A0A087WWU0_HUMAN Loading...

Uncharacterized protein AlphaSync

AlphaFold DB , UniProt , Accession A0A087WWU0, Species HUMAN (Homo sapiens, Human), Gene n/a, Length 41 aa.

						>A0A087WWU0_HUMAN|A0A087WWU0
XVTKSQPEKWDEEAQDAAGEEEKEQEKEKDAENKVKNSKGT
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure AlphaSync Parameters PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	X	54.9	Low	70.8	Confident	129 Å²	129	127.6 Å²	127.6	100%	1.33	71%	0.712	S	S	*	*				0	140.3	0	0	0	0	0	108.6
2	V	59.2	Low	72.2	Confident	134 Å²	134	127.9 Å²	127.9	81%	0.812	70%	0.703	S	S	*	*			trans	50.3	96.7	172.1	178.6	0	0	0	114.4	K4	V2-K4 PolarHBondContact O-N 3.37Å
3	T	65.8	Low	73.5	Confident	127 Å²	127	128.5 Å²	128.5	78%	0.779	70%	0.698	S	S	*	*			trans	-48	107.3	154.5	3.9	0	0	0	106.8	S5	T3-S5 PolarHBondContact O-N 3.42Å
4	K	67.9	Low	74.4	Confident	177 Å²	177	123.5 Å²	123.5	77%	0.77	68%	0.683	S	S	*	*			trans	-71.1	61.5	169.1	-169	169.8	174.1	173.7	107.1	V2 Q6	V2-K4 PolarHBondContact O-N 3.37Å; K4-Q6 PolarHBondContact O-N 2.78Å
5	S	64.8	Low	75.4	Confident	91 Å²	91	123.9 Å²	123.9	64%	0.636	68%	0.678	S	S	*	*			trans	-73.8	73	159.5	-77.8	0	0	0	104.8	T3	T3-S5 PolarHBondContact O-N 3.42Å
6	Q	67.1	Low	76.3	Confident	91 Å²	91	122.6 Å²	122.6	43%	0.425	67%	0.67	S	S	.	*				71.9	84.7	109.1	-68.6	-71.2	78.7	0	109	K4 E8 K9	K4-Q6 PolarHBondContact O-N 2.78Å; Q6-E8 PolarHBondContact O-N 2.92Å; Q6-K9 HydrophobicContact CB-CG 4.29Å; Q6-K9 PolarHBondContact O-N 3.03Å
7	P	71.3	Confident	77	Confident	88 Å²	88	118.5 Å²	118.5	57%	0.571	66%	0.656	S	S	*	*	H	α-helix	trans	-51.1	-25.2	168.5	22.4	-34	0	0	112.2	K9 W10 D11	P7-K9 VanDerWaalsContact C-N 3.26Å; P7-K9 PolarHBondContact O-N 2.85Å; P7-W10 PolarHBondContact O-N 2.98Å; P7-D11 PolarHBondContact O-N 3.24Å
8	E	77.2	Confident	77.7	Confident	142 Å²	142	114.6 Å²	114.6	66%	0.664	64%	0.641	S	S	*	*	H	α-helix	trans	-53.9	-36.1	174.3	-141.1	161.8	92.6	0	113.7	Q6 E12	Q6-E8 PolarHBondContact O-N 2.92Å; E8-E12 WeakPolarHBondContact O-CB 3.22Å; E8-E12 PolarHBondContact O-N 3.27Å; E8-E12 VanDerWaalsContact O-N 3.12Å
9	K	82.6	Confident	78.5	Confident	144 Å²	144	110.2 Å²	110.2	63%	0.626	62%	0.624	S	S	*	*	H	α-helix	trans	-75.1	-31.2	177.5	-67.2	-77.2	-85.4	164.3	112.3	Q6 P7 E13	Q6-K9 HydrophobicContact CB-CG 4.29Å; Q6-K9 PolarHBondContact O-N 3.03Å; P7-K9 VanDerWaalsContact C-N 3.26Å; P7-K9 PolarHBondContact O-N 2.85Å; K9-E13 WeakPolarHBondContact O-CB 3.29Å; K9-E13 PolarHBondContact O-N 3.24Å; K9-E13 VanDerWaalsContact O-N 3.17Å
10	W	83.3	Confident	79.2	Confident	184 Å²	184	110.6 Å²	110.6	70%	0.697	62%	0.621	S	S	*	*	H	α-helix	trans	-78.3	-35.4	175.9	-83.8	-36.9	0	0	112.3	P7 A14	P7-W10 PolarHBondContact O-N 2.98Å; W10-A14 WeakPolarHBondContact O-CB 3.39Å; W10-A14 PolarHBondContact O-N 3.29Å
11	D	85.2	Confident	79.9	Confident	97 Å²	97	111.1 Å²	111.1	52%	0.519	62%	0.618	S	S	.	*	H	α-helix	trans	-66	-44.7	175.3	-153.1	-115.6	0	0	109.9	P7 E13 A14 Q15	P7-D11 PolarHBondContact O-N 3.24Å; D11-E13 PolarHBondContact O-N 3.49Å; D11-A14 PolarHBondContact O-N 3.01Å; D11-Q15 WeakPolarHBondContact O-CB 3.08Å; D11-Q15 VanDerWaalsContact O-CG 3.24Å; D11-Q15 WeakPolarHBondContact O-CG 3.3Å; D11-Q15 PolarHBondContact O-N 3.41Å; D11-Q15 PolarHBondContact OD1-OE1 3.24Å
12	E	86.9	Confident	81.7	Confident	131 Å²	131	111.6 Å²	111.6	61%	0.612	59%	0.586	S	S	*	*	H	α-helix	trans	-60.4	-47.6	175.7	-172.3	175.4	83.7	0	112.2	E8 Q15 D16	E8-E12 WeakPolarHBondContact O-CB 3.22Å; E8-E12 PolarHBondContact O-N 3.27Å; E8-E12 VanDerWaalsContact O-N 3.12Å; E12-Q15 PolarHBondContact O-N 2.94Å; E12-D16 WeakPolarHBondContact O-CB 3.43Å; E12-D16 PolarHBondContact O-N 3.43Å
13	E	88.9	Confident	83.4	Confident	136 Å²	136	112 Å²	112	64%	0.636	58%	0.577	S	S	*	*	H	α-helix	trans	-66.5	-38.2	177.7	-172.2	176.5	90.6	0	112.3	K9 D11 A17	K9-E13 WeakPolarHBondContact O-CB 3.29Å; K9-E13 PolarHBondContact O-N 3.24Å; K9-E13 VanDerWaalsContact O-N 3.17Å; D11-E13 PolarHBondContact O-N 3.49Å; E13-A17 WeakPolarHBondContact O-CB 3.26Å; E13-A17 PolarHBondContact O-N 3.01Å
14	A	86.6	Confident	84.8	Confident	58 Å²	58	112.3 Å²	112.3	48%	0.479	57%	0.569	S	S	.	*	H	α-helix	trans	-70.4	-37.5	178.3	0	0	0	0	112.2	W10 D11 A18	W10-A14 WeakPolarHBondContact O-CB 3.39Å; W10-A14 PolarHBondContact O-N 3.29Å; D11-A14 PolarHBondContact O-N 3.01Å; A14-A18 VanDerWaalsContact O-CB 3.23Å; A14-A18 WeakPolarHBondContact O-CB 3.39Å; A14-A18 PolarHBondContact O-N 3.47Å
15	Q	88.7	Confident	86	Confident	130 Å²	130	107.8 Å²	107.8	61%	0.607	55%	0.551	S	S	*	*	H	α-helix	trans	-70.2	-38.4	175.3	-73.3	-171.7	-75.6	0	111.8	D11 E12 A18 G19	D11-Q15 WeakPolarHBondContact O-CB 3.08Å; D11-Q15 VanDerWaalsContact O-CG 3.24Å; D11-Q15 WeakPolarHBondContact O-CG 3.3Å; D11-Q15 PolarHBondContact O-N 3.41Å; D11-Q15 PolarHBondContact OD1-OE1 3.24Å; E12-Q15 PolarHBondContact O-N 2.94Å; Q15-A18 PolarHBondContact O-N 3.33Å; Q15-G19 PolarHBondContact O-N 3.47Å
16	D	90.2	Very high	87.4	Confident	103 Å²	103	110.6 Å²	110.6	55%	0.551	55%	0.554	S	S	*	*	H	α-helix	trans	-61.1	-50.8	173.9	-168.7	-120.2	0	0	110.1	E12 A18 G19 E20	E12-D16 WeakPolarHBondContact O-CB 3.43Å; E12-D16 PolarHBondContact O-N 3.43Å; D16-A18 PolarHBondContact O-N 3.04Å; D16-G19 PolarHBondContact O-N 2.91Å; D16-E20 WeakPolarHBondContact O-CG 3.5Å; D16-E20 PolarHBondContact O-N 2.83Å
17	A	88.9	Confident	88.7	Confident	53 Å²	53	113.1 Å²	113.1	44%	0.438	56%	0.564	S	S	.	*	H	α-helix	trans	-60.8	-41.6	176.5	0	0	0	0	112.9	E13 E20 E21	E13-A17 WeakPolarHBondContact O-CB 3.26Å; E13-A17 PolarHBondContact O-N 3.01Å; A17-E20 PolarHBondContact O-N 3.21Å; A17-E21 WeakPolarHBondContact O-CB 3.45Å; A17-E21 PolarHBondContact O-N 3.29Å
18	A	89.5	Confident	89.9	Confident	47 Å²	47	115.5 Å²	115.5	39%	0.388	57%	0.567	S	S	.	*	H	α-helix	trans	-64	-41.1	176.7	0	0	0	0	111.8	A14 Q15 D16 E21 E22	A14-A18 VanDerWaalsContact O-CB 3.23Å; A14-A18 WeakPolarHBondContact O-CB 3.39Å; A14-A18 PolarHBondContact O-N 3.47Å; Q15-A18 PolarHBondContact O-N 3.33Å; D16-A18 PolarHBondContact O-N 3.04Å; A18-E21 PolarHBondContact O-N 2.9Å; A18-E22 WeakPolarHBondContact O-CB 3.35Å; A18-E22 WeakPolarHBondContact O-CG 3.39Å; A18-E22 PolarHBondContact O-N 3.29Å
19	G	92.2	Very high	90.7	Very high	31 Å²	31	115.2 Å²	115.2	32%	0.32	56%	0.564	S	S	.	*	H	α-helix	trans	-69.5	-34.7	177.6	0	0	0	0	113.4	Q15 D16 K23	Q15-G19 PolarHBondContact O-N 3.47Å; D16-G19 PolarHBondContact O-N 2.91Å; G19-K23 WeakPolarHBondContact O-CB 3.49Å; G19-K23 PolarHBondContact O-N 3.19Å
20	E	93.9	Very high	91.2	Very high	119 Å²	119	112.7 Å²	112.7	56%	0.556	56%	0.557	S	S	*	*	H	α-helix	trans	-66.3	-48.9	171.3	-70.1	-156.7	107.1	0	111.2	D16 A17 E22 K23 E24	D16-E20 WeakPolarHBondContact O-CG 3.5Å; D16-E20 PolarHBondContact O-N 2.83Å; A17-E20 PolarHBondContact O-N 3.21Å; E20-E22 PolarHBondContact O-N 3.47Å; E20-K23 PolarHBondContact O-N 2.99Å; E20-E24 WeakPolarHBondContact O-CG 3.45Å; E20-E24 PolarHBondContact O-N 2.91Å
21	E	92.6	Very high	91.6	Very high	121 Å²	121	106.5 Å²	106.5	57%	0.565	55%	0.545	S	S	*	.	H	α-helix	trans	-61.2	-42.4	179.2	-168.3	-172.3	102.2	0	111.8	A17 A18 K23 E24 Q25	A17-E21 WeakPolarHBondContact O-CB 3.45Å; A17-E21 PolarHBondContact O-N 3.29Å; A18-E21 PolarHBondContact O-N 2.9Å; E21-K23 PolarHBondContact O-N 3.4Å; E21-E24 PolarHBondContact O-N 3.4Å; E21-Q25 WeakPolarHBondContact O-CB 3.43Å; E21-Q25 WeakPolarHBondContact O-CG 3.43Å; E21-Q25 PolarHBondContact O-N 2.91Å; E21-Q25 PolarHBondContact OE1-NE2 3.46Å
22	E	93.7	Very high	91.9	Very high	140 Å²	140	107.5 Å²	107.5	65%	0.654	55%	0.546	S	S	*	.	H	α-helix	trans	-61.3	-43	175.8	-80.7	-168.1	101	0	111.9	A18 E20 Q25 E26	A18-E22 WeakPolarHBondContact O-CB 3.35Å; A18-E22 WeakPolarHBondContact O-CG 3.39Å; A18-E22 PolarHBondContact O-N 3.29Å; E20-E22 PolarHBondContact O-N 3.47Å; E22-Q25 PolarHBondContact O-N 3.45Å; E22-E26 PolarHBondContact O-N 2.9Å
23	K	94.1	Very high	92.1	Very high	142 Å²	142	105.1 Å²	105.1	62%	0.617	54%	0.538	S	S	*	.	H	α-helix	trans	-66.3	-37.6	176.2	-86.2	-176.3	179.2	166.8	112.6	G19 E20 E21 K27	G19-K23 WeakPolarHBondContact O-CB 3.49Å; G19-K23 PolarHBondContact O-N 3.19Å; E20-K23 PolarHBondContact O-N 2.99Å; E21-K23 PolarHBondContact O-N 3.4Å; K23-K27 VanDerWaalsContact O-CG 3.3Å; K23-K27 WeakPolarHBondContact O-CG 3.38Å; K23-K27 PolarHBondContact O-N 2.98Å
24	E	94.5	Very high	92.1	Very high	134 Å²	134	104.9 Å²	104.9	63%	0.626	54%	0.535	S	S	*	.	H	α-helix	trans	-66.5	-45.2	176.2	-72.8	-166.7	105.5	0	111.2	E20 E21 E26 K27 E28	E20-E24 WeakPolarHBondContact O-CG 3.45Å; E20-E24 PolarHBondContact O-N 2.91Å; E21-E24 PolarHBondContact O-N 3.4Å; E24-E26 VanDerWaalsContact C-N 3.32Å; E24-E26 PolarHBondContact O-N 3.42Å; E24-K27 PolarHBondContact O-N 2.93Å; E24-E28 PolarHBondContact O-N 3.47Å
25	Q	93.8	Very high	92.1	Very high	82 Å²	82	106.8 Å²	106.8	38%	0.383	54%	0.54	S	S	.	.	H	α-helix	trans	-62.5	-36.9	175.9	-76.5	-168	76.3	0	112.9	E21 E22 E28 K29	E21-Q25 WeakPolarHBondContact O-CB 3.43Å; E21-Q25 WeakPolarHBondContact O-CG 3.43Å; E21-Q25 PolarHBondContact O-N 2.91Å; E21-Q25 PolarHBondContact OE1-NE2 3.46Å; E22-Q25 PolarHBondContact O-N 3.45Å; Q25-E28 PolarHBondContact O-N 2.91Å; Q25-K29 WeakPolarHBondContact O-CB 3.33Å; Q25-K29 WeakPolarHBondContact O-CG 3.42Å; Q25-K29 PolarHBondContact O-N 3.19Å
26	E	94.9	Very high	92	Very high	149 Å²	149	106.4 Å²	106.4	70%	0.696	54%	0.537	S	S	*	.	H	α-helix	trans	-64.2	-44.1	175.9	-170.4	177.1	91.3	0	111.4	E22 E24 K29 D30	E22-E26 PolarHBondContact O-N 2.9Å; E24-E26 VanDerWaalsContact C-N 3.32Å; E24-E26 PolarHBondContact O-N 3.42Å; E26-K29 PolarHBondContact O-N 3.18Å; E26-D30 PolarHBondContact O-N 3.45Å
27	K	94.6	Very high	91.3	Very high	145 Å²	145	107.2 Å²	107.2	63%	0.63	54%	0.541	S	S	*	.	H	α-helix	trans	-64.3	-40.8	175.8	-69.7	171.2	-174.6	176.1	112	K23 E24 D30 A31	K23-K27 VanDerWaalsContact O-CG 3.3Å; K23-K27 WeakPolarHBondContact O-CG 3.38Å; K23-K27 PolarHBondContact O-N 2.98Å; E24-K27 PolarHBondContact O-N 2.93Å; K27-D30 PolarHBondContact O-N 3.42Å; K27-A31 WeakPolarHBondContact O-CB 3.23Å; K27-A31 PolarHBondContact O-N 2.93Å
28	E	94.8	Very high	90.6	Very high	138 Å²	138	109 Å²	109	65%	0.645	55%	0.55	S	S	*	*	H	α-helix	trans	-64.2	-44.2	178.1	-172	173.3	91.5	0	111.2	E24 Q25 D30 A31 E32	E24-E28 PolarHBondContact O-N 3.47Å; Q25-E28 PolarHBondContact O-N 2.91Å; E28-D30 PolarHBondContact O-N 3.45Å; E28-A31 PolarHBondContact O-N 2.96Å; E28-E32 WeakPolarHBondContact O-CB 3.44Å; E28-E32 PolarHBondContact O-N 2.85Å
29	K	94.1	Very high	90	Very high	135 Å²	135	115.5 Å²	115.5	59%	0.587	57%	0.57	S	S	*	*	H	α-helix	trans	-63.3	-39.1	175.9	-75.9	173.1	-175	163.4	112.8	Q25 E26 N33	Q25-K29 WeakPolarHBondContact O-CB 3.33Å; Q25-K29 WeakPolarHBondContact O-CG 3.42Å; Q25-K29 PolarHBondContact O-N 3.19Å; E26-K29 PolarHBondContact O-N 3.18Å; K29-N33 VanDerWaalsContact O-CB 3.22Å; K29-N33 WeakPolarHBondContact O-CB 3.24Å; K29-N33 PolarHBondContact O-N 2.96Å
30	D	93.3	Very high	88.9	Confident	92 Å²	92	117 Å²	117	49%	0.492	59%	0.586	S	S	.	*	H	α-helix	trans	-64.1	-45.3	174.7	-178.4	-103.7	0	0	111.4	E26 K27 E28 N33 K34	E26-D30 PolarHBondContact O-N 3.45Å; K27-D30 PolarHBondContact O-N 3.42Å; E28-D30 PolarHBondContact O-N 3.45Å; D30-N33 PolarHBondContact O-N 3.35Å; D30-K34 PolarHBondContact O-N 3.12Å
31	A	91.8	Very high	87.1	Confident	53 Å²	53	120.2 Å²	120.2	44%	0.438	61%	0.614	S	S	.	*	H	α-helix	trans	-63	-44.8	178.1	0	0	0	0	111.7	K27 E28 N33 K34 V35	K27-A31 WeakPolarHBondContact O-CB 3.23Å; K27-A31 PolarHBondContact O-N 2.93Å; E28-A31 PolarHBondContact O-N 2.96Å; A31-N33 VanDerWaalsContact C-N 3.32Å; A31-N33 PolarHBondContact O-N 3.48Å; A31-K34 PolarHBondContact O-N 2.84Å; A31-V35 PolarHBondContact O-N 3.32Å
32	E	92.5	Very high	86.9	Confident	118 Å²	118	120.2 Å²	120.2	55%	0.551	62%	0.616	S	S	*	*	H	α-helix	trans	-62	-41.2	175.1	-170.1	-173.3	83	0	111	E28 V35 K36	E28-E32 WeakPolarHBondContact O-CB 3.44Å; E28-E32 PolarHBondContact O-N 2.85Å; E32-V35 PolarHBondContact O-N 2.89Å; E32-K36 WeakPolarHBondContact O-CG 3.39Å; E32-K36 PolarHBondContact O-N 3.17Å
33	N	89.9	Confident	86.5	Confident	82 Å²	82	119.2 Å²	119.2	44%	0.439	61%	0.614	S	S	.	*	H	α-helix	trans	-64.3	-41	177.8	-168.6	16.8	0	0	112.4	K29 D30 A31 K36 N37	K29-N33 VanDerWaalsContact O-CB 3.22Å; K29-N33 WeakPolarHBondContact O-CB 3.24Å; K29-N33 PolarHBondContact O-N 2.96Å; D30-N33 PolarHBondContact O-N 3.35Å; A31-N33 VanDerWaalsContact C-N 3.32Å; A31-N33 PolarHBondContact O-N 3.48Å; N33-K36 WeakPolarHBondContact O-CG 3.33Å; N33-K36 WeakPolarHBondContact OD1-CE 3.07Å; N33-N37 VanDerWaalsContact O-CB 3.26Å; N33-N37 WeakPolarHBondContact O-CB 3.34Å; N33-N37 PolarHBondContact O-N 3.05Å
34	K	89.7	Confident	86.1	Confident	130 Å²	130	117.9 Å²	117.9	57%	0.565	61%	0.614	S	S	*	*	H	α-helix	trans	-62.9	-42.8	171.9	-84.8	173.4	-176.9	-78.5	112.1	D30 A31 S38	D30-K34 PolarHBondContact O-N 3.12Å; A31-K34 PolarHBondContact O-N 2.84Å; K34-S38 VanDerWaalsContact O-CB 3.29Å; K34-S38 WeakPolarHBondContact O-CB 3.37Å; K34-S38 PolarHBondContact O-N 3.49Å; K34-S38 PolarHBondContact O-OG 2.87Å
35	V	87.2	Confident	85.6	Confident	98 Å²	98	116.9 Å²	116.9	59%	0.594	61%	0.613	S	S	*	*	H	α-helix	trans	-63.7	-49.2	179	154.2	0	0	0	111.3	A31 E32 S38 K39	A31-V35 PolarHBondContact O-N 3.32Å; E32-V35 PolarHBondContact O-N 2.89Å; V35-S38 PolarHBondContact O-N 3.04Å; V35-K39 PolarHBondContact O-N 2.96Å
36	K	85.5	Confident	85.1	Confident	123 Å²	123	119.1 Å²	119.1	54%	0.535	63%	0.628	S	S	.	*	H	α-helix	trans	-68.6	-36.4	-177.8	75.3	-168.8	-171.4	-169.1	112.1	E32 N33 K39 G40	E32-K36 WeakPolarHBondContact O-CG 3.39Å; E32-K36 PolarHBondContact O-N 3.17Å; N33-K36 WeakPolarHBondContact O-CG 3.33Å; N33-K36 WeakPolarHBondContact OD1-CE 3.07Å; K36-K39 PolarHBondContact O-N 2.78Å; K36-G40 PolarHBondContact O-N 2.91Å
37	N	77.1	Confident	84.4	Confident	119 Å²	119	117.1 Å²	117.1	64%	0.636	62%	0.623	S	S	*	*	H	α-helix	trans	-66.2	-41.3	174	-175.1	-105.8	0	0	111.3	N33 K39 G40	N33-N37 VanDerWaalsContact O-CB 3.26Å; N33-N37 WeakPolarHBondContact O-CB 3.34Å; N33-N37 PolarHBondContact O-N 3.05Å; N37-K39 VanDerWaalsContact C-N 3.33Å; N37-K39 PolarHBondContact O-N 3.25Å; N37-G40 PolarHBondContact O-N 3.02Å
38	S	73.4	Confident	83.7	Confident	91 Å²	91	115.1 Å²	115.1	64%	0.636	62%	0.622	S	S	*	*	H	α-helix	trans	-70.4	-25.1	179.5	-59.3	0	0	0	113.9	K34 V35	K34-S38 VanDerWaalsContact O-CB 3.29Å; K34-S38 WeakPolarHBondContact O-CB 3.37Å; K34-S38 PolarHBondContact O-N 3.49Å; K34-S38 PolarHBondContact O-OG 2.87Å; V35-S38 PolarHBondContact O-N 3.04Å
39	K	75.8	Confident	82.8	Confident	183 Å²	183	113.4 Å²	113.4	80%	0.796	62%	0.621	S	S	*	*	H	α-helix	trans	-91.1	-9.3	178.1	-166.4	149	-179.2	63.4	113.8	V35 K36 N37	V35-K39 PolarHBondContact O-N 2.96Å; K36-K39 PolarHBondContact O-N 2.78Å; N37-K39 VanDerWaalsContact C-N 3.33Å; N37-K39 PolarHBondContact O-N 3.25Å
40	G	70.1	Confident	81.9	Confident	64 Å²	64	111.6 Å²	111.6	66%	0.66	62%	0.624	S	S	*	*			trans	-87.1	-7.1	-175.6	0	0	0	0	115.8	K36 N37	K36-G40 PolarHBondContact O-N 2.91Å; N37-G40 PolarHBondContact O-N 3.02Å
41	T	56.4	Low	80.9	Confident	186 Å²	186	113.4 Å²	113.4	100%	1.141	64%	0.636	S	S	*	*			trans	-124.5	0	175.3	-44	0	0	0	109.5

Retrieved 41 of 41 residues in 79.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).