A0A087WWW5_HUMAN Loading...

Major facilitator superfamily domain containing 4A

AlphaFold DB , UniProt , Accession A0A087WWW5, Species HUMAN (Homo sapiens, Human), Gene SLC60A1, Length 126 aa.

						>A0A087WWW5_HUMAN|A0A087WWW5|SLC60A1
MEEKGEGMLPAPSPDITLPSCSLAQSLWALFTSSLAISLVFAVIPFCRDVKVLASVMALAGLAMGCIDTVANMQLVRMYQKDSAVFLQLPVPMAVLMLLSKERLLTCCPQRRPLLLSADELALETQ
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	37.5	Very low	37.1	Very low	230 Å²	230	154.7 Å²	154.7	100%	1.133	85%	0.853	S	S	*	*				0	78.4	0	-84.9	167.2	169.4	0	0	105.9
2	E	37.3	Very low	36.7	Very low	192 Å²	192	152.3 Å²	152.3	90%	0.897	85%	0.85	S	S	*	*				82.2	118.7	86.1	-85.8	-169.3	93.2	0	0	111.9
3	E	44.1	Very low	36.4	Very low	196 Å²	196	149.2 Å²	149.2	92%	0.916	85%	0.845	S	S	*	*			trans	-54.7	140.4	174.2	-76.7	-127.8	99.2	0	0	114.6
4	K	38.3	Very low	36.6	Very low	217 Å²	217	147.6 Å²	147.6	94%	0.943	84%	0.843	S	S	*	*			trans	-169.1	127	155.3	-146.3	169.3	-176.7	168.4	0	107.7
5	G	37.2	Very low	36.1	Very low	66 Å²	66	146.6 Å²	146.6	68%	0.68	83%	0.834	S	S	*	*			cis	174.5	134.1	3.1	0	0	0	0	0	106.8
6	E	33.8	Very low	36.6	Very low	200 Å²	200	146.3 Å²	146.3	94%	0.935	83%	0.828	S	S	*	*			trans	29.6	133.4	150.9	-48.8	-140.7	92.8	0	0	121.7
7	G	39.4	Very low	36.3	Very low	85 Å²	85	145.6 Å²	145.6	88%	0.876	83%	0.828	S	S	*	*			trans	-59.1	138.3	-172	0	0	0	0	0	116.2
8	M	33.8	Very low	36.3	Very low	172 Å²	172	143.5 Å²	143.5	85%	0.847	81%	0.813	S	S	*	*			trans	-118.1	96	168.2	-173.5	68.3	147.5	0	0	107.6	P10	M8-P10 HydrophobicContact CG-CG 4.41Å
9	L	41.3	Very low	36.8	Very low	167 Å²	167	141.5 Å²	141.5	87%	0.874	81%	0.806	S	S	*	*			trans	-92.5	121.3	163.2	-160.4	108.7	0	0	0	107.1
10	P	34.9	Very low	36.8	Very low	101 Å²	101	139.2 Å²	139.2	66%	0.656	80%	0.799	S	S	*	*			trans	-122.2	113.7	153.2	20.1	-1	0	0	0	110.6	M8	M8-P10 HydrophobicContact CG-CG 4.41Å
11	A	30.3	Very low	36.8	Very low	76 Å²	76	135.9 Å²	135.9	63%	0.628	78%	0.784	S	S	*	*			trans	31.7	123.4	143.5	0	0	0	0	0	119.4	S13	A11-S13 PolarHBondContact O-N 3.44Å
12	P	32.5	Very low	37.5	Very low	125 Å²	125	126.9 Å²	126.9	81%	0.812	74%	0.743	S	S	*	*			trans	-65.2	120.1	166.1	27.8	-31.7	0	0	0	110.1	P14	P12-P14 WeakPolarHBondContact O-CD 3.35Å
13	S	32.9	Very low	37.9	Very low	112 Å²	112	123.3 Å²	123.3	78%	0.783	73%	0.73	S	S	*	*			trans	-75.3	122.4	159.2	45.8	0	0	0	0	110.3	A11	A11-S13 PolarHBondContact O-N 3.44Å
14	P	39.6	Very low	38.1	Very low	127 Å²	127	116.3 Å²	116.3	83%	0.825	71%	0.706	S	S	*	*			trans	-104.5	103.3	149.6	31.8	-28.4	0	0	0	109.9	P12	P12-P14 WeakPolarHBondContact O-CD 3.35Å
15	D	29.2	Very low	38.8	Very low	133 Å²	133	112.5 Å²	112.5	71%	0.711	69%	0.691	S	S	*	*			trans	-75.7	118.1	173.5	-164.5	-104.5	0	0	0	110.1
16	I	42.9	Very low	39.6	Very low	141 Å²	141	111.8 Å²	111.8	72%	0.723	68%	0.676	S	S	*	*	S	Bend	trans	59.3	66.2	141.4	-47.7	177.1	0	0	0	117.1
17	T	31.9	Very low	40.4	Very low	135 Å²	135	107 Å²	107	83%	0.828	66%	0.656	S	S	*	*			trans	-140.9	63.9	153.9	-54.9	0	0	0	0	110.8
18	L	36.5	Very low	41.1	Very low	108 Å²	108	112.4 Å²	112.4	57%	0.565	65%	0.65	S	S	*	*			trans	-168.8	117.6	164.4	-129.8	145.9	0	0	0	113.3	C21 S22	L18-C21 HydrophobicContact CD1-CB 3.87Å; L18-C21 HydrophobicContact CD2-CB 3.53Å; L18-C21 VanDerWaalsContact CD2-N 3.27Å; L18-C21 HydrophobicContact CG-CB 3.93Å; L18-S22 VanDerWaalsContact CD2-N 3.3Å
19	P	46	Very low	42.3	Very low	105 Å²	105	105.8 Å²	105.8	68%	0.682	62%	0.622	S	S	*	*	S	Bend		-136.9	16.9	122.1	38.4	-26.8	0	0	0	113.5
20	S	36.6	Very low	43	Very low	96 Å²	96	101.7 Å²	101.7	67%	0.671	60%	0.601	S	S	*	*	H	α-helix	trans	-81	-36.7	174.1	-48.9	0	0	0	0	112.4	A24	S20-A24 VanDerWaalsContact O-CB 3.29Å; S20-A24 WeakPolarHBondContact O-CB 3.23Å; S20-A24 PolarHBondContact O-N 3.06Å
21	C	37.3	Very low	44.3	Very low	70 Å²	70	103.4 Å²	103.4	47%	0.473	60%	0.598	S	S	.	*	H	α-helix	trans	-76.9	-25.5	179.5	-32.2	0	0	0	0	113	L18 Q25	L18-C21 HydrophobicContact CD1-CB 3.87Å; L18-C21 HydrophobicContact CD2-CB 3.53Å; L18-C21 VanDerWaalsContact CD2-N 3.27Å; L18-C21 HydrophobicContact CG-CB 3.93Å; C21-Q25 WeakPolarHBondContact O-CA 3.14Å; C21-Q25 WeakPolarHBondContact O-CB 3.14Å; C21-Q25 PolarHBondContact O-N 2.85Å
22	S	50.9	Low	46.1	Very low	40 Å²	40	103.5 Å²	103.5	28%	0.28	59%	0.592	S	S	.	*	H	α-helix	trans	-71	-39.2	179.3	-168.7	0	0	0	0	112.5	L18 S26	L18-S22 VanDerWaalsContact CD2-N 3.3Å; S22-S26 PolarHBondContact O-N 3.12Å; S22-S26 PolarHBondContact O-OG 3.25Å; S22-S26 VanDerWaalsContact O-OG 3.1Å
23	L	46.9	Very low	47.5	Very low	117 Å²	117	100.1 Å²	100.1	61%	0.613	57%	0.571	S	S	*	*	H	α-helix	trans	-74.1	-42	177.5	-146.5	162.6	0	0	0	110.3	Q25 S26 L27	L23-Q25 VanDerWaalsContact C-N 3.29Å; L23-Q25 PolarHBondContact O-N 3.44Å; L23-S26 PolarHBondContact O-N 2.73Å; L23-L27 HydrophobicContact CD2-CD1 3.52Å; L23-L27 HydrophobicContact CD2-CG 4.1Å; L23-L27 WeakPolarHBondContact O-CB 3.1Å; L23-L27 WeakPolarHBondContact O-CG 3.31Å; L23-L27 PolarHBondContact O-N 3.33Å
24	A	48.7	Very low	48.9	Very low	50 Å²	50	98.4 Å²	98.4	41%	0.413	56%	0.559	S	S	.	*	H	α-helix	trans	-61	-36.7	172.3	0	0	0	0	0	112.4	S20 L27 W28	S20-A24 VanDerWaalsContact O-CB 3.29Å; S20-A24 WeakPolarHBondContact O-CB 3.23Å; S20-A24 PolarHBondContact O-N 3.06Å; A24-L27 PolarHBondContact O-N 2.98Å; A24-W28 VanDerWaalsContact O-CB 3.31Å; A24-W28 WeakPolarHBondContact O-CB 3.26Å; A24-W28 PolarHBondContact O-N 3.4Å
25	Q	51.3	Low	49.8	Very low	137 Å²	137	96.7 Å²	96.7	64%	0.64	54%	0.542	S	S	*	.	H	α-helix	trans	-71.6	-38.9	177.4	-173.1	170.8	-73.3	0	0	112	C21 L23 W28 A29	C21-Q25 WeakPolarHBondContact O-CA 3.14Å; C21-Q25 WeakPolarHBondContact O-CB 3.14Å; C21-Q25 PolarHBondContact O-N 2.85Å; L23-Q25 VanDerWaalsContact C-N 3.29Å; L23-Q25 PolarHBondContact O-N 3.44Å; Q25-W28 PolarHBondContact O-N 3.15Å; Q25-A29 VanDerWaalsContact O-CB 3.31Å; Q25-A29 WeakPolarHBondContact O-CB 3.41Å; Q25-A29 PolarHBondContact O-N 3.47Å
26	S	54.3	Low	51.7	Low	51 Å²	51	91.6 Å²	91.6	36%	0.357	52%	0.518	S	S	.	.	H	α-helix	trans	-65.8	-41	171.2	-64.2	0	0	0	0	112	S22 L23 A29 L30	S22-S26 PolarHBondContact O-N 3.12Å; S22-S26 PolarHBondContact O-OG 3.25Å; S22-S26 VanDerWaalsContact O-OG 3.1Å; L23-S26 PolarHBondContact O-N 2.73Å; S26-A29 PolarHBondContact O-N 3.01Å; S26-L30 WeakPolarHBondContact O-CB 3.33Å; S26-L30 VanDerWaalsContact O-CG 3.31Å; S26-L30 WeakPolarHBondContact O-CG 3.21Å; S26-L30 PolarHBondContact O-N 3.44Å
27	L	51.8	Low	53	Low	100 Å²	100	89.7 Å²	89.7	52%	0.524	51%	0.509	S	S	.	.	H	α-helix	trans	-65.1	-40.5	174.3	-80	162.4	0	0	0	111.8	L23 A24 L30 F31	L23-L27 HydrophobicContact CD2-CD1 3.52Å; L23-L27 HydrophobicContact CD2-CG 4.1Å; L23-L27 WeakPolarHBondContact O-CB 3.1Å; L23-L27 WeakPolarHBondContact O-CG 3.31Å; L23-L27 PolarHBondContact O-N 3.33Å; A24-L27 PolarHBondContact O-N 2.98Å; L27-L30 PolarHBondContact O-N 2.9Å; L27-F31 WeakPolarHBondContact O-CB 3.26Å; L27-F31 PolarHBondContact O-N 2.73Å
28	W	53.4	Low	54.6	Low	198 Å²	198	87.1 Å²	87.1	75%	0.75	50%	0.496	S	S	*	.	H	α-helix	trans	-63.8	-40.1	172.4	-103.3	39.4	0	0	0	112	A24 Q25 F31 T32	A24-W28 VanDerWaalsContact O-CB 3.31Å; A24-W28 WeakPolarHBondContact O-CB 3.26Å; A24-W28 PolarHBondContact O-N 3.4Å; Q25-W28 PolarHBondContact O-N 3.15Å; W28-F31 PolarHBondContact O-N 2.79Å; W28-T32 VanDerWaalsContact O-CB 3.31Å; W28-T32 WeakPolarHBondContact O-CB 3.48Å; W28-T32 VanDerWaalsContact O-CG2 3.25Å; W28-T32 WeakPolarHBondContact O-CG2 3.2Å; W28-T32 PolarHBondContact O-N 3.21Å; W28-T32 PolarHBondContact O-OG1 2.91Å
29	A	58.8	Low	56.2	Low	32 Å²	32	86.9 Å²	86.9	26%	0.264	50%	0.495	S	S	.	.	H	α-helix	trans	-66.7	-39.3	176	0	0	0	0	0	112.3	Q25 S26 T32 S33 I67	Q25-A29 VanDerWaalsContact O-CB 3.31Å; Q25-A29 WeakPolarHBondContact O-CB 3.41Å; Q25-A29 PolarHBondContact O-N 3.47Å; S26-A29 PolarHBondContact O-N 3.01Å; A29-T32 VanDerWaalsContact CA-OG1 3.29Å; A29-T32 WeakPolarHBondContact CA-OG1 3.42Å; A29-T32 PolarHBondContact O-OG1 3.5Å; A29-S33 WeakPolarHBondContact O-CB 3.45Å; A29-S33 PolarHBondContact O-N 2.99Å; A29-S33 PolarHBondContact O-OG 3.34Å; A29-I67 HydrophobicContact CB-CD1 4.28Å
30	L	56.9	Low	57.1	Low	82 Å²	82	84.4 Å²	84.4	43%	0.429	48%	0.478	S	S	.	.	H	α-helix	trans	-70.3	-38.9	174.6	-73.1	169.7	0	0	0	111.8	S26 L27 S33 S34	S26-L30 WeakPolarHBondContact O-CB 3.33Å; S26-L30 VanDerWaalsContact O-CG 3.31Å; S26-L30 WeakPolarHBondContact O-CG 3.21Å; S26-L30 PolarHBondContact O-N 3.44Å; L27-L30 PolarHBondContact O-N 2.9Å; L30-S33 WeakPolarHBondContact CA-OG 3.22Å; L30-S33 PolarHBondContact O-OG 3.42Å; L30-S34 VanDerWaalsContact O-CB 3.28Å; L30-S34 WeakPolarHBondContact O-CB 3.23Å; L30-S34 PolarHBondContact O-N 2.83Å
31	F	61.4	Low	58.3	Low	136 Å²	136	87 Å²	87	60%	0.596	48%	0.477	S	S	*	.	H	α-helix	trans	-67.3	-45.3	176.8	-171.1	-100.8	0	0	0	111.1	L27 W28 S34 L35	L27-F31 WeakPolarHBondContact O-CB 3.26Å; L27-F31 PolarHBondContact O-N 2.73Å; W28-F31 PolarHBondContact O-N 2.79Å; F31-S34 PolarHBondContact O-N 3.13Å; F31-L35 HydrophobicContact CD1-CD1 4.33Å; F31-L35 HydrophobicContact CE1-CD1 3.64Å; F31-L35 HydrophobicContact CZ-CD1 3.97Å; F31-L35 WeakPolarHBondContact O-CB 3.28Å; F31-L35 PolarHBondContact O-N 3.33Å
32	T	67.4	Low	59.4	Low	79 Å²	79	86.8 Å²	86.8	49%	0.485	48%	0.481	S	S	.	.	H	α-helix	trans	-65.6	-37.3	176.5	47.8	0	0	0	0	112.3	W28 A29 L35 A36	W28-T32 VanDerWaalsContact O-CB 3.31Å; W28-T32 WeakPolarHBondContact O-CB 3.48Å; W28-T32 VanDerWaalsContact O-CG2 3.25Å; W28-T32 WeakPolarHBondContact O-CG2 3.2Å; W28-T32 PolarHBondContact O-N 3.21Å; W28-T32 PolarHBondContact O-OG1 2.91Å; A29-T32 VanDerWaalsContact CA-OG1 3.29Å; A29-T32 WeakPolarHBondContact CA-OG1 3.42Å; A29-T32 PolarHBondContact O-OG1 3.5Å; T32-L35 PolarHBondContact O-N 3.2Å; T32-A36 VanDerWaalsContact O-CB 3.23Å; T32-A36 WeakPolarHBondContact O-CB 3.19Å; T32-A36 PolarHBondContact O-N 3.46Å
33	S	61.5	Low	60	Low	54 Å²	54	87.1 Å²	87.1	38%	0.378	48%	0.48	S	S	.	.	H	α-helix	trans	-68.4	-43.6	173.8	58.2	0	0	0	0	112.4	A29 L30 L35 A36 I37	A29-S33 WeakPolarHBondContact O-CB 3.45Å; A29-S33 PolarHBondContact O-N 2.99Å; A29-S33 PolarHBondContact O-OG 3.34Å; L30-S33 WeakPolarHBondContact CA-OG 3.22Å; L30-S33 PolarHBondContact O-OG 3.42Å; S33-L35 VanDerWaalsContact C-N 3.32Å; S33-L35 PolarHBondContact O-N 3.23Å; S33-A36 PolarHBondContact O-N 2.83Å; S33-I37 VanDerWaalsContact O-CD1 3.28Å; S33-I37 WeakPolarHBondContact O-CD1 3.43Å; S33-I37 WeakPolarHBondContact O-CG1 3.22Å; S33-I37 PolarHBondContact O-N 3.33Å
34	S	63.6	Low	60.7	Low	75 Å²	75	86.8 Å²	86.8	52%	0.524	48%	0.478	S	S	.	.	H	α-helix	trans	-59.2	-42.5	172.8	-174.9	0	0	0	0	112.2	L30 F31 I37 S38	L30-S34 VanDerWaalsContact O-CB 3.28Å; L30-S34 WeakPolarHBondContact O-CB 3.23Å; L30-S34 PolarHBondContact O-N 2.83Å; F31-S34 PolarHBondContact O-N 3.13Å; S34-I37 PolarHBondContact O-N 3Å; S34-S38 WeakPolarHBondContact O-CB 3.25Å; S34-S38 PolarHBondContact O-N 3.37Å
35	L	58.9	Low	61.2	Low	91 Å²	91	89.7 Å²	89.7	48%	0.476	49%	0.493	S	S	.	.	H	α-helix	trans	-70.5	-36.2	178.7	-157.7	134	0	0	0	111.6	F31 T32 S33 S38 L39	F31-L35 HydrophobicContact CD1-CD1 4.33Å; F31-L35 HydrophobicContact CE1-CD1 3.64Å; F31-L35 HydrophobicContact CZ-CD1 3.97Å; F31-L35 WeakPolarHBondContact O-CB 3.28Å; F31-L35 PolarHBondContact O-N 3.33Å; T32-L35 PolarHBondContact O-N 3.2Å; S33-L35 VanDerWaalsContact C-N 3.32Å; S33-L35 PolarHBondContact O-N 3.23Å; L35-S38 PolarHBondContact O-N 3.03Å; L35-L39 WeakPolarHBondContact O-CB 3.31Å; L35-L39 PolarHBondContact O-N 3.02Å
36	A	68.6	Low	61.8	Low	26 Å²	26	91.9 Å²	91.9	22%	0.215	50%	0.501	C	S	.	.	H	α-helix	trans	-65.6	-39.8	172.4	0	0	0	0	0	112.1	T32 S33 L39 V40 V56	T32-A36 VanDerWaalsContact O-CB 3.23Å; T32-A36 WeakPolarHBondContact O-CB 3.19Å; T32-A36 PolarHBondContact O-N 3.46Å; S33-A36 PolarHBondContact O-N 2.83Å; A36-L39 PolarHBondContact O-N 2.81Å; A36-V40 WeakPolarHBondContact O-CB 3.16Å; A36-V40 VanDerWaalsContact O-CG2 3.26Å; A36-V40 WeakPolarHBondContact O-CG2 3.43Å; A36-V40 PolarHBondContact O-N 3.43Å; A36-V56 HydrophobicContact CB-CG1 4.16Å
37	I	69.1	Low	61.8	Low	102 Å²	102	92.7 Å²	92.7	52%	0.523	51%	0.506	S	S	.	.	H	α-helix	trans	-65	-45.3	174.8	-64.6	155.1	0	0	0	110.1	S33 S34 L39 V40 F41	S33-I37 VanDerWaalsContact O-CD1 3.28Å; S33-I37 WeakPolarHBondContact O-CD1 3.43Å; S33-I37 WeakPolarHBondContact O-CG1 3.22Å; S33-I37 PolarHBondContact O-N 3.33Å; S34-I37 PolarHBondContact O-N 3Å; I37-L39 VanDerWaalsContact C-N 3.3Å; I37-L39 PolarHBondContact O-N 3.46Å; I37-V40 PolarHBondContact O-N 3.47Å; I37-F41 HydrophobicContact CG2-CD2 4.21Å; I37-F41 HydrophobicContact CG2-CE2 4.4Å; I37-F41 WeakPolarHBondContact O-CD2 3.49Å; I37-F41 PolarHBondContact O-N 2.94Å
38	S	66.8	Low	62.1	Low	80 Å²	80	99.2 Å²	99.2	56%	0.559	52%	0.523	S	S	*	.	H	α-helix	trans	-59.7	-41	174.3	-176	0	0	0	0	111.9	S34 L35 F41 A42	S34-S38 WeakPolarHBondContact O-CB 3.25Å; S34-S38 PolarHBondContact O-N 3.37Å; L35-S38 PolarHBondContact O-N 3.03Å; S38-F41 PolarHBondContact O-N 2.69Å; S38-A42 PolarHBondContact O-N 2.83Å
39	L	69.1	Low	62.2	Low	103 Å²	103	94.9 Å²	94.9	54%	0.539	52%	0.515	S	S	.	.	H	α-helix	trans	-68.8	-41	177.9	-164.4	72.7	0	0	0	111.8	L35 A36 I37 F41 A42 V43	L35-L39 WeakPolarHBondContact O-CB 3.31Å; L35-L39 PolarHBondContact O-N 3.02Å; A36-L39 PolarHBondContact O-N 2.81Å; I37-L39 VanDerWaalsContact C-N 3.3Å; I37-L39 PolarHBondContact O-N 3.46Å; L39-F41 VanDerWaalsContact C-N 3.32Å; L39-F41 PolarHBondContact O-N 3.48Å; L39-A42 CarbonylContact O-C 3.54Å; L39-A42 PolarHBondContact O-N 3.03Å; L39-V43 HydrophobicContact CG-CG2 4.24Å; L39-V43 WeakPolarHBondContact O-CB 3.41Å; L39-V43 WeakPolarHBondContact O-CG2 3.29Å; L39-V43 PolarHBondContact O-N 3.49Å
40	V	66	Low	62.3	Low	53 Å²	53	99 Å²	99	32%	0.321	54%	0.537	S	S	.	.	H	α-helix	trans	-58.9	-45.2	173.3	167.3	0	0	0	0	110.1	A36 I37 A42 V43 I44 L53	A36-V40 WeakPolarHBondContact O-CB 3.16Å; A36-V40 VanDerWaalsContact O-CG2 3.26Å; A36-V40 WeakPolarHBondContact O-CG2 3.43Å; A36-V40 PolarHBondContact O-N 3.43Å; I37-V40 PolarHBondContact O-N 3.47Å; V40-A42 VanDerWaalsContact C-N 3.33Å; V40-A42 PolarHBondContact O-N 2.87Å; V40-V43 CarbonylContact O-C 3.32Å; V40-V43 PolarHBondContact O-N 3.29Å; V40-V43 VanDerWaalsContact O-N 3.13Å; V40-I44 HydrophobicContact CG1-CD1 4.14Å; V40-I44 HydrophobicContact CG1-CG1 4.35Å; V40-I44 WeakPolarHBondContact O-CG1 3.37Å; V40-I44 PolarHBondContact O-N 3.44Å; V40-L53 HydrophobicContact CG2-CD1 4.06Å
41	F	61.9	Low	62.2	Low	152 Å²	152	103.1 Å²	103.1	67%	0.667	55%	0.551	S	S	*	*	H	α-helix	trans	-63	-36.5	175.6	-93	-77.1	0	0	0	113.8	I37 S38 L39 V43 I44 P45	I37-F41 HydrophobicContact CG2-CD2 4.21Å; I37-F41 HydrophobicContact CG2-CE2 4.4Å; I37-F41 WeakPolarHBondContact O-CD2 3.49Å; I37-F41 PolarHBondContact O-N 2.94Å; S38-F41 PolarHBondContact O-N 2.69Å; L39-F41 VanDerWaalsContact C-N 3.32Å; L39-F41 PolarHBondContact O-N 3.48Å; F41-V43 VanDerWaalsContact C-N 3.34Å; F41-I44 HydrophobicContact CD1-CD1 4.28Å; F41-P45 WeakPolarHBondContact O-CD 3.31Å
42	A	60.3	Low	62.2	Low	65 Å²	65	100.9 Å²	100.9	54%	0.537	55%	0.549	S	S	.	.	H	α-helix	trans	-73.3	-26.3	174	0	0	0	0	0	113.1	S38 L39 V40 P45	S38-A42 PolarHBondContact O-N 2.83Å; L39-A42 CarbonylContact O-C 3.54Å; L39-A42 PolarHBondContact O-N 3.03Å; V40-A42 VanDerWaalsContact C-N 3.33Å; V40-A42 PolarHBondContact O-N 2.87Å; A42-P45 WeakPolarHBondContact O-CD 3.14Å; A42-P45 VanDerWaalsContact O-CG 3.26Å; A42-P45 WeakPolarHBondContact O-CG 3.42Å
43	V	63.1	Low	61.9	Low	46 Å²	46	101.6 Å²	101.6	28%	0.279	55%	0.549	S	S	.	.	H	α-helix	trans	-91.2	-21.1	-177.9	165.3	0	0	0	0	112.4	L39 V40 F41 P45 F46 C47	L39-V43 HydrophobicContact CG-CG2 4.24Å; L39-V43 WeakPolarHBondContact O-CB 3.41Å; L39-V43 WeakPolarHBondContact O-CG2 3.29Å; L39-V43 PolarHBondContact O-N 3.49Å; V40-V43 CarbonylContact O-C 3.32Å; V40-V43 PolarHBondContact O-N 3.29Å; V40-V43 VanDerWaalsContact O-N 3.13Å; F41-V43 VanDerWaalsContact C-N 3.34Å; V43-P45 VanDerWaalsContact C-N 3.34Å; V43-F46 CarbonylContact O-C 3.56Å; V43-F46 VanDerWaalsContact O-C 3.32Å; V43-F46 VanDerWaalsContact O-CA 3.23Å; V43-F46 WeakPolarHBondContact O-CA 3.29Å; V43-F46 WeakPolarHBondContact O-CB 3.36Å; V43-F46 PolarHBondContact O-N 3.42Å; V43-C47 HydrophobicContact CG1-CB 3.64Å; V43-C47 WeakPolarHBondContact CG1-SG 2.97Å; V43-C47 VanDerWaalsContact O-CB 3.31Å; V43-C47 WeakPolarHBondContact O-CB 3.31Å; V43-C47 PolarHBondContact O-N 2.93Å
44	I	60.7	Low	61.9	Low	110 Å²	110	102 Å²	102	56%	0.564	56%	0.555	S	S	*	*	T	Hydrogen-bonded Turn	trans	-52.2	-40.4	172.6	-76.3	163.8	0	0	0	113.6	V40 F41 F46	V40-I44 HydrophobicContact CG1-CD1 4.14Å; V40-I44 HydrophobicContact CG1-CG1 4.35Å; V40-I44 WeakPolarHBondContact O-CG1 3.37Å; V40-I44 PolarHBondContact O-N 3.44Å; F41-I44 HydrophobicContact CD1-CD1 4.28Å; I44-F46 PolarHBondContact O-N 2.83Å
45	P	60.1	Low	62	Low	112 Å²	112	101.8 Å²	101.8	73%	0.727	55%	0.554	S	S	*	*	T	Hydrogen-bonded Turn	trans	-71.1	-6.9	170.6	26.8	-34.6	0	0	0	114.2	F41 A42 V43	F41-P45 WeakPolarHBondContact O-CD 3.31Å; A42-P45 WeakPolarHBondContact O-CD 3.14Å; A42-P45 VanDerWaalsContact O-CG 3.26Å; A42-P45 WeakPolarHBondContact O-CG 3.42Å; V43-P45 VanDerWaalsContact C-N 3.34Å
46	F	64.9	Low	62.3	Low	182 Å²	182	100.2 Å²	100.2	80%	0.798	55%	0.548	S	S	*	.	T	Hydrogen-bonded Turn	trans	-119.9	-10.8	-169.1	-148.6	-97.3	0	0	0	114.7	V43 I44	V43-F46 CarbonylContact O-C 3.56Å; V43-F46 VanDerWaalsContact O-C 3.32Å; V43-F46 VanDerWaalsContact O-CA 3.23Å; V43-F46 WeakPolarHBondContact O-CA 3.29Å; V43-F46 WeakPolarHBondContact O-CB 3.36Å; V43-F46 PolarHBondContact O-N 3.42Å; I44-F46 PolarHBondContact O-N 2.83Å
47	C	53.2	Low	62.2	Low	69 Å²	69	105.7 Å²	105.7	47%	0.466	57%	0.571	S	S	.	*			trans	-97.7	105.9	-160.4	-126	0	0	0	0	115.7	V43	V43-C47 HydrophobicContact CG1-CB 3.64Å; V43-C47 WeakPolarHBondContact CG1-SG 2.97Å; V43-C47 VanDerWaalsContact O-CB 3.31Å; V43-C47 WeakPolarHBondContact O-CB 3.31Å; V43-C47 PolarHBondContact O-N 2.93Å
48	R	57.9	Low	61.9	Low	236 Å²	236	104 Å²	104	89%	0.891	57%	0.572	S	S	*	*			trans	-94.3	-9.2	164.9	-93.7	155.6	59.6	173.7	-2.3	113.8
49	D	56.3	Low	62	Low	107 Å²	107	106.2 Å²	106.2	57%	0.572	58%	0.577	S	S	*	*			trans	-123.6	100.4	-167.9	-77.7	-73.6	0	0	0	114.1	K51 V52	D49-K51 PolarHBondContact O-N 3.36Å; D49-V52 PolarHBondContact O-N 3.14Å
50	V	61.3	Low	61.8	Low	119 Å²	119	104 Å²	104	72%	0.721	57%	0.573	S	S	*	*	H	α-helix	trans	-60.4	-14	178	-64.1	0	0	0	0	114.8	L53 A54	V50-L53 PolarHBondContact O-N 2.9Å; V50-A54 PolarHBondContact O-N 3.33Å; V50-A54 VanDerWaalsContact O-N 3.15Å
51	K	54.2	Low	61.5	Low	168 Å²	168	103.5 Å²	103.5	73%	0.73	58%	0.579	S	S	*	*	H	α-helix	trans	-69.6	-36.6	-179	-75	-178.6	173.4	161.5	0	113.3	D49 L53 A54 S55	D49-K51 PolarHBondContact O-N 3.36Å; K51-L53 VanDerWaalsContact C-N 3.32Å; K51-A54 PolarHBondContact O-N 3.15Å; K51-S55 PolarHBondContact O-N 3.41Å; K51-S55 VanDerWaalsContact O-N 3.12Å
52	V	61.2	Low	61.1	Low	90 Å²	90	102.2 Å²	102.2	55%	0.545	58%	0.578	S	S	.	*	H	α-helix	trans	-66.7	-40.3	178	-179.5	0	0	0	0	109.8	D49 S55 V56	D49-V52 PolarHBondContact O-N 3.14Å; V52-S55 PolarHBondContact O-N 3.45Å; V52-S55 PolarHBondContact O-OG 3.45Å; V52-V56 PolarHBondContact O-N 3.02Å
53	L	61.2	Low	61.2	Low	94 Å²	94	101.3 Å²	101.3	49%	0.492	57%	0.571	S	S	.	*	H	α-helix	trans	-65.1	-41.4	177.9	-167.4	64.5	0	0	0	112.4	V40 V50 K51 M57	V40-L53 HydrophobicContact CG2-CD1 4.06Å; V50-L53 PolarHBondContact O-N 2.9Å; K51-L53 VanDerWaalsContact C-N 3.32Å; L53-M57 PolarHBondContact O-N 3.03Å
54	A	62.2	Low	61.2	Low	62 Å²	62	104.1 Å²	104.1	51%	0.512	58%	0.583	S	S	.	*	H	α-helix	trans	-64.2	-39.9	176.2	0	0	0	0	0	112.5	V50 K51 M57 A58	V50-A54 PolarHBondContact O-N 3.33Å; V50-A54 VanDerWaalsContact O-N 3.15Å; K51-A54 PolarHBondContact O-N 3.15Å; A54-M57 PolarHBondContact O-N 3.12Å; A54-A58 WeakPolarHBondContact O-CB 3.14Å; A54-A58 PolarHBondContact O-N 3.48Å
55	S	66.1	Low	61	Low	70 Å²	70	100.6 Å²	100.6	49%	0.49	57%	0.573	S	S	.	*	H	α-helix	trans	-64.6	-41.8	179.8	73.2	0	0	0	0	112.8	K51 V52 A58 L59	K51-S55 PolarHBondContact O-N 3.41Å; K51-S55 VanDerWaalsContact O-N 3.12Å; V52-S55 PolarHBondContact O-N 3.45Å; V52-S55 PolarHBondContact O-OG 3.45Å; S55-A58 PolarHBondContact O-N 2.97Å; S55-L59 WeakPolarHBondContact O-CB 3.28Å; S55-L59 PolarHBondContact O-N 2.85Å
56	V	64.4	Low	60.7	Low	58 Å²	58	99.1 Å²	99.1	35%	0.352	57%	0.565	S	S	.	*	H	α-helix	trans	-65.8	-41.1	178.2	167.2	0	0	0	0	110.9	A36 V52 L59 A60	A36-V56 HydrophobicContact CB-CG1 4.16Å; V52-V56 PolarHBondContact O-N 3.02Å; V56-L59 PolarHBondContact O-N 3.43Å; V56-A60 WeakPolarHBondContact O-CB 3.49Å; V56-A60 PolarHBondContact O-N 2.99Å
57	M	67.4	Low	60.4	Low	142 Å²	142	94.2 Å²	94.2	70%	0.7	55%	0.546	S	S	*	.	H	α-helix	trans	-70.6	-35.9	179.7	-165.2	174.5	-83.8	0	0	112.2	L53 A54 G61	L53-M57 PolarHBondContact O-N 3.03Å; A54-M57 PolarHBondContact O-N 3.12Å; M57-G61 PolarHBondContact O-N 2.97Å
58	A	62.8	Low	60.9	Low	67 Å²	67	96.3 Å²	96.3	55%	0.554	55%	0.553	S	S	*	*	H	α-helix	trans	-66.2	-44.8	174.1	0	0	0	0	0	112	A54 S55 G61 L62	A54-A58 WeakPolarHBondContact O-CB 3.14Å; A54-A58 PolarHBondContact O-N 3.48Å; S55-A58 PolarHBondContact O-N 2.97Å; A58-G61 PolarHBondContact O-N 2.94Å; A58-L62 PolarHBondContact O-N 2.92Å
59	L	67.2	Low	60.6	Low	126 Å²	126	89.6 Å²	89.6	66%	0.66	54%	0.538	S	S	*	.	H	α-helix	trans	-67.4	-39.6	178.2	-166.8	68.5	0	0	0	111.7	S55 V56 L62 A63	S55-L59 WeakPolarHBondContact O-CB 3.28Å; S55-L59 PolarHBondContact O-N 2.85Å; V56-L59 PolarHBondContact O-N 3.43Å; L59-L62 PolarHBondContact O-N 3.42Å; L59-A63 WeakPolarHBondContact O-CB 3.32Å; L59-A63 PolarHBondContact O-N 2.87Å
60	A	66.1	Low	60.6	Low	56 Å²	56	88.1 Å²	88.1	46%	0.463	53%	0.533	S	S	.	.	H	α-helix	trans	-64.5	-40.2	173.9	0	0	0	0	0	112	V56 A63 M64	V56-A60 WeakPolarHBondContact O-CB 3.49Å; V56-A60 PolarHBondContact O-N 2.99Å; A60-A63 PolarHBondContact O-N 3.29Å; A60-M64 VanDerWaalsContact O-CB 3.22Å; A60-M64 WeakPolarHBondContact O-CB 3.18Å; A60-M64 PolarHBondContact O-N 3.46Å
61	G	58.5	Low	60.3	Low	43 Å²	43	84.5 Å²	84.5	44%	0.443	52%	0.515	S	S	.	.	H	α-helix	trans	-66	-39.6	176.6	0	0	0	0	0	113.3	M57 A58 M64 G65	M57-G61 PolarHBondContact O-N 2.97Å; A58-G61 PolarHBondContact O-N 2.94Å; G61-M64 PolarHBondContact O-N 2.81Å; G61-G65 PolarHBondContact O-N 2.81Å
62	L	54.6	Low	60	Low	124 Å²	124	81.4 Å²	81.4	65%	0.649	51%	0.507	S	S	*	.	H	α-helix	trans	-66.9	-43.3	175.9	-172.4	68	0	0	0	111.6	A58 L59 G65 C66	A58-L62 PolarHBondContact O-N 2.92Å; L59-L62 PolarHBondContact O-N 3.42Å; L62-G65 PolarHBondContact O-N 3.39Å; L62-C66 PolarHBondContact O-N 3.33Å; L62-C66 VanDerWaalsContact O-N 3.15Å
63	A	62	Low	59.7	Low	47 Å²	47	83.7 Å²	83.7	39%	0.388	51%	0.513	S	S	.	.	H	α-helix	trans	-63.8	-44.2	175.1	0	0	0	0	0	111.4	L59 A60 G65 C66 I67	L59-A63 WeakPolarHBondContact O-CB 3.32Å; L59-A63 PolarHBondContact O-N 2.87Å; A60-A63 PolarHBondContact O-N 3.29Å; A63-G65 VanDerWaalsContact C-N 3.34Å; A63-G65 PolarHBondContact O-N 2.92Å; A63-C66 PolarHBondContact O-N 3.22Å; A63-I67 VanDerWaalsContact O-CD1 3.29Å; A63-I67 WeakPolarHBondContact O-CD1 3.19Å; A63-I67 WeakPolarHBondContact O-CG1 3.31Å; A63-I67 PolarHBondContact O-N 3.46Å
64	M	62.8	Low	59.1	Low	105 Å²	105	83.7 Å²	83.7	52%	0.517	51%	0.51	S	S	.	.	H	α-helix	trans	-60.3	-40.5	178	-168.5	173.2	-173.5	0	0	111.9	A60 G61 I67 D68	A60-M64 VanDerWaalsContact O-CB 3.22Å; A60-M64 WeakPolarHBondContact O-CB 3.18Å; A60-M64 PolarHBondContact O-N 3.46Å; G61-M64 PolarHBondContact O-N 2.81Å; M64-I67 PolarHBondContact O-N 3.43Å; M64-D68 WeakPolarHBondContact O-CB 3.15Å; M64-D68 PolarHBondContact O-N 2.79Å
65	G	57	Low	58.9	Low	36 Å²	36	85.8 Å²	85.8	37%	0.371	51%	0.513	S	S	.	.	H	α-helix	trans	-69.1	-38	177.1	0	0	0	0	0	114.6	G61 L62 A63 D68 T69	G61-G65 PolarHBondContact O-N 2.81Å; L62-G65 PolarHBondContact O-N 3.39Å; A63-G65 VanDerWaalsContact C-N 3.34Å; A63-G65 PolarHBondContact O-N 2.92Å; G65-D68 PolarHBondContact O-N 3.24Å; G65-T69 PolarHBondContact O-N 3.48Å; G65-T69 VanDerWaalsContact O-N 3.12Å; G65-T69 PolarHBondContact O-OG1 2.95Å
66	C	52.8	Low	58.4	Low	81 Å²	81	87.7 Å²	87.7	55%	0.547	52%	0.521	S	S	.	.	H	α-helix	trans	-66.3	-40.4	173.4	-88.9	0	0	0	0	111.7	L62 A63 T69 V70	L62-C66 PolarHBondContact O-N 3.33Å; L62-C66 VanDerWaalsContact O-N 3.15Å; A63-C66 PolarHBondContact O-N 3.22Å; C66-T69 PolarHBondContact O-N 2.82Å; C66-V70 WeakPolarHBondContact O-CG2 3.27Å; C66-V70 PolarHBondContact O-N 3.47Å
67	I	60.2	Low	57.9	Low	78 Å²	78	94.7 Å²	94.7	40%	0.4	54%	0.541	S	S	.	.	H	α-helix	trans	-66.7	-40.3	177.8	-63.1	160.2	0	0	0	110.4	A29 A63 M64 T69 V70 A71	A29-I67 HydrophobicContact CB-CD1 4.28Å; A63-I67 VanDerWaalsContact O-CD1 3.29Å; A63-I67 WeakPolarHBondContact O-CD1 3.19Å; A63-I67 WeakPolarHBondContact O-CG1 3.31Å; A63-I67 PolarHBondContact O-N 3.46Å; M64-I67 PolarHBondContact O-N 3.43Å; I67-T69 PolarHBondContact O-N 3.42Å; I67-V70 PolarHBondContact O-N 3.21Å; I67-A71 WeakPolarHBondContact O-CB 3.35Å; I67-A71 PolarHBondContact O-N 3.1Å
68	D	61.9	Low	57.3	Low	114 Å²	114	93 Å²	93	61%	0.61	53%	0.533	S	S	*	.	H	α-helix	trans	-64.4	-39.1	178.3	-157	80.1	0	0	0	112.1	M64 G65 V70 A71 N72	M64-D68 WeakPolarHBondContact O-CB 3.15Å; M64-D68 PolarHBondContact O-N 2.79Å; G65-D68 PolarHBondContact O-N 3.24Å; D68-V70 PolarHBondContact O-N 2.79Å; D68-A71 PolarHBondContact O-N 3.48Å; D68-N72 WeakPolarHBondContact O-CB 3.29Å; D68-N72 PolarHBondContact O-N 3.46Å
69	T	53.5	Low	56.9	Low	94 Å²	94	99.3 Å²	99.3	58%	0.577	54%	0.544	S	S	*	.	H	α-helix	trans	-64.1	-41	176.5	-54.8	0	0	0	0	112	G65 C66 I67	G65-T69 PolarHBondContact O-N 3.48Å; G65-T69 VanDerWaalsContact O-N 3.12Å; G65-T69 PolarHBondContact O-OG1 2.95Å; C66-T69 PolarHBondContact O-N 2.82Å; I67-T69 PolarHBondContact O-N 3.42Å
70	V	55.2	Low	56.1	Low	77 Å²	77	101.7 Å²	101.7	47%	0.467	55%	0.551	S	S	.	*	H	α-helix	trans	-76	-38.7	178.5	176.8	0	0	0	0	111.1	C66 I67 D68 M73 Q74	C66-V70 WeakPolarHBondContact O-CG2 3.27Å; C66-V70 PolarHBondContact O-N 3.47Å; I67-V70 PolarHBondContact O-N 3.21Å; D68-V70 PolarHBondContact O-N 2.79Å; V70-M73 PolarHBondContact O-N 3.27Å; V70-Q74 HydrophobicContact CG1-CG 4.37Å; V70-Q74 WeakPolarHBondContact O-CG 3.43Å; V70-Q74 PolarHBondContact O-N 3.41Å
71	A	55.4	Low	55.2	Low	43 Å²	43	106.8 Å²	106.8	36%	0.355	56%	0.563	S	S	.	*	H	α-helix	trans	-68.7	-36.7	177.6	0	0	0	0	0	112.2	I67 D68 M73 Q74 L75	I67-A71 WeakPolarHBondContact O-CB 3.35Å; I67-A71 PolarHBondContact O-N 3.1Å; D68-A71 PolarHBondContact O-N 3.48Å; A71-M73 PolarHBondContact O-N 3.32Å; A71-Q74 PolarHBondContact O-N 3.01Å; A71-Q74 VanDerWaalsContact O-N 3.16Å; A71-L75 WeakPolarHBondContact O-CB 3.43Å; A71-L75 PolarHBondContact O-N 2.81Å
72	N	47.2	Very low	55.1	Low	103 Å²	103	108.1 Å²	108.1	55%	0.551	56%	0.56	S	S	*	*	H	α-helix	trans	-58.9	-34.7	173.8	-173.3	41.1	0	0	0	111.6	D68	D68-N72 WeakPolarHBondContact O-CB 3.29Å; D68-N72 PolarHBondContact O-N 3.46Å
73	M	54.4	Low	54.6	Low	137 Å²	137	107.9 Å²	107.9	68%	0.675	57%	0.569	S	S	*	*	H	α-helix	trans	-81.6	-32.5	175.3	-66.9	-71.2	163.3	0	0	113.1	V70 A71	V70-M73 PolarHBondContact O-N 3.27Å; A71-M73 PolarHBondContact O-N 3.32Å
74	Q	49.9	Very low	54.1	Low	94 Å²	94	109.9 Å²	109.9	44%	0.439	59%	0.585	S	S	.	*	H	α-helix	trans	-82	-27.5	178.9	-71.9	-167.8	27.4	0	0	114	V70 A71 V76 R77 M78	V70-Q74 HydrophobicContact CG1-CG 4.37Å; V70-Q74 WeakPolarHBondContact O-CG 3.43Å; V70-Q74 PolarHBondContact O-N 3.41Å; A71-Q74 PolarHBondContact O-N 3.01Å; A71-Q74 VanDerWaalsContact O-N 3.16Å; Q74-V76 VanDerWaalsContact C-N 3.33Å; Q74-V76 PolarHBondContact O-N 3.29Å; Q74-R77 PolarHBondContact O-N 2.75Å; Q74-M78 WeakPolarHBondContact O-CG 3.41Å; Q74-M78 PolarHBondContact O-N 2.96Å
75	L	58.7	Low	53.5	Low	107 Å²	107	108.8 Å²	108.8	56%	0.56	58%	0.584	S	S	*	*	H	α-helix	trans	-60.6	-43.7	177.6	-177.1	72.3	0	0	0	110.6	A71 R77 M78 Y79	A71-L75 WeakPolarHBondContact O-CB 3.43Å; A71-L75 PolarHBondContact O-N 2.81Å; L75-R77 PolarHBondContact O-N 3.16Å; L75-M78 PolarHBondContact O-N 2.88Å; L75-Y79 HydrophobicContact CD1-CD2 4.41Å; L75-Y79 WeakPolarHBondContact O-CB 3.2Å; L75-Y79 PolarHBondContact O-N 3.29Å
76	V	55	Low	53.2	Low	110 Å²	110	114.9 Å²	114.9	67%	0.667	60%	0.601	S	S	*	*	H	α-helix	trans	-58.4	-30.6	175.1	165.8	0	0	0	0	112.2	Q74	Q74-V76 VanDerWaalsContact C-N 3.33Å; Q74-V76 PolarHBondContact O-N 3.29Å
77	R	52.9	Low	53.3	Low	205 Å²	205	118.7 Å²	118.7	77%	0.774	62%	0.615	S	S	*	*	H	α-helix	trans	-90.4	-31.2	-178.6	-65.4	-74.5	-168.6	142.9	2.1	113.2	Q74 L75	Q74-R77 PolarHBondContact O-N 2.75Å; L75-R77 PolarHBondContact O-N 3.16Å
78	M	55.8	Low	52.8	Low	107 Å²	107	123.7 Å²	123.7	53%	0.527	64%	0.637	S	S	.	*	H	α-helix	trans	-81	-32.8	178.2	-72.9	-71.8	-73.1	0	0	112.8	Q74 L75 Q80 K81 D82	Q74-M78 WeakPolarHBondContact O-CG 3.41Å; Q74-M78 PolarHBondContact O-N 2.96Å; L75-M78 PolarHBondContact O-N 2.88Å; M78-Q80 PolarHBondContact O-N 3.05Å; M78-Q80 VanDerWaalsContact O-N 3.11Å; M78-K81 PolarHBondContact O-N 3.4Å; M78-D82 VanDerWaalsContact CE-OD2 3.27Å; M78-D82 WeakPolarHBondContact CE-OD2 3.31Å; M78-D82 PolarHBondContact O-N 3.27Å
79	Y	53.4	Low	52.5	Low	198 Å²	198	123.4 Å²	123.4	78%	0.776	64%	0.635	S	S	*	*	T	Hydrogen-bonded Turn	trans	-59.4	-26.7	-179.2	-144.3	-90.4	0	0	0	113.2	L75	L75-Y79 HydrophobicContact CD1-CD2 4.41Å; L75-Y79 WeakPolarHBondContact O-CB 3.2Å; L75-Y79 PolarHBondContact O-N 3.29Å
80	Q	51.3	Low	52.5	Low	176 Å²	176	122.8 Å²	122.8	82%	0.822	63%	0.632	S	S	*	*	T	Hydrogen-bonded Turn	trans	-90.5	-14.4	179.7	-128.6	-82.2	-48.7	0	0	113	M78	M78-Q80 PolarHBondContact O-N 3.05Å; M78-Q80 VanDerWaalsContact O-N 3.11Å
81	K	45.9	Very low	52.5	Low	164 Å²	164	124.5 Å²	124.5	71%	0.713	64%	0.643	S	S	*	*	T	Hydrogen-bonded Turn	trans	-104.3	-34.1	-167.1	-167.6	80.9	99.6	68	0	114.5	M78	M78-K81 PolarHBondContact O-N 3.4Å
82	D	56.3	Low	52.1	Low	70 Å²	70	126.2 Å²	126.2	37%	0.374	65%	0.65	S	S	.	*			trans	-120	33.9	-161.3	-68.9	-69.3	0	0	0	115.4	M78 A84 V85	M78-D82 VanDerWaalsContact CE-OD2 3.27Å; M78-D82 WeakPolarHBondContact CE-OD2 3.31Å; M78-D82 PolarHBondContact O-N 3.27Å; D82-A84 PolarHBondContact O-N 2.95Å; D82-V85 PolarHBondContact O-N 3.3Å
83	S	45.8	Very low	52.8	Low	120 Å²	120	126.1 Å²	126.1	84%	0.839	65%	0.648	S	S	*	*	T	Hydrogen-bonded Turn	trans	-64.5	-7.2	-177.3	-157.1	0	0	0	0	115.2
84	A	49.8	Very low	53	Low	88 Å²	88	122.1 Å²	122.1	73%	0.727	64%	0.636	S	S	*	*	T	Hydrogen-bonded Turn	trans	-103.5	-18.4	-176.5	0	0	0	0	0	114.8	D82	D82-A84 PolarHBondContact O-N 2.95Å
85	V	50.5	Low	53.4	Low	82 Å²	82	121.2 Å²	121.2	50%	0.497	64%	0.637	S	S	.	*	G	3₁₀ helix	trans	-90.2	-15.8	-170.4	176.6	0	0	0	0	112.8	D82 L87 L89	D82-V85 PolarHBondContact O-N 3.3Å; V85-L87 PolarHBondContact O-N 2.9Å; V85-L87 VanDerWaalsContact O-N 3.14Å; V85-L89 HydrophobicContact CG1-CD1 3.63Å
86	F	51.2	Low	53.3	Low	164 Å²	164	119.9 Å²	119.9	72%	0.719	63%	0.63	S	S	*	*	G	3₁₀ helix	trans	-69.4	-11.1	-175.1	-160.8	-112.1	0	0	0	115
87	L	55.1	Low	53.5	Low	162 Å²	162	119.5 Å²	119.5	85%	0.848	62%	0.622	S	S	*	*	G	3₁₀ helix	trans	-86.6	-5.4	-174.9	-102.5	148.2	0	0	0	115	V85	V85-L87 PolarHBondContact O-N 2.9Å; V85-L87 VanDerWaalsContact O-N 3.14Å
88	Q	49.4	Very low	53.6	Low	183 Å²	183	114.9 Å²	114.9	86%	0.855	61%	0.612	S	S	*	*	S	Bend	trans	-126.4	-4.8	-173.3	-67.9	-175.4	-34.7	0	0	115.7
89	L	56.1	Low	53.8	Low	108 Å²	108	115 Å²	115	57%	0.565	61%	0.614	S	S	*	*			trans	-89.9	140.3	-173.1	-80.4	136.1	0	0	0	113.1	V85	V85-L89 HydrophobicContact CG1-CD1 3.63Å
90	P	53.2	Low	53.8	Low	81 Å²	81	109 Å²	109	53%	0.526	60%	0.601	S	S	.	*			trans	-73.6	153.9	-161.2	30.1	-36.3	0	0	0	113.1	P92 M93	P90-P92 VanDerWaalsContact C-N 3.28Å; P90-P92 HydrophobicContact CB-CG 4.25Å; P90-P92 HydrophobicContact CG-CG 4.13Å; P90-P92 WeakPolarHBondContact O-CD 3.39Å; P90-M93 PolarHBondContact O-N 2.85Å
91	V	54.1	Low	53.5	Low	113 Å²	113	107.7 Å²	107.7	69%	0.685	59%	0.593	S	S	*	*	H	α-helix	trans	-23.4	-44.4	172.4	-177.4	0	0	0	0	117.2	M93 A94 V95	V91-M93 VanDerWaalsContact C-N 3.27Å; V91-M93 PolarHBondContact O-N 3.26Å; V91-A94 WeakPolarHBondContact O-CB 3.32Å; V91-A94 PolarHBondContact O-N 3.49Å; V91-V95 HydrophobicContact CG1-CG2 4.47Å; V91-V95 PolarHBondContact O-N 2.93Å
92	P	47.7	Very low	53.5	Low	79 Å²	79	106 Å²	106	51%	0.513	59%	0.587	S	S	.	*	H	α-helix	trans	-57.1	-32.7	176	18.9	-34.9	0	0	0	115	P90 V95 L96	P90-P92 VanDerWaalsContact C-N 3.28Å; P90-P92 HydrophobicContact CB-CG 4.25Å; P90-P92 HydrophobicContact CG-CG 4.13Å; P90-P92 WeakPolarHBondContact O-CD 3.39Å; P92-V95 PolarHBondContact O-N 3.48Å; P92-L96 WeakPolarHBondContact O-CB 3.32Å; P92-L96 PolarHBondContact O-N 2.86Å
93	M	62.4	Low	53.4	Low	101 Å²	101	108.8 Å²	108.8	50%	0.498	59%	0.593	S	S	.	*	H	α-helix	trans	-69.7	-36	175	-73.8	-62.1	127.9	0	0	111.4	P90 V91 L96 M97	P90-M93 PolarHBondContact O-N 2.85Å; V91-M93 VanDerWaalsContact C-N 3.27Å; V91-M93 PolarHBondContact O-N 3.26Å; M93-L96 HydrophobicContact CE-CD2 4.33Å; M93-L96 PolarHBondContact O-N 3.38Å; M93-L96 HydrophobicContact SD-CD2 4.24Å; M93-M97 WeakPolarHBondContact O-CB 3.34Å; M93-M97 PolarHBondContact O-N 2.97Å
94	A	59	Low	53.4	Low	52 Å²	52	110.3 Å²	110.3	43%	0.43	59%	0.591	S	S	.	*	H	α-helix	trans	-66.3	-39	173.9	0	0	0	0	0	111.6	V91 L96 M97 L98	V91-A94 WeakPolarHBondContact O-CB 3.32Å; V91-A94 PolarHBondContact O-N 3.49Å; A94-L96 VanDerWaalsContact C-N 3.35Å; A94-M97 PolarHBondContact O-N 3.32Å; A94-L98 WeakPolarHBondContact O-CB 3.44Å; A94-L98 VanDerWaalsContact O-CG 3.23Å; A94-L98 WeakPolarHBondContact O-CG 3.47Å; A94-L98 PolarHBondContact O-N 3.02Å
95	V	58.4	Low	53.1	Low	75 Å²	75	112.5 Å²	112.5	46%	0.455	59%	0.59	S	S	.	*	H	α-helix	trans	-64.2	-41.2	173.8	177.2	0	0	0	0	110.9	V91 P92 M97 L98 L99	V91-V95 HydrophobicContact CG1-CG2 4.47Å; V91-V95 PolarHBondContact O-N 2.93Å; P92-V95 PolarHBondContact O-N 3.48Å; V95-M97 VanDerWaalsContact C-N 3.33Å; V95-M97 PolarHBondContact O-N 3.4Å; V95-L98 PolarHBondContact O-N 3.26Å; V95-L99 HydrophobicContact CG1-CD1 4Å; V95-L99 HydrophobicContact CG1-CG 4.41Å; V95-L99 WeakPolarHBondContact O-CB 3.36Å; V95-L99 VanDerWaalsContact O-CG 3.27Å; V95-L99 WeakPolarHBondContact O-CG 3.23Å; V95-L99 PolarHBondContact O-N 3.44Å
96	L	56.1	Low	52.6	Low	80 Å²	80	113.8 Å²	113.8	42%	0.419	60%	0.597	S	S	.	*	H	α-helix	trans	-64.9	-37	175.1	-165.4	67.4	0	0	0	112	P92 M93 A94 S100	P92-L96 WeakPolarHBondContact O-CB 3.32Å; P92-L96 PolarHBondContact O-N 2.86Å; M93-L96 HydrophobicContact CE-CD2 4.33Å; M93-L96 PolarHBondContact O-N 3.38Å; M93-L96 HydrophobicContact SD-CD2 4.24Å; A94-L96 VanDerWaalsContact C-N 3.35Å; L96-S100 VanDerWaalsContact O-CB 3.32Å; L96-S100 WeakPolarHBondContact O-CB 3.27Å; L96-S100 PolarHBondContact O-N 2.78Å; L96-S100 PolarHBondContact O-OG 3.21Å
97	M	59.4	Low	52	Low	101 Å²	101	109.9 Å²	109.9	50%	0.498	59%	0.59	S	S	.	*	H	α-helix	trans	-71.7	-35.9	175.8	-124.1	-100.9	-170	0	0	112.8	M93 A94 V95 S100 K101	M93-M97 WeakPolarHBondContact O-CB 3.34Å; M93-M97 PolarHBondContact O-N 2.97Å; A94-M97 PolarHBondContact O-N 3.32Å; V95-M97 VanDerWaalsContact C-N 3.33Å; V95-M97 PolarHBondContact O-N 3.4Å; M97-S100 VanDerWaalsContact CA-OG 3.32Å; M97-S100 WeakPolarHBondContact CA-OG 3.4Å; M97-S100 PolarHBondContact O-N 3.04Å; M97-S100 PolarHBondContact O-OG 3.45Å; M97-K101 PolarHBondContact O-N 2.95Å
98	L	54.7	Low	51.3	Low	108 Å²	108	106.7 Å²	106.7	57%	0.565	58%	0.58	S	S	*	*	H	α-helix	trans	-71.8	-43.7	175.4	-74.2	170.6	0	0	0	110.4	A94 V95 S100 K101 E102	A94-L98 WeakPolarHBondContact O-CB 3.44Å; A94-L98 VanDerWaalsContact O-CG 3.23Å; A94-L98 WeakPolarHBondContact O-CG 3.47Å; A94-L98 PolarHBondContact O-N 3.02Å; V95-L98 PolarHBondContact O-N 3.26Å; L98-S100 VanDerWaalsContact C-N 3.28Å; L98-S100 PolarHBondContact O-N 2.92Å; L98-K101 PolarHBondContact O-N 3.33Å; L98-E102 VanDerWaalsContact O-CG 3.31Å; L98-E102 WeakPolarHBondContact O-CG 3.34Å; L98-E102 PolarHBondContact O-N 2.87Å
99	L	59.1	Low	50.8	Low	110 Å²	110	104.1 Å²	104.1	58%	0.576	58%	0.579	S	S	*	*	H	α-helix	trans	-63.1	-34.9	172.6	-70.7	172.6	0	0	0	111.7	V95 E102 R103	V95-L99 HydrophobicContact CG1-CD1 4Å; V95-L99 HydrophobicContact CG1-CG 4.41Å; V95-L99 WeakPolarHBondContact O-CB 3.36Å; V95-L99 VanDerWaalsContact O-CG 3.27Å; V95-L99 WeakPolarHBondContact O-CG 3.23Å; V95-L99 PolarHBondContact O-N 3.44Å; L99-E102 PolarHBondContact O-N 3.02Å; L99-R103 VanDerWaalsContact O-CB 3.32Å; L99-R103 WeakPolarHBondContact O-CB 3.17Å; L99-R103 PolarHBondContact O-N 3.04Å
100	S	53.5	Low	50.4	Low	71 Å²	71	106.6 Å²	106.6	50%	0.497	59%	0.588	S	S	.	*	H	α-helix	trans	-73.4	-30.5	175.8	71.6	0	0	0	0	113.6	L96 M97 L98	L96-S100 VanDerWaalsContact O-CB 3.32Å; L96-S100 WeakPolarHBondContact O-CB 3.27Å; L96-S100 PolarHBondContact O-N 2.78Å; L96-S100 PolarHBondContact O-OG 3.21Å; M97-S100 VanDerWaalsContact CA-OG 3.32Å; M97-S100 WeakPolarHBondContact CA-OG 3.4Å; M97-S100 PolarHBondContact O-N 3.04Å; M97-S100 PolarHBondContact O-OG 3.45Å; L98-S100 VanDerWaalsContact C-N 3.28Å; L98-S100 PolarHBondContact O-N 2.92Å
101	K	46.4	Very low	49.7	Very low	149 Å²	149	114.1 Å²	114.1	65%	0.648	61%	0.605	S	S	*	*	H	α-helix	trans	-68.3	-38	169.7	-88.8	-166.4	76.7	93.9	0	112.8	M97 L98	M97-K101 PolarHBondContact O-N 2.95Å; L98-K101 PolarHBondContact O-N 3.33Å
102	E	46.1	Very low	49	Very low	129 Å²	129	119.5 Å²	119.5	60%	0.603	61%	0.614	S	S	*	*	H	α-helix	trans	-83.2	-26.6	-177.2	-62.7	-66	147.3	0	0	112.9	L98 L99 L104	L98-E102 VanDerWaalsContact O-CG 3.31Å; L98-E102 WeakPolarHBondContact O-CG 3.34Å; L98-E102 PolarHBondContact O-N 2.87Å; L99-E102 PolarHBondContact O-N 3.02Å; E102-L104 PolarHBondContact O-N 3Å
103	R	53.8	Low	48.8	Very low	129 Å²	129	121.2 Å²	121.2	49%	0.487	63%	0.625	S	S	.	*	T	Hydrogen-bonded Turn	trans	-75.8	3	175.8	-109.5	-74.8	-172.1	-166.4	-1.8	115	L99 L105 C107	L99-R103 VanDerWaalsContact O-CB 3.32Å; L99-R103 WeakPolarHBondContact O-CB 3.17Å; L99-R103 PolarHBondContact O-N 3.04Å; R103-L105 PolarHBondContact O-N 3.11Å; R103-C107 PolarHBondContact NH1-SG 3.35Å
104	L	46	Very low	47.6	Very low	152 Å²	152	123.4 Å²	123.4	80%	0.796	64%	0.638	S	S	*	*	T	Hydrogen-bonded Turn	trans	-72.9	-16.1	171.7	-157.8	107.3	0	0	0	112.5	E102	E102-L104 PolarHBondContact O-N 3Å
105	L	42.3	Very low	46.9	Very low	134 Å²	134	129 Å²	129	70%	0.702	66%	0.659	S	S	*	*	S	Bend	trans	-104.5	-16.2	-171.9	-82.4	155	0	0	0	115.6	R103	R103-L105 PolarHBondContact O-N 3.11Å
106	T	40.8	Very low	46.1	Very low	108 Å²	108	133.3 Å²	133.3	66%	0.663	68%	0.679	S	S	*	*	S	Bend	trans	-107	-2.4	-171	8.1	0	0	0	0	115.9
107	C	39.2	Very low	45.1	Very low	83 Å²	83	135 Å²	135	56%	0.561	70%	0.698	S	S	*	*	S	Bend	trans	-96.1	-8.6	176.7	-77.2	0	0	0	0	114.6	R103	R103-C107 PolarHBondContact NH1-SG 3.35Å
108	C	39	Very low	44.6	Very low	95 Å²	95	134.7 Å²	134.7	64%	0.642	71%	0.711	S	S	*	*	S	Bend	trans	-134.1	129.4	178.2	-63.1	0	0	0	0	109.8	Q110	C108-Q110 PolarHBondContact O-N 3.44Å; C108-Q110 VanDerWaalsContact O-N 3.14Å
109	P	39.9	Very low	44.3	Very low	128 Å²	128	137.1 Å²	137.1	83%	0.831	72%	0.724	S	S	*	*			trans	-63.8	114.4	156.7	27	-28.5	0	0	0	108.3
110	Q	46.6	Very low	43.8	Very low	160 Å²	160	140.2 Å²	140.2	75%	0.748	74%	0.736	S	S	*	*			trans	33.7	96.8	149.2	-162.9	79.3	-17.1	0	0	117.1	C108	C108-Q110 PolarHBondContact O-N 3.44Å; C108-Q110 VanDerWaalsContact O-N 3.14Å
111	R	38.7	Very low	43.6	Very low	239 Å²	239	144.7 Å²	144.7	90%	0.902	75%	0.754	S	S	*	*			trans	-146	49.1	159.8	-118.4	-80	178.5	110.3	0.2	113.8
112	R	41	Very low	43.4	Very low	227 Å²	227	141.9 Å²	141.9	86%	0.857	76%	0.758	S	S	*	*			trans	-148.8	123.2	145.2	-64.7	-163.6	-175.3	-169.9	2.7	110.9
113	P	42.8	Very low	43.7	Very low	115 Å²	115	143.3 Å²	143.3	75%	0.747	77%	0.769	S	S	*	*				-99.6	117.1	125.2	28.6	-17.3	0	0	0	106.4
114	L	37.3	Very low	43.3	Very low	147 Å²	147	145.5 Å²	145.5	77%	0.77	78%	0.784	S	S	*	*				64.4	108.2	92.4	-151.4	172.7	0	0	0	111.1	L116	L114-L116 PolarHBondContact O-N 2.99Å
115	L	43.3	Very low	43.1	Very low	169 Å²	169	145.1 Å²	145.1	89%	0.885	79%	0.789	S	S	*	*	S	Bend	trans	-28.2	97.4	157.8	-89.2	169.6	0	0	0	113.8
116	L	41.5	Very low	43	Very low	166 Å²	166	151.2 Å²	151.2	87%	0.869	81%	0.813	S	S	*	*			trans	170.8	77.6	149	-114.1	160.4	0	0	0	109.9	L114	L114-L116 PolarHBondContact O-N 2.99Å
117	S	36.4	Very low	43.1	Very low	116 Å²	116	153.4 Å²	153.4	81%	0.811	82%	0.821	S	S	*	*			trans	-149	94.4	156.6	-122.6	0	0	0	0	109.7	D119	S117-D119 PolarHBondContact O-N 3.14Å
118	A	47.9	Very low	43.3	Very low	93 Å²	93	157.1 Å²	157.1	77%	0.769	84%	0.835	S	S	*	*				59.1	61.3	124.6	0	0	0	0	0	116.6
119	D	48	Very low	43.6	Very low	159 Å²	159	160.5 Å²	160.5	85%	0.85	85%	0.845	S	S	*	*			trans	-128.8	55.3	157.6	-150.8	-102.7	0	0	0	109.2	S117	S117-D119 PolarHBondContact O-N 3.14Å
120	E	50.3	Low	43.8	Very low	176 Å²	176	162.4 Å²	162.4	82%	0.822	85%	0.846	S	S	*	*	S	Bend	trans	-165.1	53.2	168.9	-101.3	-65.1	79.3	0	0	110.4
121	L	48.5	Very low	43.6	Very low	165 Å²	165	162.6 Å²	162.6	86%	0.864	85%	0.852	S	S	*	*	S	Bend	trans	-176.3	120.7	139.2	-129.8	72.3	0	0	0	112.6
122	A	42.8	Very low	44	Very low	89 Å²	89	157.5 Å²	157.5	74%	0.736	85%	0.849	S	S	*	*			trans	69.6	104.6	153.2	0	0	0	0	0	119.1
123	L	51.4	Low	44.2	Very low	160 Å²	160	152.5 Å²	152.5	84%	0.838	85%	0.849	S	S	*	*				-166.2	111	105.7	-146.3	73.9	0	0	0	112.2
124	E	45.6	Very low	44.3	Very low	174 Å²	174	155.4 Å²	155.4	81%	0.813	86%	0.856	S	S	*	*			trans	51.7	90.4	135.3	-55.4	-82.4	86.2	0	0	117.8
125	T	42.4	Very low	44.9	Very low	144 Å²	144	156.1 Å²	156.1	88%	0.883	86%	0.864	S	S	*	*			trans	-97.3	114.8	144.7	55.8	0	0	0	0	108.3
126	Q	40.3	Very low	45	Very low	262 Å²	262	154.9 Å²	154.9	100%	1.224	86%	0.862	S	S	*	*			trans	-39.2	0	167.2	-160.9	-179.3	24	0	0	114.5

Retrieved 126 of 126 residues in 115.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).