophobicContact CD1-CG1 4.23Å
32	S	85.4	Confident	87.6	Confident	38 Å²	38	105.4 Å²	105.4	27%	0.266	57%	0.569	S	S	.	*			trans	-64.2	160	167.4	62.3	0	0	0	0	111.1	E34 E35 I36	S32-E34 PolarHBondContact O-N 2.66Å; S32-E35 WeakPolarHBondContact CB-OE2 3.35Å; S32-E35 PolarHBondContact N-OE2 3.41Å; S32-E35 PolarHBondContact O-N 2.82Å; S32-E35 VanDerWaalsContact O-N 3.16Å; S32-E35 WeakPolarHBondContact OG-CB 3.2Å; S32-E35 VanDerWaalsContact OG-CD 3.29Å; S32-E35 WeakPolarHBondContact OG-CG 3.44Å; S32-E35 PolarHBondContact OG-N 3.13Å; S32-E35 VanDerWaalsContact OG-N 3.13Å; S32-E35 PolarHBondContact OG-OE2 3.01Å; S32-I36 WeakPolarHBondContact O-CG1 3.32Å; S32-I36 PolarHBondContact O-N 2.78Å
33	R	87.3	Confident	88.2	Confident	189 Å²	189	104.6 Å²	104.6	71%	0.713	56%	0.562	S	S	*	*	H	α-helix	trans	-54	-39.3	172.5	176.2	177	175.8	-102.7	1.1	111.2	Q37	R33-Q37 VanDerWaalsContact O-CB 3.26Å; R33-Q37 WeakPolarHBondContact O-CB 3.21Å; R33-Q37 PolarHBondContact O-N 3.46Å
34	E	89.9	Confident	88.8	Confident	121 Å²	121	100.1 Å²	100.1	57%	0.565	54%	0.54	S	S	*	.	H	α-helix	trans	-66.8	-42.4	-179.5	-68.5	62.5	-136.7	0	0	111.3	S32 Q37 S38	S32-E34 PolarHBondContact O-N 2.66Å; E34-Q37 PolarHBondContact O-N 3.44Å; E34-S38 WeakPolarHBondContact O-CB 3.25Å; E34-S38 PolarHBondContact O-N 2.96Å
35	E	91.9	Very high	89.6	Confident	95 Å²	95	97.6 Å²	97.6	44%	0.444	54%	0.536	S	S	.	.	H	α-helix	trans	-67.1	-41.4	176.7	-73.5	164.7	125.8	0	0	112.3	L31 S32 S38 S39	L31-E35 HydrophobicContact CB-CB 4.32Å; L31-E35 HydrophobicContact CD2-CB 4.07Å; S32-E35 WeakPolarHBondContact CB-OE2 3.35Å; S32-E35 PolarHBondContact N-OE2 3.41Å; S32-E35 PolarHBondContact O-N 2.82Å; S32-E35 VanDerWaalsContact O-N 3.16Å; S32-E35 WeakPolarHBondContact OG-CB 3.2Å; S32-E35 VanDerWaalsContact OG-CD 3.29Å; S32-E35 WeakPolarHBondContact OG-CG 3.44Å; S32-E35 PolarHBondContact OG-N 3.13Å; S32-E35 VanDerWaalsContact OG-N 3.13Å; S32-E35 PolarHBondContact OG-OE2 3.01Å; E35-S38 PolarHBondContact O-N 3.16Å; E35-S39 WeakPolarHBondContact O-CB 3.4Å; E35-S39 PolarHBondContact O-N 3.23Å; E35-S39 PolarHBondContact O-OG 3Å
36	I	94.4	Very high	90.4	Very high	79 Å²	79	93.8 Å²	93.8	41%	0.405	52%	0.518	S	S	.	.	H	α-helix	trans	-60.8	-50.3	174.1	-65.4	168.3	0	0	0	109.6	L31 S32 S38 S39 I40	L31-I36 HydrophobicContact CB-CD1 4.18Å; L31-I36 HydrophobicContact CB-CG1 3.7Å; L31-I36 HydrophobicContact CD1-CG1 4.23Å; S32-I36 WeakPolarHBondContact O-CG1 3.32Å; S32-I36 PolarHBondContact O-N 2.78Å; I36-S38 VanDerWaalsContact C-N 3.32Å; I36-S38 PolarHBondContact O-N 3.28Å; I36-S39 PolarHBondContact O-N 2.83Å; I36-I40 HydrophobicContact CG2-CD1 3.78Å; I36-I40 WeakPolarHBondContact O-CG1 3.37Å; I36-I40 PolarHBondContact O-N 3.43Å
37	Q	97.3	Very high	91.5	Very high	103 Å²	103	92.5 Å²	92.5	48%	0.481	51%	0.508	S	S	.	.	H	α-helix	trans	-63.3	-39.7	-179	-172	62.4	66.1	0	0	111.8	R33 E34 S41	R33-Q37 VanDerWaalsContact O-CB 3.26Å; R33-Q37 WeakPolarHBondContact O-CB 3.21Å; R33-Q37 PolarHBondContact O-N 3.46Å; E34-Q37 PolarHBondContact O-N 3.44Å; Q37-S41 PolarHBondContact NE2-OG 3Å; Q37-S41 VanDerWaalsContact O-CB 3.25Å; Q37-S41 WeakPolarHBondContact O-CB 3.46Å; Q37-S41 PolarHBondContact O-N 3.4Å; Q37-S41 PolarHBondContact O-OG 3.07Å
38	S	97.1	Very high	92.7	Very high	82 Å²	82	92.9 Å²	92.9	57%	0.573	51%	0.509	S	S	*	.	H	α-helix	trans	-61.5	-47.7	176.3	-178.2	0	0	0	0	111.1	E34 E35 I36 S41 G42	E34-S38 WeakPolarHBondContact O-CB 3.25Å; E34-S38 PolarHBondContact O-N 2.96Å; E35-S38 PolarHBondContact O-N 3.16Å; I36-S38 VanDerWaalsContact C-N 3.32Å; I36-S38 PolarHBondContact O-N 3.28Å; S38-S41 PolarHBondContact O-N 3.27Å; S38-G42 PolarHBondContact O-N 3.46Å
39	S	97.3	Very high	93.9	Very high	70 Å²	70	95.1 Å²	95.1	49%	0.49	50%	0.501	S	S	.	.	H	α-helix	trans	-61.2	-48.6	179.6	-58.4	0	0	0	0	111.9	E35 I36 S41 G42 V43	E35-S39 WeakPolarHBondContact O-CB 3.4Å; E35-S39 PolarHBondContact O-N 3.23Å; E35-S39 PolarHBondContact O-OG 3Å; I36-S39 PolarHBondContact O-N 2.83Å; S39-S41 PolarHBondContact O-N 2.86Å; S39-G42 PolarHBondContact O-N 3.32Å; S39-V43 WeakPolarHBondContact O-CG2 3.27Å; S39-V43 PolarHBondContact O-N 2.91Å
40	I	97.9	Very high	94.8	Very high	93 Å²	93	92.3 Å²	92.3	48%	0.477	49%	0.485	S	S	.	.	H	α-helix	trans	-61.2	-45.5	177.7	-66.7	169.3	0	0	0	110.8	I36 G42 V43 T44	I36-I40 HydrophobicContact CG2-CD1 3.78Å; I36-I40 WeakPolarHBondContact O-CG1 3.37Å; I36-I40 PolarHBondContact O-N 3.43Å; I40-G42 VanDerWaalsContact C-N 3.31Å; I40-G42 PolarHBondContact O-N 2.95Å; I40-V43 PolarHBondContact O-N 2.95Å; I40-T44 VanDerWaalsContact O-CB 3.27Å; I40-T44 WeakPolarHBondContact O-CB 3.26Å; I40-T44 PolarHBondContact O-N 2.94Å; I40-T44 PolarHBondContact O-OG1 3.09Å
41	S	98.1	Very high	95.6	Very high	57 Å²	57	90.2 Å²	90.2	40%	0.399	48%	0.475	S	S	.	.	H	α-helix	trans	-61.7	-41.2	178.8	-56.1	0	0	0	0	111.4	Q37 S38 S39 A45	Q37-S41 PolarHBondContact NE2-OG 3Å; Q37-S41 VanDerWaalsContact O-CB 3.25Å; Q37-S41 WeakPolarHBondContact O-CB 3.46Å; Q37-S41 PolarHBondContact O-N 3.4Å; Q37-S41 PolarHBondContact O-OG 3.07Å; S38-S41 PolarHBondContact O-N 3.27Å; S39-S41 PolarHBondContact O-N 2.86Å; S41-A45 VanDerWaalsContact O-CB 3.22Å; S41-A45 WeakPolarHBondContact O-CB 3.22Å; S41-A45 PolarHBondContact O-N 3.43Å
42	G	98.3	Very high	96.1	Very high	41 Å²	41	90 Å²	90	42%	0.423	48%	0.475	S	S	.	.	H	α-helix	trans	-61.8	-50.8	178.4	0	0	0	0	0	112.6	S38 S39 I40 A45 A46	S38-G42 PolarHBondContact O-N 3.46Å; S39-G42 PolarHBondContact O-N 3.32Å; I40-G42 VanDerWaalsContact C-N 3.31Å; I40-G42 PolarHBondContact O-N 2.95Å; G42-A45 PolarHBondContact O-N 3.39Å; G42-A46 PolarHBondContact O-N 2.63Å
43	V	98.4	Very high	96.7	Very high	104 Å²	104	95.1 Å²	95.1	63%	0.63	49%	0.488	S	S	*	.	H	α-helix	trans	-63.2	-44.8	178.3	175.7	0	0	0	0	110.8	S39 I40 A45 A46 Y47	S39-V43 WeakPolarHBondContact O-CG2 3.27Å; S39-V43 PolarHBondContact O-N 2.91Å; I40-V43 PolarHBondContact O-N 2.95Å; V43-A45 PolarHBondContact O-N 3.25Å; V43-A46 PolarHBondContact O-N 3.44Å; V43-Y47 PolarHBondContact O-N 2.73Å
44	T	98.3	Very high	97.2	Very high	67 Å²	67	90.1 Å²	90.1	41%	0.411	48%	0.475	S	S	.	.	H	α-helix	trans	-62.5	-43.1	179.2	-56.3	0	0	0	0	111.5	I40 Y47 N48	I40-T44 VanDerWaalsContact O-CB 3.27Å; I40-T44 WeakPolarHBondContact O-CB 3.26Å; I40-T44 PolarHBondContact O-N 2.94Å; I40-T44 PolarHBondContact O-OG1 3.09Å; T44-Y47 PolarHBondContact O-N 3.27Å; T44-N48 WeakPolarHBondContact O-CB 3.41Å; T44-N48 VanDerWaalsContact O-CG 3.22Å; T44-N48 PolarHBondContact O-N 3.31Å; T44-N48 PolarHBondContact O-ND2 2.88Å
45	A	98.4	Very high	97.6	Very high	38 Å²	38	88 Å²	88	31%	0.314	48%	0.478	S	S	.	.	H	α-helix	trans	-65.8	-38.4	177.5	0	0	0	0	0	112.1	S41 G42 V43 R49	S41-A45 VanDerWaalsContact O-CB 3.22Å; S41-A45 WeakPolarHBondContact O-CB 3.22Å; S41-A45 PolarHBondContact O-N 3.43Å; G42-A45 PolarHBondContact O-N 3.39Å; V43-A45 PolarHBondContact O-N 3.25Å; A45-R49 WeakPolarHBondContact O-CG 3.45Å; A45-R49 PolarHBondContact O-N 3.09Å; A45-R49 VanDerWaalsContact O-N 3.09Å
46	A	98.4	Very high	97.9	Very high	45 Å²	45	86.6 Å²	86.6	37%	0.372	47%	0.474	S	S	.	.	H	α-helix	trans	-62.6	-48.7	174.9	0	0	0	0	0	111.4	G42 V43 N48 R49 E50	G42-A46 PolarHBondContact O-N 2.63Å; V43-A46 PolarHBondContact O-N 3.44Å; A46-N48 PolarHBondContact O-N 3.12Å; A46-R49 PolarHBondContact O-N 3.47Å; A46-E50 PolarHBondContact O-N 2.91Å; A46-E50 VanDerWaalsContact O-N 3.09Å
47	Y	98.4	Very high	98.1	Very high	126 Å²	126	87 Å²	87	49%	0.494	47%	0.474	S	S	.	.	H	α-helix	trans	-58.6	-48	176.4	178.3	-99.2	0	0	0	112.1	V43 T44 R49 E50 Q51	V43-Y47 PolarHBondContact O-N 2.73Å; T44-Y47 PolarHBondContact O-N 3.27Å; Y47-R49 VanDerWaalsContact C-N 3.29Å; Y47-R49 PolarHBondContact O-N 2.9Å; Y47-E50 WeakPolarHBondContact O-CB 3.36Å; Y47-E50 PolarHBondContact O-N 3.49Å; Y47-E50 VanDerWaalsContact O-N 3.12Å; Y47-Q51 HydrophobicContact CD1-CG 4Å; Y47-Q51 HydrophobicContact CD2-CG 4.45Å; Y47-Q51 HydrophobicContact CE1-CG 3.53Å; Y47-Q51 HydrophobicContact CE2-CG 4.03Å; Y47-Q51 HydrophobicContact CG-CG 4.44Å; Y47-Q51 WeakPolarHBondContact O-CG 3.5Å; Y47-Q51 PolarHBondContact O-N 2.94Å
48	N	98.5	Very high	98.1	Very high	82 Å²	82	84.2 Å²	84.2	44%	0.439	47%	0.472	S	S	.	.	H	α-helix	trans	-61.6	-37.3	179.8	-72.9	-16.5	0	0	0	112.6	T44 A46 Q51 L52	T44-N48 WeakPolarHBondContact O-CB 3.41Å; T44-N48 VanDerWaalsContact O-CG 3.22Å; T44-N48 PolarHBondContact O-N 3.31Å; T44-N48 PolarHBondContact O-ND2 2.88Å; A46-N48 PolarHBondContact O-N 3.12Å; N48-Q51 PolarHBondContact O-N 3.4Å; N48-L52 WeakPolarHBondContact O-CB 3.46Å; N48-L52 WeakPolarHBondContact O-CG 3.41Å; N48-L52 PolarHBondContact O-N 3.38Å
49	R	98.1	Very high	98.2	Very high	161 Å²	161	84.8 Å²	84.8	61%	0.608	47%	0.469	S	S	*	.	H	α-helix	trans	-64	-42.9	174.3	-76.2	-172	-61.2	-97.3	3.1	111.8	A45 A46 Y47 L52 W53	A45-R49 WeakPolarHBondContact O-CG 3.45Å; A45-R49 PolarHBondContact O-N 3.09Å; A45-R49 VanDerWaalsContact O-N 3.09Å; A46-R49 PolarHBondContact O-N 3.47Å; Y47-R49 VanDerWaalsContact C-N 3.29Å; Y47-R49 PolarHBondContact O-N 2.9Å; R49-L52 PolarHBondContact O-N 3.42Å; R49-W53 PolarHBondContact O-N 3.42Å
50	E	98.3	Very high	98.3	Very high	115 Å²	115	84.6 Å²	84.6	54%	0.537	46%	0.461	S	S	.	.	H	α-helix	trans	-62.5	-46.5	176.5	-176.5	176.6	-169.1	0	0	111.2	A46 Y47 L52 W53 L54	A46-E50 PolarHBondContact O-N 2.91Å; A46-E50 VanDerWaalsContact O-N 3.09Å; Y47-E50 WeakPolarHBondContact O-CB 3.36Å; Y47-E50 PolarHBondContact O-N 3.49Å; Y47-E50 VanDerWaalsContact O-N 3.12Å; E50-L52 VanDerWaalsContact C-N 3.33Å; E50-L52 PolarHBondContact O-N 3.05Å; E50-W53 WeakPolarHBondContact O-CA 3.4Å; E50-W53 WeakPolarHBondContact O-CB 3.41Å; E50-W53 PolarHBondContact O-N 3.39Å; E50-L54 HydrophobicContact CG-CD1 4.25Å; E50-L54 WeakPolarHBondContact O-CG 3.44Å; E50-L54 PolarHBondContact O-N 2.88Å
51	Q	98.4	Very high	98.3	Very high	76 Å²	76	83.9 Å²	83.9	36%	0.355	46%	0.462	S	S	.	.	H	α-helix	trans	-60.9	-41.3	176.8	-66.2	-52.9	-55.2	0	0	112.5	Y47 N48 W53 L54 A55	Y47-Q51 HydrophobicContact CD1-CG 4Å; Y47-Q51 HydrophobicContact CD2-CG 4.45Å; Y47-Q51 HydrophobicContact CE1-CG 3.53Å; Y47-Q51 HydrophobicContact CE2-CG 4.03Å; Y47-Q51 HydrophobicContact CG-CG 4.44Å; Y47-Q51 WeakPolarHBondContact O-CG 3.5Å; Y47-Q51 PolarHBondContact O-N 2.94Å; N48-Q51 PolarHBondContact O-N 3.4Å; Q51-W53 VanDerWaalsContact C-N 3.32Å; Q51-W53 PolarHBondContact O-N 3.24Å; Q51-L54 PolarHBondContact O-N 3.46Å; Q51-A55 VanDerWaalsContact O-CB 3.29Å; Q51-A55 WeakPolarHBondContact O-CB 3.4Å; Q51-A55 PolarHBondContact O-N 2.87Å
52	L	98.3	Very high	98.3	Very high	109 Å²	109	88.3 Å²	88.3	57%	0.571	47%	0.469	S	S	*	.	H	α-helix	trans	-61.6	-41.2	172.9	-78.6	168.1	0	0	0	111.5	N48 R49 E50 N56	N48-L52 WeakPolarHBondContact O-CB 3.46Å; N48-L52 WeakPolarHBondContact O-CG 3.41Å; N48-L52 PolarHBondContact O-N 3.38Å; R49-L52 PolarHBondContact O-N 3.42Å; E50-L52 VanDerWaalsContact C-N 3.33Å; E50-L52 PolarHBondContact O-N 3.05Å; L52-N56 WeakPolarHBondContact O-CB 3.35Å; L52-N56 PolarHBondContact O-N 3.42Å; L52-N56 VanDerWaalsContact O-N 3.15Å; L52-N56 PolarHBondContact O-ND2 3.08Å
53	W	97.6	Very high	98.4	Very high	145 Å²	145	91.7 Å²	91.7	55%	0.549	48%	0.477	S	S	.	.	H	α-helix	trans	-63.3	-49.9	178	-161.3	97.2	0	0	0	111.1	R49 E50 Q51 A55 N56 E57	R49-W53 PolarHBondContact O-N 3.42Å; E50-W53 WeakPolarHBondContact O-CA 3.4Å; E50-W53 WeakPolarHBondContact O-CB 3.41Å; E50-W53 PolarHBondContact O-N 3.39Å; Q51-W53 VanDerWaalsContact C-N 3.32Å; Q51-W53 PolarHBondContact O-N 3.24Å; W53-A55 PolarHBondContact O-N 3.15Å; W53-N56 CarbonylContact O-C 3.51Å; W53-N56 PolarHBondContact O-N 3.48Å; W53-N56 VanDerWaalsContact O-N 3.08Å; W53-E57 HydrophobicContact CE3-CB 4.25Å; W53-E57 HydrophobicContact CE3-CG 4.45Å; W53-E57 HydrophobicContact CH2-CG 3.96Å; W53-E57 HydrophobicContact CZ3-CB 3.97Å; W53-E57 VanDerWaalsContact CZ3-CD 3.4Å; W53-E57 HydrophobicContact CZ3-CG 3.69Å; W53-E57 WeakPolarHBondContact CZ3-OE1 3.32Å; W53-E57 PolarHBondContact O-N 2.87Å
54	L	98.3	Very high	98.4	Very high	83 Å²	83	90.7 Å²	90.7	44%	0.435	47%	0.466	S	S	.	.	H	α-helix	trans	-58.1	-45.6	177.1	-69	174.1	0	0	0	112	E50 Q51 N56 E57	E50-L54 HydrophobicContact CG-CD1 4.25Å; E50-L54 WeakPolarHBondContact O-CG 3.44Å; E50-L54 PolarHBondContact O-N 2.88Å; Q51-L54 PolarHBondContact O-N 3.46Å; L54-N56 PolarHBondContact O-N 2.76Å; L54-E57 PolarHBondContact O-N 2.94Å
55	A	98.3	Very high	98.4	Very high	77 Å²	77	90.4 Å²	90.4	64%	0.636	47%	0.47	S	S	*	.	H	α-helix	trans	-62.3	-29.1	178.2	0	0	0	0	0	112.9	Q51 W53	Q51-A55 VanDerWaalsContact O-CB 3.29Å; Q51-A55 WeakPolarHBondContact O-CB 3.4Å; Q51-A55 PolarHBondContact O-N 2.87Å; W53-A55 PolarHBondContact O-N 3.15Å
56	N	98.2	Very high	98.4	Very high	66 Å²	66	97.4 Å²	97.4	35%	0.353	49%	0.488	S	S	.	.	H	α-helix	trans	-101.6	-6.7	-176.7	-72.1	-78.7	0	0	0	114.1	L52 W53 L54 G58 L59 I60	L52-N56 WeakPolarHBondContact O-CB 3.35Å; L52-N56 PolarHBondContact O-N 3.42Å; L52-N56 VanDerWaalsContact O-N 3.15Å; L52-N56 PolarHBondContact O-ND2 3.08Å; W53-N56 CarbonylContact O-C 3.51Å; W53-N56 PolarHBondContact O-N 3.48Å; W53-N56 VanDerWaalsContact O-N 3.08Å; L54-N56 PolarHBondContact O-N 2.76Å; N56-G58 VanDerWaalsContact C-N 3.3Å; N56-G58 PolarHBondContact O-N 2.96Å; N56-L59 WeakPolarHBondContact O-CB 3.29Å; N56-L59 PolarHBondContact O-N 2.92Å; N56-I60 HydrophobicContact CB-CD1 4.22Å; N56-I60 WeakPolarHBondContact O-CG1 3.39Å; N56-I60 PolarHBondContact O-N 2.87Å
57	E	98.4	Very high	98.4	Very high	88 Å²	88	98.4 Å²	98.4	41%	0.411	49%	0.492	S	S	.	.	H	α-helix	trans	-54.8	-44.3	-176.2	-175.9	177.2	-158.9	0	0	112.2	W53 L54 L59 I60 T61	W53-E57 HydrophobicContact CE3-CB 4.25Å; W53-E57 HydrophobicContact CE3-CG 4.45Å; W53-E57 HydrophobicContact CH2-CG 3.96Å; W53-E57 HydrophobicContact CZ3-CB 3.97Å; W53-E57 VanDerWaalsContact CZ3-CD 3.4Å; W53-E57 HydrophobicContact CZ3-CG 3.69Å; W53-E57 WeakPolarHBondContact CZ3-OE1 3.32Å; W53-E57 PolarHBondContact O-N 2.87Å; L54-E57 PolarHBondContact O-N 2.94Å; E57-L59 VanDerWaalsContact C-N 3.34Å; E57-L59 PolarHBondContact O-N 3.4Å; E57-I60 PolarHBondContact O-N 3.17Å; E57-T61 WeakPolarHBondContact O-CB 3.48Å; E57-T61 PolarHBondContact O-N 3.42Å; E57-T61 PolarHBondContact O-OG1 3.1Å
58	G	98.3	Very high	98.4	Very high	43 Å²	43	99.6 Å²	99.6	44%	0.443	50%	0.496	S	S	.	.	H	α-helix	trans	-67.2	-30.5	178.2	0	0	0	0	0	113.9	N56 R62	N56-G58 VanDerWaalsContact C-N 3.3Å; N56-G58 PolarHBondContact O-N 2.96Å; G58-R62 VanDerWaalsContact O-CG 3.3Å; G58-R62 WeakPolarHBondContact O-CG 3.4Å; G58-R62 PolarHBondContact O-N 3.17Å; G58-R62 PolarHBondContact O-NE 2.85Å; G58-R62 VanDerWaalsContact O-NE 3.1Å
59	L	98.6	Very high	98.4	Very high	95 Å²	95	96.7 Å²	96.7	50%	0.497	49%	0.485	S	S	.	.	H	α-helix	trans	-71.8	-46.9	173.4	-77.8	164.4	0	0	0	110.7	N56 E57 T61 R62 L63	N56-L59 WeakPolarHBondContact O-CB 3.29Å; N56-L59 PolarHBondContact O-N 2.92Å; E57-L59 VanDerWaalsContact C-N 3.34Å; E57-L59 PolarHBondContact O-N 3.4Å; L59-T61 PolarHBondContact O-N 3Å; L59-R62 PolarHBondContact O-N 3.48Å; L59-L63 WeakPolarHBondContact O-CB 3.45Å; L59-L63 PolarHBondContact O-N 3.34Å
60	I	98.4	Very high	98.5	Very high	65 Å²	65	95.5 Å²	95.5	33%	0.333	48%	0.481	S	S	.	.	H	α-helix	trans	-59.7	-47.8	178.4	-66.2	165.9	0	0	0	110.1	N56 E57 R62 L63 Q64	N56-I60 HydrophobicContact CB-CD1 4.22Å; N56-I60 WeakPolarHBondContact O-CG1 3.39Å; N56-I60 PolarHBondContact O-N 2.87Å; E57-I60 PolarHBondContact O-N 3.17Å; I60-R62 VanDerWaalsContact C-N 3.35Å; I60-R62 PolarHBondContact O-N 3.39Å; I60-L63 WeakPolarHBondContact O-CB 3.35Å; I60-L63 PolarHBondContact O-N 3.35Å; I60-Q64 HydrophobicContact CG2-CG 4.28Å; I60-Q64 WeakPolarHBondContact O-CG 3.48Å; I60-Q64 PolarHBondContact O-N 2.95Å
61	T	98.6	Very high	98.5	Very high	79 Å²	79	94.9 Å²	94.9	49%	0.485	48%	0.481	S	S	.	.	H	α-helix	trans	-58.7	-45.1	179	-61.5	0	0	0	0	111.8	E57 L59 Q64 A65	E57-T61 WeakPolarHBondContact O-CB 3.48Å; E57-T61 PolarHBondContact O-N 3.42Å; E57-T61 PolarHBondContact O-OG1 3.1Å; L59-T61 PolarHBondContact O-N 3Å; T61-Q64 PolarHBondContact O-N 3.24Å; T61-A65 WeakPolarHBondContact O-CB 3.44Å; T61-A65 PolarHBondContact O-N 3.28Å
62	R	98.7	Very high	98.5	Very high	149 Å²	149	95.9 Å²	95.9	56%	0.562	49%	0.492	S	S	*	.	H	α-helix	trans	-63.7	-41.9	176.3	-76	-177.5	-66.3	171	-4.9	112.3	G58 L59 I60 A65 R66	G58-R62 VanDerWaalsContact O-CG 3.3Å; G58-R62 WeakPolarHBondContact O-CG 3.4Å; G58-R62 PolarHBondContact O-N 3.17Å; G58-R62 PolarHBondContact O-NE 2.85Å; G58-R62 VanDerWaalsContact O-NE 3.1Å; L59-R62 PolarHBondContact O-N 3.48Å; I60-R62 VanDerWaalsContact C-N 3.35Å; I60-R62 PolarHBondContact O-N 3.39Å; R62-A65 PolarHBondContact O-N 2.93Å; R62-R66 WeakPolarHBondContact O-CG 3.3Å; R62-R66 PolarHBondContact O-N 3.31Å
63	L	98.7	Very high	98.5	Very high	112 Å²	112	97.3 Å²	97.3	59%	0.586	49%	0.49	S	S	*	.	H	α-helix	trans	-60.9	-50.2	176.3	178.2	61.7	0	0	0	110.6	L59 I60 A65 R66 C67	L59-L63 WeakPolarHBondContact O-CB 3.45Å; L59-L63 PolarHBondContact O-N 3.34Å; I60-L63 WeakPolarHBondContact O-CB 3.35Å; I60-L63 PolarHBondContact O-N 3.35Å; L63-A65 VanDerWaalsContact C-N 3.33Å; L63-A65 PolarHBondContact O-N 3.43Å; L63-R66 WeakPolarHBondContact O-CB 3.37Å; L63-R66 PolarHBondContact O-N 3.45Å; L63-R66 VanDerWaalsContact O-N 3.14Å; L63-C67 PolarHBondContact O-N 2.94Å; L63-C67 PolarHBondContact O-SG 3.38Å
64	Q	98.8	Very high	98.6	Very high	84 Å²	84	95.1 Å²	95.1	39%	0.393	49%	0.486	S	S	.	.	H	α-helix	trans	-60.5	-42.1	179.4	-67.2	-178.5	0.6	0	0	112.2	I60 T61 R66 C67 R68	I60-Q64 HydrophobicContact CG2-CG 4.28Å; I60-Q64 WeakPolarHBondContact O-CG 3.48Å; I60-Q64 PolarHBondContact O-N 2.95Å; T61-Q64 PolarHBondContact O-N 3.24Å; Q64-R66 VanDerWaalsContact C-N 3.33Å; Q64-R66 PolarHBondContact O-N 3.4Å; Q64-C67 PolarHBondContact O-N 2.93Å; Q64-R68 VanDerWaalsContact CB-NH1 3.31Å; Q64-R68 WeakPolarHBondContact O-CG 3.5Å; Q64-R68 PolarHBondContact O-N 3.46Å
65	A	98.6	Very high	98.6	Very high	60 Å²	60	98.1 Å²	98.1	50%	0.496	50%	0.497	S	S	.	.	H	α-helix	trans	-60.6	-41.6	176.1	0	0	0	0	0	111.9	T61 R62 L63 G69	T61-A65 WeakPolarHBondContact O-CB 3.44Å; T61-A65 PolarHBondContact O-N 3.28Å; R62-A65 PolarHBondContact O-N 2.93Å; L63-A65 VanDerWaalsContact C-N 3.33Å; L63-A65 PolarHBondContact O-N 3.43Å; A65-G69 PolarHBondContact O-N 3.44Å
66	R	98.7	Very high	98.6	Very high	186 Å²	186	100.5 Å²	100.5	70%	0.702	49%	0.494	S	S	*	.	H	α-helix	trans	-64.4	-44.4	175.5	-73.1	176.8	178.5	-165.5	-0	112.1	R62 L63 Q64 G69 Y70	R62-R66 WeakPolarHBondContact O-CG 3.3Å; R62-R66 PolarHBondContact O-N 3.31Å; L63-R66 WeakPolarHBondContact O-CB 3.37Å; L63-R66 PolarHBondContact O-N 3.45Å; L63-R66 VanDerWaalsContact O-N 3.14Å; Q64-R66 VanDerWaalsContact C-N 3.33Å; Q64-R66 PolarHBondContact O-N 3.4Å; R66-G69 PolarHBondContact O-N 3.45Å; R66-Y70 WeakPolarHBondContact O-CB 3.33Å; R66-Y70 PolarHBondContact O-N 2.95Å
67	C	98.8	Very high	98.6	Very high	66 Å²	66	105.5 Å²	105.5	45%	0.446	51%	0.508	S	S	.	.	H	α-helix	trans	-59.4	-52.9	176.5	-67.1	0	0	0	0	111.3	L63 Q64 G69 Y70 L71	L63-C67 PolarHBondContact O-N 2.94Å; L63-C67 PolarHBondContact O-SG 3.38Å; Q64-C67 PolarHBondContact O-N 2.93Å; C67-G69 VanDerWaalsContact C-N 3.34Å; C67-G69 PolarHBondContact O-N 3.14Å; C67-Y70 WeakPolarHBondContact O-CB 3.34Å; C67-Y70 PolarHBondContact O-N 3.05Å; C67-Y70 VanDerWaalsContact O-N 3.15Å; C67-L71 WeakPolarHBondContact O-CG 3.42Å; C67-L71 PolarHBondContact O-N 2.89Å
68	R	98.8	Very high	98.6	Very high	151 Å²	151	105.2 Å²	105.2	57%	0.57	52%	0.515	S	S	*	.	H	α-helix	trans	-57.6	-46.6	178	-70	177.5	-175.9	113.5	5.9	111.4	Q64 Y70 L71 V72	Q64-R68 VanDerWaalsContact CB-NH1 3.31Å; Q64-R68 WeakPolarHBondContact O-CG 3.5Å; Q64-R68 PolarHBondContact O-N 3.46Å; R68-Y70 VanDerWaalsContact C-N 3.33Å; R68-Y70 PolarHBondContact O-N 2.93Å; R68-L71 PolarHBondContact O-N 3.31Å; R68-V72 WeakPolarHBondContact O-CG2 3.41Å; R68-V72 PolarHBondContact O-N 2.93Å; R68-V72 VanDerWaalsContact O-N 3.17Å
69	G	98.8	Very high	98.6	Very high	20 Å²	20	109.9 Å²	109.9	21%	0.206	52%	0.519	C	S	.	.	H	α-helix	trans	-62.9	-36.7	177.6	0	0	0	0	0	113.5	A65 R66 C67 R73	A65-G69 PolarHBondContact O-N 3.44Å; R66-G69 PolarHBondContact O-N 3.45Å; C67-G69 VanDerWaalsContact C-N 3.34Å; C67-G69 PolarHBondContact O-N 3.14Å; G69-R73 VanDerWaalsContact C-CZ 3.47Å; G69-R73 WeakPolarHBondContact O-CG 3.39Å; G69-R73 PolarHBondContact O-N 3.27Å; G69-R73 PolarHBondContact O-NE 2.88Å; G69-R73 PolarHBondContact O-NH1 3.42Å
70	Y	98.7	Very high	98.6	Very high	136 Å²	136	108.4 Å²	108.4	53%	0.533	51%	0.511	S	S	.	.	H	α-helix	trans	-64.2	-48.5	175.7	172.9	-92.6	0	0	0	111.5	R66 C67 R68 V72 R73 Q74	R66-Y70 WeakPolarHBondContact O-CB 3.33Å; R66-Y70 PolarHBondContact O-N 2.95Å; C67-Y70 WeakPolarHBondContact O-CB 3.34Å; C67-Y70 PolarHBondContact O-N 3.05Å; C67-Y70 VanDerWaalsContact O-N 3.15Å; R68-Y70 VanDerWaalsContact C-N 3.33Å; R68-Y70 PolarHBondContact O-N 2.93Å; Y70-V72 PolarHBondContact O-N 3.39Å; Y70-R73 PolarHBondContact O-N 3.19Å; Y70-Q74 HydrophobicContact CE1-CB 4.47Å; Y70-Q74 WeakPolarHBondContact O-CB 3.45Å; Y70-Q74 PolarHBondContact O-N 3.41Å
71	L	98.8	Very high	98.6	Very high	103 Å²	103	109.5 Å²	109.5	54%	0.539	52%	0.517	S	S	.	.	H	α-helix	trans	-58.6	-46.3	-179	-68.4	172	0	0	0	111.7	C67 R68 R73 Q74 E75	C67-L71 WeakPolarHBondContact O-CG 3.42Å; C67-L71 PolarHBondContact O-N 2.89Å; R68-L71 PolarHBondContact O-N 3.31Å; L71-R73 PolarHBondContact O-N 3.18Å; L71-Q74 WeakPolarHBondContact O-CB 3.45Å; L71-Q74 PolarHBondContact O-N 3.04Å; L71-E75 PolarHBondContact O-N 3.15Å
72	V	98.7	Very high	98.6	Very high	96 Å²	96	110.6 Å²	110.6	58%	0.582	52%	0.516	S	S	*	.	H	α-helix	trans	-59.5	-45.3	177	172.5	0	0	0	0	111.5	R68 Y70 Q74 E75 F76	R68-V72 WeakPolarHBondContact O-CG2 3.41Å; R68-V72 PolarHBondContact O-N 2.93Å; R68-V72 VanDerWaalsContact O-N 3.17Å; Y70-V72 PolarHBondContact O-N 3.39Å; V72-Q74 VanDerWaalsContact C-N 3.32Å; V72-Q74 PolarHBondContact O-N 3.3Å; V72-E75 PolarHBondContact O-N 3.44Å; V72-F76 WeakPolarHBondContact O-CB 3.49Å; V72-F76 PolarHBondContact O-N 3.23Å
73	R	98.6	Very high	98.5	Very high	139 Å²	139	107 Å²	107	53%	0.525	51%	0.507	S	S	.	.	H	α-helix	trans	-66.2	-35.8	178.7	-73.6	-174.2	-65.2	-89.5	1.1	112.2	G69 Y70 L71 R77	G69-R73 VanDerWaalsContact C-CZ 3.47Å; G69-R73 WeakPolarHBondContact O-CG 3.39Å; G69-R73 PolarHBondContact O-N 3.27Å; G69-R73 PolarHBondContact O-NE 2.88Å; G69-R73 PolarHBondContact O-NH1 3.42Å; Y70-R73 PolarHBondContact O-N 3.19Å; L71-R73 PolarHBondContact O-N 3.18Å; R73-R77 WeakPolarHBondContact O-CB 3.4Å; R73-R77 VanDerWaalsContact O-CG 3.24Å; R73-R77 WeakPolarHBondContact O-CG 3.39Å; R73-R77 PolarHBondContact O-N 3.49Å
74	Q	98.6	Very high	98.5	Very high	99 Å²	99	107.5 Å²	107.5	46%	0.463	51%	0.505	S	S	.	.	H	α-helix	trans	-64.4	-49.4	176.7	-176.4	-177.7	20.3	0	0	110.8	Y70 L71 V72 R77 S78	Y70-Q74 HydrophobicContact CE1-CB 4.47Å; Y70-Q74 WeakPolarHBondContact O-CB 3.45Å; Y70-Q74 PolarHBondContact O-N 3.41Å; L71-Q74 WeakPolarHBondContact O-CB 3.45Å; L71-Q74 PolarHBondContact O-N 3.04Å; V72-Q74 VanDerWaalsContact C-N 3.32Å; V72-Q74 PolarHBondContact O-N 3.3Å; Q74-R77 PolarHBondContact O-N 3.43Å; Q74-S78 PolarHBondContact O-N 2.95Å
75	E	98.6	Very high	98.4	Very high	146 Å²	146	111.6 Å²	111.6	68%	0.682	52%	0.521	S	S	*	.	H	α-helix	trans	-61.3	-47	177.9	-173.1	-179	178.2	0	0	111.5	L71 V72 R77 S78 R79	L71-E75 PolarHBondContact O-N 3.15Å; V72-E75 PolarHBondContact O-N 3.44Å; E75-R77 VanDerWaalsContact C-N 3.34Å; E75-R77 PolarHBondContact O-N 2.86Å; E75-S78 WeakPolarHBondContact O-CB 3.27Å; E75-S78 PolarHBondContact O-N 3.26Å; E75-S78 VanDerWaalsContact O-N 3.13Å; E75-R79 PolarHBondContact O-N 3.35Å
76	F	98.6	Very high	98.3	Very high	128 Å²	128	112.2 Å²	112.2	56%	0.561	51%	0.513	S	S	*	.	H	α-helix	trans	-57.2	-46	176.5	179.4	-96	0	0	0	112.1	V72 S78 R79 M80	V72-F76 WeakPolarHBondContact O-CB 3.49Å; V72-F76 PolarHBondContact O-N 3.23Å; F76-S78 VanDerWaalsContact C-N 3.34Å; F76-S78 PolarHBondContact O-N 3.47Å; F76-R79 PolarHBondContact O-N 2.9Å; F76-M80 HydrophobicContact CE1-CE 4.11Å; F76-M80 HydrophobicContact CE2-CE 4.13Å; F76-M80 HydrophobicContact CZ-CE 3.54Å; F76-M80 VanDerWaalsContact O-CB 3.27Å; F76-M80 WeakPolarHBondContact O-CB 3.37Å; F76-M80 PolarHBondContact O-N 3.37Å
77	R	98.6	Very high	98.2	Very high	171 Å²	171	107.9 Å²	107.9	65%	0.645	50%	0.503	S	S	*	.	H	α-helix	trans	-61.7	-42.8	176.5	-77.1	176.1	-176.6	-165.8	1.3	111.6	R73 Q74 E75 M80 N81	R73-R77 WeakPolarHBondContact O-CB 3.4Å; R73-R77 VanDerWaalsContact O-CG 3.24Å; R73-R77 WeakPolarHBondContact O-CG 3.39Å; R73-R77 PolarHBondContact O-N 3.49Å; Q74-R77 PolarHBondContact O-N 3.43Å; E75-R77 VanDerWaalsContact C-N 3.34Å; E75-R77 PolarHBondContact O-N 2.86Å; R77-M80 PolarHBondContact O-N 3.01Å; R77-N81 VanDerWaalsContact O-CB 3.29Å; R77-N81 WeakPolarHBondContact O-CB 3.36Å; R77-N81 PolarHBondContact O-N 3.04Å; R77-N81 PolarHBondContact O-ND2 3.4Å
78	S	98.5	Very high	98.1	Very high	81 Å²	81	109 Å²	109	57%	0.566	51%	0.51	S	S	*	.	H	α-helix	trans	-58.3	-50.2	176.5	-175.3	0	0	0	0	111.2	Q74 E75 F76 M80 N81 F82	Q74-S78 PolarHBondContact O-N 2.95Å; E75-S78 WeakPolarHBondContact O-CB 3.27Å; E75-S78 PolarHBondContact O-N 3.26Å; E75-S78 VanDerWaalsContact O-N 3.13Å; F76-S78 VanDerWaalsContact C-N 3.34Å; F76-S78 PolarHBondContact O-N 3.47Å; S78-M80 PolarHBondContact O-N 3.32Å; S78-N81 PolarHBondContact O-N 3.26Å; S78-F82 PolarHBondContact O-N 2.91Å
79	R	98.3	Very high	98	Very high	141 Å²	141	104 Å²	104	53%	0.532	50%	0.501	S	S	.	.	H	α-helix	trans	-63.2	-44.5	178.9	-176.9	58.3	177.4	155.4	0.2	112.4	E75 F76 N81 F82 L83	E75-R79 PolarHBondContact O-N 3.35Å; F76-R79 PolarHBondContact O-N 2.9Å; R79-N81 VanDerWaalsContact C-N 3.34Å; R79-N81 PolarHBondContact O-N 3.47Å; R79-F82 VanDerWaalsContact NH1-CE1 3.28Å; R79-F82 WeakPolarHBondContact O-CB 3.4Å; R79-F82 PolarHBondContact O-N 3.13Å; R79-L83 HydrophobicContact CG-CD1 4.36Å; R79-L83 WeakPolarHBondContact O-CG 3.49Å; R79-L83 PolarHBondContact O-N 2.96Å
80	M	98.3	Very high	97.8	Very high	65 Å²	65	106.8 Å²	106.8	32%	0.32	51%	0.51	S	S	.	.	H	α-helix	trans	-61.5	-43.2	177.7	-173.9	59.3	63.5	0	0	111.4	F76 R77 S78 F82 L83 K84	F76-M80 HydrophobicContact CE1-CE 4.11Å; F76-M80 HydrophobicContact CE2-CE 4.13Å; F76-M80 HydrophobicContact CZ-CE 3.54Å; F76-M80 VanDerWaalsContact O-CB 3.27Å; F76-M80 WeakPolarHBondContact O-CB 3.37Å; F76-M80 PolarHBondContact O-N 3.37Å; R77-M80 PolarHBondContact O-N 3.01Å; S78-M80 PolarHBondContact O-N 3.32Å; M80-F82 VanDerWaalsContact C-N 3.35Å; M80-L83 PolarHBondContact O-N 2.95Å; M80-K84 HydrophobicContact CG-CD 4.32Å; M80-K84 WeakPolarHBondContact O-CB 3.42Å; M80-K84 WeakPolarHBondContact O-CG 3.24Å; M80-K84 PolarHBondContact O-N 2.89Å
81	N	98.4	Very high	97.7	Very high	88 Å²	88	103.4 Å²	103.4	47%	0.471	50%	0.504	S	S	.	.	H	α-helix	trans	-64.2	-40.7	176.8	-72.6	-16.7	0	0	0	111.7	R77 S78 R79 K85	R77-N81 VanDerWaalsContact O-CB 3.29Å; R77-N81 WeakPolarHBondContact O-CB 3.36Å; R77-N81 PolarHBondContact O-N 3.04Å; R77-N81 PolarHBondContact O-ND2 3.4Å; S78-N81 PolarHBondContact O-N 3.26Å; R79-N81 VanDerWaalsContact C-N 3.34Å; R79-N81 PolarHBondContact O-N 3.47Å; N81-K85 WeakPolarHBondContact O-CG 3.45Å; N81-K85 PolarHBondContact O-N 3.14Å; N81-K85 VanDerWaalsContact O-N 3.11Å
82	F	97.9	Very high	97.6	Very high	102 Å²	102	102.7 Å²	102.7	45%	0.447	51%	0.506	S	S	.	.	H	α-helix	trans	-58.1	-51.6	172.5	174.6	-88.5	0	0	0	111.1	S78 R79 M80 K84 K85 Q86	S78-F82 PolarHBondContact O-N 2.91Å; R79-F82 VanDerWaalsContact NH1-CE1 3.28Å; R79-F82 WeakPolarHBondContact O-CB 3.4Å; R79-F82 PolarHBondContact O-N 3.13Å; M80-F82 VanDerWaalsContact C-N 3.35Å; F82-K84 VanDerWaalsContact C-N 3.35Å; F82-K84 PolarHBondContact O-N 3.29Å; F82-K85 WeakPolarHBondContact O-CB 3.45Å; F82-K85 PolarHBondContact O-N 3.34Å; F82-K85 VanDerWaalsContact O-N 3.14Å; F82-Q86 HydrophobicContact CD1-CG 4.27Å; F82-Q86 HydrophobicContact CE1-CG 3.82Å; F82-Q86 HydrophobicContact CZ-CG 3.99Å; F82-Q86 WeakPolarHBondContact O-CG 3.3Å; F82-Q86 PolarHBondContact O-N 3.31Å
83	L	97.1	Very high	97.4	Very high	72 Å²	72	102.9 Å²	102.9	38%	0.377	50%	0.503	S	S	.	.	H	α-helix	trans	-60.7	-43.5	-178.9	-70	174.4	0	0	0	111.9	R79 M80 K85 Q86 I87	R79-L83 HydrophobicContact CG-CD1 4.36Å; R79-L83 WeakPolarHBondContact O-CG 3.49Å; R79-L83 PolarHBondContact O-N 2.96Å; M80-L83 PolarHBondContact O-N 2.95Å; L83-K85 VanDerWaalsContact C-N 3.28Å; L83-K85 PolarHBondContact O-N 3.11Å; L83-Q86 WeakPolarHBondContact O-CB 3.47Å; L83-Q86 PolarHBondContact O-N 3.3Å; L83-I87 PolarHBondContact O-N 3.32Å
84	K	97.6	Very high	97.2	Very high	124 Å²	124	101 Å²	101	54%	0.539	50%	0.5	S	S	.	.	H	α-helix	trans	-57.8	-40	175.8	-75.9	178	177.1	-175.8	0	112.5	M80 F82 Q86 I87	M80-K84 HydrophobicContact CG-CD 4.32Å; M80-K84 WeakPolarHBondContact O-CB 3.42Å; M80-K84 WeakPolarHBondContact O-CG 3.24Å; M80-K84 PolarHBondContact O-N 2.89Å; F82-K84 VanDerWaalsContact C-N 3.35Å; F82-K84 PolarHBondContact O-N 3.29Å; K84-Q86 PolarHBondContact O-N 3.37Å; K84-I87 HydrophobicContact CG-CD1 4.44Å; K84-I87 PolarHBondContact O-N 3.36Å
85	K	97.8	Very high	97.1	Very high	169 Å²	169	99.8 Å²	99.8	74%	0.735	50%	0.5	S	S	*	.	H	α-helix	trans	-64.4	-27.3	175.5	-71.9	174.3	179.6	-174.1	0	112.9	N81 F82 L83 P88	N81-K85 WeakPolarHBondContact O-CG 3.45Å; N81-K85 PolarHBondContact O-N 3.14Å; N81-K85 VanDerWaalsContact O-N 3.11Å; F82-K85 WeakPolarHBondContact O-CB 3.45Å; F82-K85 PolarHBondContact O-N 3.34Å; F82-K85 VanDerWaalsContact O-N 3.14Å; L83-K85 VanDerWaalsContact C-N 3.28Å; L83-K85 PolarHBondContact O-N 3.11Å; K85-P88 WeakPolarHBondContact O-CD 3.45Å
86	Q	96.6	Very high	96.9	Very high	73 Å²	73	99.6 Å²	99.6	34%	0.341	50%	0.497	S	S	.	.	H	α-helix	trans	-83.4	-16.6	179.4	-58.7	-56	-25.7	0	0	113.7	F82 L83 K84 A89 I90	F82-Q86 HydrophobicContact CD1-CG 4.27Å; F82-Q86 HydrophobicContact CE1-CG 3.82Å; F82-Q86 HydrophobicContact CZ-CG 3.99Å; F82-Q86 WeakPolarHBondContact O-CG 3.3Å; F82-Q86 PolarHBondContact O-N 3.31Å; L83-Q86 WeakPolarHBondContact O-CB 3.47Å; L83-Q86 PolarHBondContact O-N 3.3Å; K84-Q86 PolarHBondContact O-N 3.37Å; Q86-A89 PolarHBondContact O-N 3.12Å; Q86-A89 VanDerWaalsContact O-N 3.11Å; Q86-I90 HydrophobicContact CB-CD1 3.97Å; Q86-I90 HydrophobicContact CB-CG1 4.45Å; Q86-I90 WeakPolarHBondContact O-CG1 3.32Å; Q86-I90 PolarHBondContact O-N 3.43Å
87	I	97	Very high	96.6	Very high	95 Å²	95	98.4 Å²	98.4	49%	0.487	49%	0.493	S	S	.	.	H	α-helix	trans	-50.3	-49	-176.7	-67.9	175	0	0	0	112.4	L83 K84 A89 I90 T91	L83-I87 PolarHBondContact O-N 3.32Å; K84-I87 HydrophobicContact CG-CD1 4.44Å; K84-I87 PolarHBondContact O-N 3.36Å; I87-A89 VanDerWaalsContact C-N 3.32Å; I87-A89 PolarHBondContact O-N 3.42Å; I87-I90 PolarHBondContact O-N 3.14Å; I87-T91 PolarHBondContact O-N 3.3Å; I87-T91 PolarHBondContact O-OG1 3.42Å
88	P	96.3	Very high	96.2	Very high	89 Å²	89	94.9 Å²	94.9	58%	0.578	49%	0.487	S	S	*	.	H	α-helix	trans	-60.3	-40.5	-178.6	-23.8	35.1	0	0	0	113.4	K85 T91 C92	K85-P88 WeakPolarHBondContact O-CD 3.45Å; P88-T91 PolarHBondContact O-N 2.98Å; P88-C92 WeakPolarHBondContact O-CB 3.29Å; P88-C92 PolarHBondContact O-N 3.24Å
89	A	96.3	Very high	95.8	Very high	46 Å²	46	95.4 Å²	95.4	38%	0.38	48%	0.483	S	S	.	.	H	α-helix	trans	-67.7	-43.2	178.4	0	0	0	0	0	111.5	Q86 I87 C92 I93	Q86-A89 PolarHBondContact O-N 3.12Å; Q86-A89 VanDerWaalsContact O-N 3.11Å; I87-A89 VanDerWaalsContact C-N 3.32Å; I87-A89 PolarHBondContact O-N 3.42Å; A89-C92 WeakPolarHBondContact O-CB 3.45Å; A89-C92 PolarHBondContact O-N 2.97Å; A89-I93 WeakPolarHBondContact O-CG1 3.4Å; A89-I93 PolarHBondContact O-N 3.49Å
90	I	94.6	Very high	95.3	Very high	79 Å²	79	90.2 Å²	90.2	41%	0.405	47%	0.468	S	S	.	.	H	α-helix	trans	-59.9	-47.9	175.7	-66.4	167	0	0	0	110.2	Q86 I87 C92 I93 Q94	Q86-I90 HydrophobicContact CB-CD1 3.97Å; Q86-I90 HydrophobicContact CB-CG1 4.45Å; Q86-I90 WeakPolarHBondContact O-CG1 3.32Å; Q86-I90 PolarHBondContact O-N 3.43Å; I87-I90 PolarHBondContact O-N 3.14Å; I90-C92 VanDerWaalsContact C-N 3.32Å; I90-C92 PolarHBondContact O-N 3.41Å; I90-I93 PolarHBondContact O-N 3.34Å; I90-Q94 HydrophobicContact CG2-CG 4.31Å; I90-Q94 WeakPolarHBondContact O-CB 3.47Å; I90-Q94 VanDerWaalsContact O-CG 3.3Å; I90-Q94 WeakPolarHBondContact O-CG 3.36Å; I90-Q94 PolarHBondContact O-N 3.48Å
91	T	95.8	Very high	94.8	Very high	66 Å²	66	92.8 Å²	92.8	41%	0.405	48%	0.479	S	S	.	.	H	α-helix	trans	-60.3	-42.5	177.9	-57	0	0	0	0	111.3	I87 P88 I93 Q94 V95	I87-T91 PolarHBondContact O-N 3.3Å; I87-T91 PolarHBondContact O-OG1 3.42Å; P88-T91 PolarHBondContact O-N 2.98Å; T91-I93 PolarHBondContact O-N 3.02Å; T91-Q94 PolarHBondContact O-N 3.35Å; T91-V95 HydrophobicContact CG2-CG2 4.29Å; T91-V95 WeakPolarHBondContact O-CB 3.45Å; T91-V95 VanDerWaalsContact O-CG2 3.28Å; T91-V95 WeakPolarHBondContact O-CG2 3.32Å; T91-V95 PolarHBondContact O-N 3.42Å
92	C	96.6	Very high	94.1	Very high	87 Å²	87	96.2 Å²	96.2	59%	0.588	49%	0.485	S	S	*	.	H	α-helix	trans	-58.2	-49.2	176.7	-175	0	0	0	0	111.7	P88 A89 I90 Q94 V95 F96	P88-C92 WeakPolarHBondContact O-CB 3.29Å; P88-C92 PolarHBondContact O-N 3.24Å; A89-C92 WeakPolarHBondContact O-CB 3.45Å; A89-C92 PolarHBondContact O-N 2.97Å; I90-C92 VanDerWaalsContact C-N 3.32Å; I90-C92 PolarHBondContact O-N 3.41Å; C92-Q94 PolarHBondContact O-N 2.92Å; C92-V95 PolarHBondContact O-N 2.96Å; C92-F96 WeakPolarHBondContact O-CB 3.39Å; C92-F96 PolarHBondContact O-N 3.03Å
93	I	95.1	Very high	93.2	Very high	100 Å²	100	98.8 Å²	98.8	51%	0.513	50%	0.499	S	S	.	.	H	α-helix	trans	-61.5	-45.7	178.3	-66.8	166.1	0	0	0	110.9	A89 I90 T91 F96 Q97	A89-I93 WeakPolarHBondContact O-CG1 3.4Å; A89-I93 PolarHBondContact O-N 3.49Å; I90-I93 PolarHBondContact O-N 3.34Å; T91-I93 PolarHBondContact O-N 3.02Å; I93-F96 PolarHBondContact O-N 3.49Å; I93-Q97 HydrophobicContact CG2-CG 4.44Å; I93-Q97 WeakPolarHBondContact O-CG 3.35Å; I93-Q97 PolarHBondContact O-N 2.99Å
94	Q	94.6	Very high	92.2	Very high	99 Å²	99	102.9 Å²	102.9	46%	0.463	52%	0.516	S	S	.	.	H	α-helix	trans	-63.3	-43.5	-179.8	-73.6	174.2	-25.6	0	0	112.2	I90 T91 C92 Q97 N98	I90-Q94 HydrophobicContact CG2-CG 4.31Å; I90-Q94 WeakPolarHBondContact O-CB 3.47Å; I90-Q94 VanDerWaalsContact O-CG 3.3Å; I90-Q94 WeakPolarHBondContact O-CG 3.36Å; I90-Q94 PolarHBondContact O-N 3.48Å; T91-Q94 PolarHBondContact O-N 3.35Å; C92-Q94 PolarHBondContact O-N 2.92Å; Q94-Q97 PolarHBondContact O-N 3.24Å; Q94-N98 WeakPolarHBondContact O-CB 3.28Å; Q94-N98 PolarHBondContact O-N 3.32Å; Q94-N98 PolarHBondContact O-ND2 2.98Å
95	V	96	Very high	91.3	Very high	75 Å²	75	100.2 Å²	100.2	46%	0.455	52%	0.517	S	S	.	.	H	α-helix	trans	-62.1	-46	176.6	169.9	0	0	0	0	110.4	T91 C92 N98 L99	T91-V95 HydrophobicContact CG2-CG2 4.29Å; T91-V95 WeakPolarHBondContact O-CB 3.45Å; T91-V95 VanDerWaalsContact O-CG2 3.28Å; T91-V95 WeakPolarHBondContact O-CG2 3.32Å; T91-V95 PolarHBondContact O-N 3.42Å; C92-V95 PolarHBondContact O-N 2.96Å; V95-N98 PolarHBondContact O-N 3.35Å; V95-L99 HydrophobicContact CG1-CD1 3.88Å; V95-L99 HydrophobicContact CG1-CG 4.42Å; V95-L99 WeakPolarHBondContact O-CG 3.48Å; V95-L99 PolarHBondContact O-N 3.42Å
96	F	95.1	Very high	90	Very high	142 Å²	142	95.6 Å²	95.6	62%	0.623	52%	0.518	S	S	*	.	H	α-helix	trans	-59.4	-49.7	178.5	-178.4	-96.8	0	0	0	111.9	C92 I93 N98 L99 S100	C92-F96 WeakPolarHBondContact O-CB 3.39Å; C92-F96 PolarHBondContact O-N 3.03Å; I93-F96 PolarHBondContact O-N 3.49Å; F96-N98 VanDerWaalsContact C-N 3.35Å; F96-N98 PolarHBondContact O-N 3.27Å; F96-L99 PolarHBondContact O-N 3.28Å; F96-S100 PolarHBondContact O-N 3.43Å; F96-S100 PolarHBondContact O-OG 3.05Å; F96-S100 VanDerWaalsContact O-OG 3.14Å
97	Q	92.3	Very high	88	Confident	102 Å²	102	101 Å²	101	48%	0.477	55%	0.547	S	S	.	.	H	α-helix	trans	-58.4	-45.7	177.5	-73.6	176.1	-17	0	0	112	I93 Q94 L99 S100 H101	I93-Q97 HydrophobicContact CG2-CG 4.44Å; I93-Q97 WeakPolarHBondContact O-CG 3.35Å; I93-Q97 PolarHBondContact O-N 2.99Å; Q94-Q97 PolarHBondContact O-N 3.24Å; Q97-L99 VanDerWaalsContact C-N 3.33Å; Q97-L99 PolarHBondContact O-N 3.11Å; Q97-S100 PolarHBondContact O-N 3.25Å; Q97-H101 PolarHBondContact O-CD2 3.13Å; Q97-H101 PolarHBondContact O-N 3.04Å
98	N	91.3	Very high	87.5	Confident	97 Å²	97	101.4 Å²	101.4	52%	0.519	55%	0.55	S	S	.	*	H	α-helix	trans	-62.7	-39.1	179.2	-72.5	-29.3	0	0	0	112.5	Q94 V95 F96 R102	Q94-N98 WeakPolarHBondContact O-CB 3.28Å; Q94-N98 PolarHBondContact O-N 3.32Å; Q94-N98 PolarHBondContact O-ND2 2.98Å; V95-N98 PolarHBondContact O-N 3.35Å; F96-N98 VanDerWaalsContact C-N 3.35Å; F96-N98 PolarHBondContact O-N 3.27Å; N98-R102 WeakPolarHBondContact O-CG 3.34Å; N98-R102 PolarHBondContact O-N 2.98Å; N98-R102 VanDerWaalsContact O-N 3.13Å
99	L	90.1	Very high	87.1	Confident	92 Å²	92	102 Å²	102	48%	0.482	55%	0.549	S	S	.	.	H	α-helix	trans	-66.4	-45.2	175.7	-72.4	170.5	0	0	0	111.5	V95 F96 Q97 H101 R102 Q103	V95-L99 HydrophobicContact CG1-CD1 3.88Å; V95-L99 HydrophobicContact CG1-CG 4.42Å; V95-L99 WeakPolarHBondContact O-CG 3.48Å; V95-L99 PolarHBondContact O-N 3.42Å; F96-L99 PolarHBondContact O-N 3.28Å; Q97-L99 VanDerWaalsContact C-N 3.33Å; Q97-L99 PolarHBondContact O-N 3.11Å; L99-H101 VanDerWaalsContact C-N 3.33Å; L99-H101 PolarHBondContact O-N 3.22Å; L99-R102 PolarHBondContact O-N 3.34Å; L99-Q103 WeakPolarHBondContact O-CG 3.47Å; L99-Q103 PolarHBondContact O-N 2.99Å
100	S	87.6	Confident	86.6	Confident	32 Å²	32	105.1 Å²	105.1	22%	0.224	56%	0.558	C	S	.	*	H	α-helix	trans	-60.5	-41.2	176.9	-58.7	0	0	0	0	112.3	F96 Q97 Q103 Q104	F96-S100 PolarHBondContact O-N 3.43Å; F96-S100 PolarHBondContact O-OG 3.05Å; F96-S100 VanDerWaalsContact O-OG 3.14Å; Q97-S100 PolarHBondContact O-N 3.25Å; S100-Q103 PolarHBondContact O-N 3.1Å; S100-Q104 WeakPolarHBondContact O-CG 3.44Å; S100-Q104 PolarHBondContact O-N 3.04Å; S100-Q104 VanDerWaalsContact O-N 3.12Å
101	H	86.6	Confident	86.1	Confident	119 Å²	119	106.6 Å²	106.6	55%	0.551	57%	0.567	S	S	*	*	H	α-helix	trans	-65.3	-38.1	176.2	-74.9	-55.7	0	0	0	112.9	Q97 L99 Q104 A105	Q97-H101 PolarHBondContact O-CD2 3.13Å; Q97-H101 PolarHBondContact O-N 3.04Å; L99-H101 VanDerWaalsContact C-N 3.33Å; L99-H101 PolarHBondContact O-N 3.22Å; H101-Q104 PolarHBondContact O-N 2.91Å; H101-A105 WeakPolarHBondContact O-CB 3.4Å; H101-A105 PolarHBondContact O-N 2.96Å
102	R	83.8	Confident	85.5	Confident	161 Å²	161	109.2 Å²	109.2	61%	0.608	58%	0.577	S	S	*	*	H	α-helix	trans	-65	-43	175.6	-75	179	177.2	-179.6	-1.2	112.3	N98 L99 Q104 A105 G106 I107	N98-R102 WeakPolarHBondContact O-CG 3.34Å; N98-R102 PolarHBondContact O-N 2.98Å; N98-R102 VanDerWaalsContact O-N 3.13Å; L99-R102 PolarHBondContact O-N 3.34Å; R102-Q104 VanDerWaalsContact C-N 3.29Å; R102-Q104 PolarHBondContact O-N 3.41Å; R102-A105 PolarHBondContact O-N 3.49Å; R102-A105 VanDerWaalsContact O-N 3.1Å; R102-G106 PolarHBondContact O-N 2.88Å; R102-I107 PolarHBondContact O-N 3Å
103	Q	79.1	Confident	84.7	Confident	155 Å²	155	110.7 Å²	110.7	72%	0.724	58%	0.576	S	S	*	*	H	α-helix	trans	-60.5	-37.6	175.4	-71.4	177.1	-23.4	0	0	112.5	L99 S100	L99-Q103 WeakPolarHBondContact O-CG 3.47Å; L99-Q103 PolarHBondContact O-N 2.99Å; S100-Q103 PolarHBondContact O-N 3.1Å
104	Q	75.7	Confident	84	Confident	158 Å²	158	111.4 Å²	111.4	74%	0.738	58%	0.581	S	S	*	*	H	α-helix	trans	-72.7	-27.9	175.5	-70.8	174.3	-1.7	0	0	113.2	S100 H101 R102 G106	S100-Q104 WeakPolarHBondContact O-CG 3.44Å; S100-Q104 PolarHBondContact O-N 3.04Å; S100-Q104 VanDerWaalsContact O-N 3.12Å; H101-Q104 PolarHBondContact O-N 2.91Å; R102-Q104 VanDerWaalsContact C-N 3.29Å; R102-Q104 PolarHBondContact O-N 3.41Å; Q104-G106 VanDerWaalsContact C-N 3.31Å
105	A	79.2	Confident	83.2	Confident	69 Å²	69	112.4 Å²	112.4	57%	0.57	59%	0.59	S	S	*	*	T	Hydrogen-bonded Turn	trans	-82.4	-4.3	177.9	0	0	0	0	0	113.8	H101 R102 I107	H101-A105 WeakPolarHBondContact O-CB 3.4Å; H101-A105 PolarHBondContact O-N 2.96Å; R102-A105 PolarHBondContact O-N 3.49Å; R102-A105 VanDerWaalsContact O-N 3.1Å; A105-I107 VanDerWaalsContact C-N 3.29Å; A105-I107 HydrophobicContact CB-CD1 4.45Å; A105-I107 HydrophobicContact CB-CG1 4.37Å; A105-I107 PolarHBondContact O-N 3.31Å
106	G	69.5	Low	82.1	Confident	72 Å²	72	115.5 Å²	115.5	74%	0.742	60%	0.601	S	S	*	*	T	Hydrogen-bonded Turn	trans	69	23.1	179.5	0	0	0	0	0	114.6	R102 Q104	R102-G106 PolarHBondContact O-N 2.88Å; Q104-G106 VanDerWaalsContact C-N 3.31Å
107	I	55.4	Low	81	Confident	187 Å²	187	113.1 Å²	113.1	96%	0.959	60%	0.599	S	S	*	*			trans	-98.1	0	173	-51.3	174.7	0	0	0	109.6	R102 A105	R102-I107 PolarHBondContact O-N 3Å; A105-I107 VanDerWaalsContact C-N 3.29Å; A105-I107 HydrophobicContact CB-CD1 4.45Å; A105-I107 HydrophobicContact CB-CG1 4.37Å; A105-I107 PolarHBondContact O-N 3.31Å

Retrieved 107 of 107 residues in 57 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).