A0A087WWT7_HUMAN Loading...

Adhesion G protein-coupled receptor D2

AlphaFold DB , UniProt , Accession A0A087WWT7, Species HUMAN (Homo sapiens, Human), Gene ADGRD2, Length 41 aa.

						>A0A087WWT7_HUMAN|A0A087WWT7|ADGRD2
FLVAFSWMLVEGLLLWRKVVAVSMHPGPGMRLYHATGWGPR
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	F	71.1	Confident	88.1	Confident	230 Å²	230	124.6 Å²	124.6	100%	1.009	64%	0.636	S	S	*	*				0	-60.9	0	-110.3	-90.1	0	0	0	112.5	V3 A4 F5	F1-V3 PolarHBondContact O-N 2.95Å; F1-A4 PolarHBondContact O-N 3.12Å; F1-F5 PolarHBondContact O-N 2.97Å
2	L	88.2	Confident	88.5	Confident	152 Å²	152	117.9 Å²	117.9	80%	0.796	62%	0.621	S	S	*	*	H	α-helix	trans	-60	-37.9	-178.8	-71.1	153.6	0	0	0	114.3	F5 S6	L2-F5 PolarHBondContact O-N 2.71Å; L2-S6 VanDerWaalsContact O-CB 3.31Å; L2-S6 WeakPolarHBondContact O-CB 3.34Å; L2-S6 PolarHBondContact O-N 3.12Å
3	V	86.1	Confident	88.7	Confident	119 Å²	119	116.2 Å²	116.2	72%	0.721	61%	0.612	S	S	*	*	H	α-helix	trans	-65	-43.1	180	68	0	0	0	0	112.8	F1 F5 S6 W7	F1-V3 PolarHBondContact O-N 2.95Å; V3-F5 VanDerWaalsContact C-N 3.35Å; V3-S6 PolarHBondContact O-N 2.82Å; V3-W7 WeakPolarHBondContact O-CB 2.84Å; V3-W7 PolarHBondContact O-N 3.1Å
4	A	86.3	Confident	88.8	Confident	64 Å²	64	115 Å²	115	53%	0.529	61%	0.605	S	S	.	*	H	α-helix	trans	-68.5	-37.1	177.6	0	0	0	0	0	111.3	F1 W7 M8	F1-A4 PolarHBondContact O-N 3.12Å; A4-W7 PolarHBondContact O-N 3.12Å; A4-M8 WeakPolarHBondContact O-CB 3.3Å; A4-M8 PolarHBondContact O-N 2.87Å
5	F	84.7	Confident	88.8	Confident	137 Å²	137	115.2 Å²	115.2	60%	0.601	61%	0.606	S	S	*	*	H	α-helix	trans	-65.3	-44.1	173.8	-175.8	-99.9	0	0	0	112	F1 L2 V3 W7 M8 L9	F1-F5 PolarHBondContact O-N 2.97Å; L2-F5 PolarHBondContact O-N 2.71Å; V3-F5 VanDerWaalsContact C-N 3.35Å; F5-W7 VanDerWaalsContact C-N 3.32Å; F5-W7 PolarHBondContact O-N 3.49Å; F5-M8 PolarHBondContact O-N 3.27Å; F5-L9 WeakPolarHBondContact O-CB 3.14Å; F5-L9 PolarHBondContact O-N 2.79Å
6	S	88.7	Confident	88.8	Confident	72 Å²	72	118.3 Å²	118.3	50%	0.503	61%	0.607	S	S	.	*	H	α-helix	trans	-64.4	-38.1	178	-157.8	0	0	0	0	111.6	L2 V3 L9 V10	L2-S6 VanDerWaalsContact O-CB 3.31Å; L2-S6 WeakPolarHBondContact O-CB 3.34Å; L2-S6 PolarHBondContact O-N 3.12Å; V3-S6 PolarHBondContact O-N 2.82Å; S6-L9 PolarHBondContact O-N 3.48Å; S6-V10 WeakPolarHBondContact O-CB 3.45Å; S6-V10 PolarHBondContact O-N 3.41Å
7	W	91.4	Very high	88.5	Confident	175 Å²	175	121.1 Å²	121.1	66%	0.663	61%	0.608	S	S	*	*	H	α-helix	trans	-63.8	-46.8	173.1	-170	-93.9	0	0	0	112.3	V3 A4 F5 L9 V10 E11	V3-W7 WeakPolarHBondContact O-CB 2.84Å; V3-W7 PolarHBondContact O-N 3.1Å; A4-W7 PolarHBondContact O-N 3.12Å; F5-W7 VanDerWaalsContact C-N 3.32Å; F5-W7 PolarHBondContact O-N 3.49Å; W7-L9 VanDerWaalsContact C-N 3.3Å; W7-L9 PolarHBondContact O-N 3.36Å; W7-V10 PolarHBondContact O-N 3.28Å; W7-E11 WeakPolarHBondContact O-CG 3.37Å; W7-E11 PolarHBondContact O-N 3.37Å
8	M	93.8	Very high	88.2	Confident	152 Å²	152	122.8 Å²	122.8	75%	0.749	61%	0.611	S	S	*	*	H	α-helix	trans	-65.3	-33.7	179.5	-164.5	166.7	171.6	0	0	112.4	A4 F5 G12	A4-M8 WeakPolarHBondContact O-CB 3.3Å; A4-M8 PolarHBondContact O-N 2.87Å; F5-M8 PolarHBondContact O-N 3.27Å; M8-G12 PolarHBondContact O-N 3.46Å
9	L	92.9	Very high	88.1	Confident	112 Å²	112	120.4 Å²	120.4	59%	0.586	60%	0.604	S	S	*	*	H	α-helix	trans	-70.1	-41	173.1	-161.5	78.6	0	0	0	111.9	F5 S6 W7 L13	F5-L9 WeakPolarHBondContact O-CB 3.14Å; F5-L9 PolarHBondContact O-N 2.79Å; S6-L9 PolarHBondContact O-N 3.48Å; W7-L9 VanDerWaalsContact C-N 3.3Å; W7-L9 PolarHBondContact O-N 3.36Å; L9-L13 VanDerWaalsContact O-CB 3.31Å; L9-L13 WeakPolarHBondContact O-CB 3.14Å; L9-L13 PolarHBondContact O-N 2.66Å
10	V	92.4	Very high	87.8	Confident	73 Å²	73	116.8 Å²	116.8	44%	0.442	59%	0.588	S	S	.	*	H	α-helix	trans	-62.2	-45.7	176.3	138.3	0	0	0	0	111.3	S6 W7 G12 L13 L14	S6-V10 WeakPolarHBondContact O-CB 3.45Å; S6-V10 PolarHBondContact O-N 3.41Å; W7-V10 PolarHBondContact O-N 3.28Å; V10-G12 PolarHBondContact O-N 2.89Å; V10-L13 PolarHBondContact O-N 3.2Å; V10-L14 WeakPolarHBondContact O-CB 3.23Å; V10-L14 PolarHBondContact O-N 3.29Å
11	E	93.1	Very high	87.4	Confident	85 Å²	85	114.1 Å²	114.1	40%	0.397	58%	0.584	S	S	.	*	H	α-helix	trans	-63.7	-43	-179.5	-73	-63	133.3	0	0	111.5	W7 L14 L15	W7-E11 WeakPolarHBondContact O-CG 3.37Å; W7-E11 PolarHBondContact O-N 3.37Å; E11-L14 PolarHBondContact O-N 3.44Å; E11-L15 WeakPolarHBondContact O-CB 3.2Å; E11-L15 PolarHBondContact O-N 2.77Å
12	G	93.3	Very high	87.5	Confident	44 Å²	44	107.7 Å²	107.7	45%	0.454	56%	0.563	S	S	.	*	H	α-helix	trans	-63.8	-43.4	174.4	0	0	0	0	0	113	M8 V10 W16	M8-G12 PolarHBondContact O-N 3.46Å; V10-G12 PolarHBondContact O-N 2.89Å; G12-W16 WeakPolarHBondContact O-CB 3.37Å; G12-W16 PolarHBondContact O-N 2.99Å
13	L	90.7	Very high	86.8	Confident	96 Å²	96	104.5 Å²	104.5	50%	0.503	55%	0.554	S	S	.	*	H	α-helix	trans	-68.7	-36.9	177.9	-173.6	64.4	0	0	0	112	L9 V10 W16 R17	L9-L13 VanDerWaalsContact O-CB 3.31Å; L9-L13 WeakPolarHBondContact O-CB 3.14Å; L9-L13 PolarHBondContact O-N 2.66Å; V10-L13 PolarHBondContact O-N 3.2Å; L13-W16 HydrophobicContact CD1-CE3 4.01Å; L13-W16 PolarHBondContact O-N 3.31Å; L13-R17 WeakPolarHBondContact O-CB 3.27Å; L13-R17 VanDerWaalsContact O-CG 3.27Å; L13-R17 WeakPolarHBondContact O-CG 3.49Å; L13-R17 PolarHBondContact O-N 3.42Å
14	L	90.7	Very high	85.7	Confident	99 Å²	99	106 Å²	106	52%	0.518	56%	0.555	S	S	.	*	H	α-helix	trans	-65.8	-44.7	177.1	-174.4	72.2	0	0	0	110.7	V10 E11 R17 K18	V10-L14 WeakPolarHBondContact O-CB 3.23Å; V10-L14 PolarHBondContact O-N 3.29Å; E11-L14 PolarHBondContact O-N 3.44Å; L14-R17 PolarHBondContact O-N 2.92Å; L14-K18 WeakPolarHBondContact O-CB 3.33Å; L14-K18 PolarHBondContact O-N 2.81Å
15	L	88.9	Confident	84.6	Confident	118 Å²	118	109.5 Å²	109.5	62%	0.618	56%	0.56	S	S	*	*	H	α-helix	trans	-63.3	-44	175.4	-142.5	82	0	0	0	110.9	E11 R17 K18 V19	E11-L15 WeakPolarHBondContact O-CB 3.2Å; E11-L15 PolarHBondContact O-N 2.77Å; L15-R17 PolarHBondContact O-N 3.19Å; L15-K18 PolarHBondContact O-N 3.5Å; L15-V19 WeakPolarHBondContact O-CG2 3.44Å; L15-V19 PolarHBondContact O-N 2.84Å
16	W	88.3	Confident	83.2	Confident	165 Å²	165	106.6 Å²	106.6	63%	0.625	56%	0.555	S	S	*	*	H	α-helix	trans	-62.1	-42.7	175.7	-173.8	74.9	0	0	0	112.1	G12 L13 K18 V19 V20	G12-W16 WeakPolarHBondContact O-CB 3.37Å; G12-W16 PolarHBondContact O-N 2.99Å; L13-W16 HydrophobicContact CD1-CE3 4.01Å; L13-W16 PolarHBondContact O-N 3.31Å; W16-K18 VanDerWaalsContact C-N 3.31Å; W16-K18 PolarHBondContact O-N 2.76Å; W16-V19 PolarHBondContact O-N 2.66Å; W16-V20 HydrophobicContact CD2-CG2 4.17Å; W16-V20 HydrophobicContact CE3-CG2 4.47Å; W16-V20 HydrophobicContact CH2-CG2 4.35Å; W16-V20 HydrophobicContact CZ2-CG2 4.01Å; W16-V20 WeakPolarHBondContact O-CB 3.44Å; W16-V20 WeakPolarHBondContact O-CG2 3.17Å; W16-V20 PolarHBondContact O-N 2.76Å
17	R	83.7	Confident	81.8	Confident	165 Å²	165	105.4 Å²	105.4	62%	0.623	55%	0.554	S	S	*	*	H	α-helix	trans	-62.4	-36.8	173.9	-78	-179	71	-168.4	2.3	112.3	L13 L14 L15 A21	L13-R17 WeakPolarHBondContact O-CB 3.27Å; L13-R17 VanDerWaalsContact O-CG 3.27Å; L13-R17 WeakPolarHBondContact O-CG 3.49Å; L13-R17 PolarHBondContact O-N 3.42Å; L14-R17 PolarHBondContact O-N 2.92Å; L15-R17 PolarHBondContact O-N 3.19Å; R17-A21 VanDerWaalsContact O-CB 3.23Å; R17-A21 WeakPolarHBondContact O-CB 3.36Å; R17-A21 PolarHBondContact O-N 3.35Å
18	K	82.8	Confident	80.1	Confident	153 Å²	153	102.2 Å²	102.2	67%	0.665	56%	0.556	S	S	*	*	H	α-helix	trans	-70	-42.9	175.9	-171.8	175.9	-177.9	176.9	0	111.4	L14 L15 W16 A21 V22	L14-K18 WeakPolarHBondContact O-CB 3.33Å; L14-K18 PolarHBondContact O-N 2.81Å; L15-K18 PolarHBondContact O-N 3.5Å; W16-K18 VanDerWaalsContact C-N 3.31Å; W16-K18 PolarHBondContact O-N 2.76Å; K18-A21 PolarHBondContact O-N 3.43Å; K18-V22 WeakPolarHBondContact O-CG1 3.4Å; K18-V22 PolarHBondContact O-N 2.95Å
19	V	86.1	Confident	78.3	Confident	77 Å²	77	96.4 Å²	96.4	47%	0.467	54%	0.535	S	S	.	.	H	α-helix	trans	-62.6	-42.6	173.5	171.3	0	0	0	0	110.7	L15 W16 V22 S23	L15-V19 WeakPolarHBondContact O-CG2 3.44Å; L15-V19 PolarHBondContact O-N 2.84Å; W16-V19 PolarHBondContact O-N 2.66Å; V19-V22 WeakPolarHBondContact O-CG1 3.31Å; V19-V22 PolarHBondContact O-N 2.93Å; V19-S23 WeakPolarHBondContact O-CB 3.15Å; V19-S23 PolarHBondContact O-N 3.5Å; V19-S23 PolarHBondContact O-OG 3.01Å
20	V	82.6	Confident	76.5	Confident	48 Å²	48	98.1 Å²	98.1	29%	0.291	54%	0.542	S	S	.	.	H	α-helix	trans	-63.4	-45.2	172.8	155.4	0	0	0	0	110.3	W16 V22 S23 M24	W16-V20 HydrophobicContact CD2-CG2 4.17Å; W16-V20 HydrophobicContact CE3-CG2 4.47Å; W16-V20 HydrophobicContact CH2-CG2 4.35Å; W16-V20 HydrophobicContact CZ2-CG2 4.01Å; W16-V20 WeakPolarHBondContact O-CB 3.44Å; W16-V20 WeakPolarHBondContact O-CG2 3.17Å; W16-V20 PolarHBondContact O-N 2.76Å; V20-V22 PolarHBondContact O-N 3.29Å; V20-S23 CarbonylContact O-C 3.41Å; V20-S23 PolarHBondContact O-N 3.31Å; V20-M24 HydrophobicContact CG1-SD 3.73Å; V20-M24 WeakPolarHBondContact O-CA 3.42Å; V20-M24 WeakPolarHBondContact O-CB 3.46Å; V20-M24 PolarHBondContact O-N 3.38Å
21	A	79.3	Confident	74.7	Confident	61 Å²	61	105.2 Å²	105.2	50%	0.504	56%	0.56	S	S	.	*	H	α-helix	trans	-65	-36.1	178.9	0	0	0	0	0	112.7	R17 K18 M24 H25	R17-A21 VanDerWaalsContact O-CB 3.23Å; R17-A21 WeakPolarHBondContact O-CB 3.36Å; R17-A21 PolarHBondContact O-N 3.35Å; K18-A21 PolarHBondContact O-N 3.43Å; A21-M24 CarbonylContact O-C 3.57Å; A21-H25 VanDerWaalsContact O-CB 3.3Å; A21-H25 WeakPolarHBondContact O-CB 3.36Å; A21-H25 PolarHBondContact O-N 3.19Å
22	V	73.6	Confident	72.9	Confident	95 Å²	95	106.3 Å²	106.3	58%	0.576	57%	0.569	S	S	*	*	H	α-helix	trans	-75.7	-32.7	172.5	69.6	0	0	0	0	112	K18 V19 V20 H25	K18-V22 WeakPolarHBondContact O-CG1 3.4Å; K18-V22 PolarHBondContact O-N 2.95Å; V19-V22 WeakPolarHBondContact O-CG1 3.31Å; V19-V22 PolarHBondContact O-N 2.93Å; V20-V22 PolarHBondContact O-N 3.29Å; V22-H25 PolarHBondContact O-N 3.44Å
23	S	74.3	Confident	71.1	Confident	85 Å²	85	113.2 Å²	113.2	59%	0.594	58%	0.582	S	S	*	*	H	α-helix	trans	-72.3	-35.5	174.6	-58.5	0	0	0	0	112.1	V19 V20 H25	V19-S23 WeakPolarHBondContact O-CB 3.15Å; V19-S23 PolarHBondContact O-N 3.5Å; V19-S23 PolarHBondContact O-OG 3.01Å; V20-S23 CarbonylContact O-C 3.41Å; V20-S23 PolarHBondContact O-N 3.31Å; S23-H25 VanDerWaalsContact C-N 3.31Å
24	M	62.8	Low	69.4	Low	151 Å²	151	116.4 Å²	116.4	74%	0.744	59%	0.594	S	S	*	*	T	Hydrogen-bonded Turn	trans	-89.9	11	170.9	-88.1	160.3	154.6	0	0	112.7	V20 A21 P26	V20-M24 HydrophobicContact CG1-SD 3.73Å; V20-M24 WeakPolarHBondContact O-CA 3.42Å; V20-M24 WeakPolarHBondContact O-CB 3.46Å; V20-M24 PolarHBondContact O-N 3.38Å; A21-M24 CarbonylContact O-C 3.57Å; M24-P26 VanDerWaalsContact C-N 3.34Å; M24-P26 WeakPolarHBondContact O-CD 3.43Å
25	H	62.4	Low	67.7	Low	136 Å²	136	114.9 Å²	114.9	63%	0.63	60%	0.596	S	S	*	*			trans	-97.6	62	152.7	-170.1	-133	0	0	0	107.5	A21 V22 S23	A21-H25 VanDerWaalsContact O-CB 3.3Å; A21-H25 WeakPolarHBondContact O-CB 3.36Å; A21-H25 PolarHBondContact O-N 3.19Å; V22-H25 PolarHBondContact O-N 3.44Å; S23-H25 VanDerWaalsContact C-N 3.31Å
26	P	54.7	Low	66.3	Low	76 Å²	76	114.8 Å²	114.8	49%	0.494	60%	0.6	S	S	.	*			trans	-59.7	146.5	166.1	34.2	-34.8	0	0	0	106.3	M24	M24-P26 VanDerWaalsContact C-N 3.34Å; M24-P26 WeakPolarHBondContact O-CD 3.43Å
27	G	60.1	Low	65.2	Low	48 Å²	48	109.6 Å²	109.6	50%	0.495	60%	0.598	S	S	.	*			trans	-48	157.5	-170.8	0	0	0	0	0	114.1	G29 M30	G27-G29 PolarHBondContact O-N 2.95Å; G27-M30 PolarHBondContact O-N 3.47Å
28	P	56.3	Low	64.3	Low	107 Å²	107	112.9 Å²	112.9	70%	0.695	61%	0.61	S	S	*	*	T	Hydrogen-bonded Turn	trans	-46.1	-10.9	168.8	-26.5	32.7	0	0	0	115.6	M30 R31	P28-M30 PolarHBondContact O-N 2.96Å; P28-R31 PolarHBondContact O-N 3.49Å
29	G	56.6	Low	62.8	Low	30 Å²	30	108.8 Å²	108.8	31%	0.309	61%	0.612	S	S	.	*	H	α-helix	trans	-61	-26.7	176.8	0	0	0	0	0	116.7	G27 L32 Y33	G27-G29 PolarHBondContact O-N 2.95Å; G29-L32 WeakPolarHBondContact O-CB 3.44Å; G29-L32 PolarHBondContact O-N 3.37Å; G29-L32 VanDerWaalsContact O-N 3.1Å; G29-Y33 WeakPolarHBondContact O-CD2 3.31Å; G29-Y33 PolarHBondContact O-N 3.31Å
30	M	54.3	Low	61.8	Low	148 Å²	148	111.1 Å²	111.1	73%	0.729	63%	0.629	S	S	*	*	H	α-helix	trans	-84.4	-9.4	-178.7	-132.9	152	97.5	0	0	114.6	G27 P28 Y33	G27-M30 PolarHBondContact O-N 3.47Å; P28-M30 PolarHBondContact O-N 2.96Å; M30-Y33 HydrophobicContact CG-CD2 4.39Å
31	R	53.9	Low	60.3	Low	222 Å²	222	124 Å²	124	84%	0.838	67%	0.672	S	S	*	*	H	α-helix	trans	-79	-26.2	159.3	-95.1	-175.1	-177.7	-176.5	1.1	112.4	P28 H34 A35	P28-R31 PolarHBondContact O-N 3.49Å; R31-H34 PolarHBondContact O-N 2.97Å; R31-A35 PolarHBondContact O-N 3.37Å; R31-A35 VanDerWaalsContact O-N 3.12Å
32	L	55.9	Low	59.4	Low	109 Å²	109	127.1 Å²	127.1	57%	0.571	68%	0.68	S	S	*	*	H	α-helix	trans	-70.1	-37.5	178.4	-81.4	155	0	0	0	111.7	G29 H34 A35 T36	G29-L32 WeakPolarHBondContact O-CB 3.44Å; G29-L32 PolarHBondContact O-N 3.37Å; G29-L32 VanDerWaalsContact O-N 3.1Å; L32-H34 VanDerWaalsContact C-N 3.27Å; L32-H34 PolarHBondContact O-N 3.17Å; L32-A35 CarbonylContact O-C 3.54Å; L32-A35 PolarHBondContact O-N 3.49Å; L32-A35 VanDerWaalsContact O-N 3.12Å; L32-T36 PolarHBondContact O-N 3.37Å; L32-T36 PolarHBondContact O-OG1 3.34Å
33	Y	54.8	Low	58.6	Low	188 Å²	188	128.8 Å²	128.8	74%	0.737	69%	0.686	S	S	*	*	H	α-helix	trans	-65.6	-26.9	177.4	-66.8	-74	0	0	0	114.2	G29 M30	G29-Y33 WeakPolarHBondContact O-CD2 3.31Å; G29-Y33 PolarHBondContact O-N 3.31Å; M30-Y33 HydrophobicContact CG-CD2 4.39Å
34	H	55.1	Low	57.8	Low	164 Å²	164	131.2 Å²	131.2	76%	0.759	69%	0.691	S	S	*	*	H	α-helix	trans	-86.4	-22.6	173.2	-158.8	-94.5	0	0	0	112.7	R31 L32	R31-H34 PolarHBondContact O-N 2.97Å; L32-H34 VanDerWaalsContact C-N 3.27Å; L32-H34 PolarHBondContact O-N 3.17Å
35	A	55.6	Low	57.5	Low	66 Å²	66	130.1 Å²	130.1	55%	0.545	69%	0.688	S	S	.	*	H	α-helix	trans	-76	-28.6	169.2	0	0	0	0	0	112.2	R31 L32 G37	R31-A35 PolarHBondContact O-N 3.37Å; R31-A35 VanDerWaalsContact O-N 3.12Å; L32-A35 CarbonylContact O-C 3.54Å; L32-A35 PolarHBondContact O-N 3.49Å; L32-A35 VanDerWaalsContact O-N 3.12Å; A35-G37 PolarHBondContact O-N 2.84Å
36	T	58.8	Low	57.2	Low	116 Å²	116	129.7 Å²	129.7	71%	0.712	69%	0.691	S	S	*	*	T	Hydrogen-bonded Turn	trans	-79.3	40.9	171.1	-48.2	0	0	0	0	111.6	L32	L32-T36 PolarHBondContact O-N 3.37Å; L32-T36 PolarHBondContact O-OG1 3.34Å
37	G	65.3	Low	57.3	Low	56 Å²	56	133.3 Å²	133.3	58%	0.577	71%	0.705	S	S	*	*	T	Hydrogen-bonded Turn	trans	-104.4	-2.6	164.9	0	0	0	0	0	113.8	A35	A35-G37 PolarHBondContact O-N 2.84Å
38	W	64.1	Low	57.1	Low	234 Å²	234	139.4 Å²	139.4	89%	0.886	72%	0.72	S	S	*	*			trans	-138.8	93.7	-161.9	-70.2	75.1	0	0	0	113.8
39	G	53.2	Low	57.2	Low	68 Å²	68	141.8 Å²	141.8	70%	0.701	72%	0.722	S	S	*	*			trans	-178.4	76.4	165.7	0	0	0	0	0	111.5	R41	G39-R41 PolarHBondContact O-N 2.96Å; G39-R41 VanDerWaalsContact O-N 3.12Å
40	P	63.8	Low	57.3	Low	126 Å²	126	151.2 Å²	151.2	82%	0.818	76%	0.756	S	S	*	*			trans	-79	90.2	171.5	32	-28.4	0	0	0	108.3
41	R	52.1	Low	57.5	Low	317 Å²	317	151.5 Å²	151.5	100%	1.196	76%	0.758	S	S	*	*			trans	-151.9	0	152.8	-74.2	-152.1	170.9	137.8	1.4	110.3	G39	G39-R41 PolarHBondContact O-N 2.96Å; G39-R41 VanDerWaalsContact O-N 3.12Å

Retrieved 41 of 41 residues in 74.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).