A0A087WWZ0_HUMAN Loading...

Protein phosphatase 1 regulatory subunit 16A

AlphaFold DB , UniProt , Accession A0A087WWZ0, Species HUMAN (Homo sapiens, Human), Gene PPP1R16A, Length 65 aa.

						>A0A087WWZ0_HUMAN|A0A087WWZ0|PPP1R16A
MAEHLELLAEMPMVGRMSTQERLKHAQKRRAQQVKMWAQAEKEAQGKKGPGERPRKEAASQGLLK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	61.4	Low	82.7	Confident	187 Å²	187	101.5 Å²	101.5	92%	0.921	53%	0.53	S	S	*	.				0	149.5	0	-141.1	172.1	-179.5	0	0	106.3
2	A	70.9	Confident	83.5	Confident	31 Å²	31	99.2 Å²	99.2	26%	0.256	53%	0.526	S	S	.	.			trans	-73.8	135.2	170.5	0	0	0	0	0	108.2
3	E	81.9	Confident	84.1	Confident	123 Å²	123	98.7 Å²	98.7	58%	0.575	52%	0.521	S	S	*	.			trans	-76.4	151.7	-175.2	-67	-59.4	130.4	0	0	110.9	L5 E6 L7	E3-L5 PolarHBondContact O-N 3.1Å; E3-L5 VanDerWaalsContact O-N 3.13Å; E3-E6 PolarHBondContact N-OE2 3.38Å; E3-E6 VanDerWaalsContact N-OE2 3.11Å; E3-E6 WeakPolarHBondContact O-CB 3.37Å; E3-E6 PolarHBondContact O-N 3.1Å; E3-L7 PolarHBondContact O-N 2.9Å
4	H	82.2	Confident	84.7	Confident	130 Å²	130	93.9 Å²	93.9	60%	0.602	50%	0.498	S	S	*	.	H	α-helix	trans	-55.9	-34.5	-177.7	-178.7	65.2	0	0	0	112.6	L7 L8	H4-L7 WeakPolarHBondContact O-CB 3.46Å; H4-L7 PolarHBondContact O-N 2.95Å; H4-L8 PolarHBondContact O-N 3.28Å; H4-L8 VanDerWaalsContact O-N 3.16Å
5	L	85.9	Confident	85.2	Confident	134 Å²	134	91.7 Å²	91.7	70%	0.702	51%	0.506	S	S	*	.	H	α-helix	trans	-66.8	-36.7	177.6	-63.4	177.9	0	0	0	112.9	E3 L7 L8 A9	E3-L5 PolarHBondContact O-N 3.1Å; E3-L5 VanDerWaalsContact O-N 3.13Å; L5-L7 VanDerWaalsContact C-N 3.34Å; L5-L8 PolarHBondContact O-N 3.27Å; L5-A9 WeakPolarHBondContact O-CB 3.43Å; L5-A9 PolarHBondContact O-N 3.38Å
6	E	84.1	Confident	85.8	Confident	106 Å²	106	99.3 Å²	99.3	50%	0.495	52%	0.524	S	S	.	.	H	α-helix	trans	-66.1	-38.9	175.3	-71.7	-179.2	102.3	0	0	111.2	E3 L8 A9 E10	E3-E6 PolarHBondContact N-OE2 3.38Å; E3-E6 VanDerWaalsContact N-OE2 3.11Å; E3-E6 WeakPolarHBondContact O-CB 3.37Å; E3-E6 PolarHBondContact O-N 3.1Å; E6-L8 PolarHBondContact O-N 3.06Å; E6-A9 PolarHBondContact O-N 3.16Å; E6-E10 WeakPolarHBondContact O-CG 3.44Å; E6-E10 PolarHBondContact O-N 3.06Å
7	L	85.3	Confident	86.4	Confident	66 Å²	66	95.8 Å²	95.8	35%	0.346	51%	0.505	S	S	.	.	H	α-helix	trans	-59.9	-46.3	175.1	-76.3	163.4	0	0	0	111.4	E3 H4 L5 E10 M11	E3-L7 PolarHBondContact O-N 2.9Å; H4-L7 WeakPolarHBondContact O-CB 3.46Å; H4-L7 PolarHBondContact O-N 2.95Å; L5-L7 VanDerWaalsContact C-N 3.34Å; L7-E10 PolarHBondContact O-N 3.13Å; L7-M11 WeakPolarHBondContact O-CG 3.22Å; L7-M11 PolarHBondContact O-N 3.01Å
8	L	89.1	Confident	86.9	Confident	92 Å²	92	93.6 Å²	93.6	48%	0.482	50%	0.499	S	S	.	.	H	α-helix	trans	-65.8	-40.9	178.8	-70	177	0	0	0	112.3	H4 L5 E6 E10 M11 P12	H4-L8 PolarHBondContact O-N 3.28Å; H4-L8 VanDerWaalsContact O-N 3.16Å; L5-L8 PolarHBondContact O-N 3.27Å; E6-L8 PolarHBondContact O-N 3.06Å; L8-E10 PolarHBondContact O-N 2.94Å; L8-M11 WeakPolarHBondContact O-CB 3.37Å; L8-M11 PolarHBondContact O-N 3.48Å; L8-P12 WeakPolarHBondContact O-CD 3.45Å
9	A	91.1	Very high	87.3	Confident	75 Å²	75	94 Å²	94	62%	0.62	51%	0.505	S	S	*	.	H	α-helix	trans	-62.4	-28.9	178.7	0	0	0	0	0	112.7	L5 E6 P12	L5-A9 WeakPolarHBondContact O-CB 3.43Å; L5-A9 PolarHBondContact O-N 3.38Å; E6-A9 PolarHBondContact O-N 3.16Å; A9-P12 WeakPolarHBondContact O-CD 3.43Å
10	E	87.4	Confident	87.8	Confident	49 Å²	49	96.5 Å²	96.5	23%	0.229	51%	0.514	C	S	.	.	H	α-helix	trans	-82.1	-20.4	178.5	-73.6	179.5	-130.4	0	0	114.2	E6 L7 L8 M13 V14 H25 R29	E6-E10 WeakPolarHBondContact O-CG 3.44Å; E6-E10 PolarHBondContact O-N 3.06Å; L7-E10 PolarHBondContact O-N 3.13Å; L8-E10 PolarHBondContact O-N 2.94Å; E10-M13 WeakPolarHBondContact O-CB 3.43Å; E10-M13 PolarHBondContact O-N 3.11Å; E10-M13 VanDerWaalsContact O-N 3.07Å; E10-V14 WeakPolarHBondContact O-CG2 3.48Å; E10-V14 PolarHBondContact O-N 3.34Å; E10-H25 IonicContact OE2-CE1 3.3Å; E10-H25 PolarHBondContact OE2-CE1 3.42Å; E10-H25 VanDerWaalsContact OE2-CE1 3.3Å; E10-H25 IonicContact OE2-NE2 2.79Å; E10-H25 PolarHBondContact OE2-NE2 3.2Å; E10-R29 VanDerWaalsContact CD-NH1 3.28Å; E10-R29 VanDerWaalsContact CD-NH2 3.3Å; E10-R29 IonicContact OE1-CZ 3.39Å; E10-R29 IonicContact OE1-NH1 3.47Å; E10-R29 PolarHBondContact OE1-NH1 3.38Å; E10-R29 IonicContact OE1-NH2 2.68Å; E10-R29 PolarHBondContact OE1-NH2 2.98Å; E10-R29 IonicContact OE2-CZ 3.34Å; E10-R29 IonicContact OE2-NH1 2.66Å; E10-R29 PolarHBondContact OE2-NH1 3.19Å; E10-R29 IonicContact OE2-NH2 3.45Å; E10-R29 PolarHBondContact OE2-NH2 3.28Å
11	M	90.3	Very high	88.2	Confident	123 Å²	123	96.3 Å²	96.3	61%	0.606	51%	0.51	S	S	*	.	H	α-helix	trans	-56	-43.7	-176.8	-72.4	-69	-69.3	0	0	114.2	L7 L8 M13 V14 G15	L7-M11 WeakPolarHBondContact O-CG 3.22Å; L7-M11 PolarHBondContact O-N 3.01Å; L8-M11 WeakPolarHBondContact O-CB 3.37Å; L8-M11 PolarHBondContact O-N 3.48Å; M11-M13 PolarHBondContact O-N 3.42Å; M11-V14 PolarHBondContact O-N 2.89Å; M11-G15 PolarHBondContact O-N 3.37Å
12	P	92.1	Very high	89.8	Confident	74 Å²	74	92 Å²	92	48%	0.481	48%	0.483	S	S	.	.	H	α-helix	trans	-64.8	-26.1	177.7	-22.1	34.3	0	0	0	114	L8 A9 R16	L8-P12 WeakPolarHBondContact O-CD 3.45Å; A9-P12 WeakPolarHBondContact O-CD 3.43Å; P12-R16 PolarHBondContact O-NE 2.9Å; P12-R16 VanDerWaalsContact O-NE 3.15Å
13	M	91.4	Very high	91.1	Very high	93 Å²	93	95.5 Å²	95.5	46%	0.458	50%	0.497	S	S	.	.	H	α-helix	trans	-76.5	-47.4	175	-178	-174	70.3	0	0	110	E10 M11 G15 R16 M17	E10-M13 WeakPolarHBondContact O-CB 3.43Å; E10-M13 PolarHBondContact O-N 3.11Å; E10-M13 VanDerWaalsContact O-N 3.07Å; M11-M13 PolarHBondContact O-N 3.42Å; M13-G15 PolarHBondContact O-N 3.44Å; M13-R16 PolarHBondContact O-N 2.85Å; M13-M17 WeakPolarHBondContact O-CG 3.27Å
14	V	92.3	Very high	91.7	Very high	32 Å²	32	96.3 Å²	96.3	19%	0.194	50%	0.499	C	S	.	.	H	α-helix	trans	-59	-35	178.5	174.8	0	0	0	0	112	E10 M11 R16 M17 R22	E10-V14 WeakPolarHBondContact O-CG2 3.48Å; E10-V14 PolarHBondContact O-N 3.34Å; M11-V14 PolarHBondContact O-N 2.89Å; V14-R16 PolarHBondContact O-N 3.18Å; V14-M17 HydrophobicContact CG2-SD 4.33Å; V14-M17 PolarHBondContact O-N 2.83Å; V14-R22 HydrophobicContact CG1-CG 3.96Å
15	G	92.4	Very high	92.3	Very high	60 Å²	60	92.1 Å²	92.1	62%	0.619	48%	0.479	S	S	*	.	T	Hydrogen-bonded Turn	trans	-62.9	-23.5	176.3	0	0	0	0	0	114.8	M11 M13	M11-G15 PolarHBondContact O-N 3.37Å; M13-G15 PolarHBondContact O-N 3.44Å
16	R	95.7	Very high	92.7	Very high	214 Å²	214	88.5 Å²	88.5	81%	0.808	47%	0.469	S	S	*	.	T	Hydrogen-bonded Turn	trans	-94.4	-10	179.8	-57.5	178.4	-143.4	-162.1	1.6	113.3	P12 M13 V14	P12-R16 PolarHBondContact O-NE 2.9Å; P12-R16 VanDerWaalsContact O-NE 3.15Å; M13-R16 PolarHBondContact O-N 2.85Å; V14-R16 PolarHBondContact O-N 3.18Å
17	M	94.6	Very high	93.2	Very high	39 Å²	39	89 Å²	89	19%	0.192	47%	0.471	C	S	.	.	S	Bend	trans	-78.5	151.1	-177.3	-68.4	170.3	89.3	0	0	111.5	M13 V14 E21 R22 H25	M13-M17 WeakPolarHBondContact O-CG 3.27Å; V14-M17 HydrophobicContact CG2-SD 4.33Å; V14-M17 PolarHBondContact O-N 2.83Å; M17-E21 HydrophobicContact CB-CB 3.86Å; M17-E21 HydrophobicContact CE-CB 3.68Å; M17-E21 WeakPolarHBondContact CE-O 3.44Å; M17-E21 HydrophobicContact CG-CB 4.29Å; M17-R22 HydrophobicContact CB-CG 3.81Å; M17-R22 PolarHBondContact O-NH1 3.2Å; M17-H25 HydrophobicContact CE-CB 3.94Å
18	S	96.6	Very high	93.6	Very high	56 Å²	56	92.3 Å²	92.3	39%	0.392	48%	0.483	S	S	.	.			trans	-67.7	164.8	166.5	67.9	0	0	0	0	111.5	Q20 E21 R22	S18-Q20 VanDerWaalsContact C-N 3.26Å; S18-Q20 PolarHBondContact O-N 3.32Å; S18-E21 VanDerWaalsContact CB-OE2 3.25Å; S18-E21 WeakPolarHBondContact CB-OE2 3.4Å; S18-E21 PolarHBondContact N-OE2 3.47Å; S18-E21 PolarHBondContact O-N 3.44Å; S18-E21 VanDerWaalsContact OG-CG 3.29Å; S18-E21 WeakPolarHBondContact OG-CG 3.44Å; S18-E21 PolarHBondContact OG-N 2.91Å; S18-E21 PolarHBondContact OG-OE2 3.11Å; S18-R22 WeakPolarHBondContact O-CG 3.47Å; S18-R22 PolarHBondContact O-N 2.99Å
19	T	94.8	Very high	93.7	Very high	102 Å²	102	89.7 Å²	89.7	63%	0.626	47%	0.467	S	S	*	.	H	α-helix	trans	-56.5	-39.7	177.7	-59.8	0	0	0	0	112.7	R22 L23	T19-R22 PolarHBondContact O-N 3.12Å; T19-R22 PolarHBondContact OG1-NH2 3.15Å; T19-L23 PolarHBondContact O-N 3.07Å
20	Q	97.2	Very high	93.8	Very high	144 Å²	144	94.1 Å²	94.1	67%	0.673	47%	0.467	S	S	*	.	H	α-helix	trans	-68.3	-40.3	178.9	-68	-175.7	2.1	0	0	112.2	S18 L23 K24	S18-Q20 VanDerWaalsContact C-N 3.26Å; S18-Q20 PolarHBondContact O-N 3.32Å; Q20-L23 WeakPolarHBondContact O-CB 3.43Å; Q20-L23 PolarHBondContact O-N 3.29Å; Q20-K24 WeakPolarHBondContact O-CG 3.48Å; Q20-K24 PolarHBondContact O-N 3.37Å
21	E	96.1	Very high	94	Very high	93 Å²	93	94.1 Å²	94.1	44%	0.435	48%	0.475	S	S	.	.	H	α-helix	trans	-65.8	-42.2	177	-72.5	171.3	113.7	0	0	111.1	M17 S18 L23 K24 H25	M17-E21 HydrophobicContact CB-CB 3.86Å; M17-E21 HydrophobicContact CE-CB 3.68Å; M17-E21 WeakPolarHBondContact CE-O 3.44Å; M17-E21 HydrophobicContact CG-CB 4.29Å; S18-E21 VanDerWaalsContact CB-OE2 3.25Å; S18-E21 WeakPolarHBondContact CB-OE2 3.4Å; S18-E21 PolarHBondContact N-OE2 3.47Å; S18-E21 PolarHBondContact O-N 3.44Å; S18-E21 VanDerWaalsContact OG-CG 3.29Å; S18-E21 WeakPolarHBondContact OG-CG 3.44Å; S18-E21 PolarHBondContact OG-N 2.91Å; S18-E21 PolarHBondContact OG-OE2 3.11Å; E21-L23 VanDerWaalsContact C-N 3.29Å; E21-L23 PolarHBondContact O-N 3.44Å; E21-K24 PolarHBondContact O-N 2.79Å; E21-H25 WeakPolarHBondContact O-CB 3.5Å; E21-H25 PolarHBondContact O-N 2.66Å
22	R	94.8	Very high	94.1	Very high	96 Å²	96	93 Å²	93	36%	0.362	47%	0.469	S	S	.	.	H	α-helix	trans	-58.6	-41.4	172.9	-71.1	-166.1	-71.1	-98.1	-2.5	112.1	V14 M17 S18 T19 H25 A26	V14-R22 HydrophobicContact CG1-CG 3.96Å; M17-R22 HydrophobicContact CB-CG 3.81Å; M17-R22 PolarHBondContact O-NH1 3.2Å; S18-R22 WeakPolarHBondContact O-CG 3.47Å; S18-R22 PolarHBondContact O-N 2.99Å; T19-R22 PolarHBondContact O-N 3.12Å; T19-R22 PolarHBondContact OG1-NH2 3.15Å; R22-H25 PolarHBondContact O-N 3.27Å; R22-A26 WeakPolarHBondContact O-CB 3.48Å; R22-A26 PolarHBondContact O-N 2.84Å
23	L	97.2	Very high	94	Very high	104 Å²	104	93 Å²	93	55%	0.545	46%	0.463	S	S	.	.	H	α-helix	trans	-62.2	-47.9	176.8	-178.7	63.2	0	0	0	111.5	T19 Q20 E21 H25 A26 Q27	T19-L23 PolarHBondContact O-N 3.07Å; Q20-L23 WeakPolarHBondContact O-CB 3.43Å; Q20-L23 PolarHBondContact O-N 3.29Å; E21-L23 VanDerWaalsContact C-N 3.29Å; E21-L23 PolarHBondContact O-N 3.44Å; L23-H25 VanDerWaalsContact C-N 3.31Å; L23-H25 PolarHBondContact O-N 2.68Å; L23-A26 PolarHBondContact O-N 3.44Å; L23-Q27 VanDerWaalsContact O-CG 3.32Å; L23-Q27 WeakPolarHBondContact O-CG 3.41Å; L23-Q27 PolarHBondContact O-N 3.04Å
24	K	96.2	Very high	94	Very high	141 Å²	141	92.2 Å²	92.2	61%	0.613	46%	0.462	S	S	*	.	H	α-helix	trans	-59.5	-42.1	175.9	-72.5	176.8	-179.6	177.2	0	111.7	Q20 E21 Q27 K28	Q20-K24 WeakPolarHBondContact O-CG 3.48Å; Q20-K24 PolarHBondContact O-N 3.37Å; E21-K24 PolarHBondContact O-N 2.79Å; K24-Q27 PolarHBondContact O-N 3.3Å; K24-K28 WeakPolarHBondContact O-CB 3.44Å; K24-K28 PolarHBondContact O-N 3.45Å
25	H	94.7	Very high	93.9	Very high	42 Å²	42	98.2 Å²	98.2	19%	0.194	49%	0.486	C	S	.	.	H	α-helix	trans	-62	-48.1	177.8	-167.4	69.5	0	0	0	111.9	E10 M17 E21 R22 L23 Q27 K28 R29	E10-H25 IonicContact OE2-CE1 3.3Å; E10-H25 PolarHBondContact OE2-CE1 3.42Å; E10-H25 VanDerWaalsContact OE2-CE1 3.3Å; E10-H25 IonicContact OE2-NE2 2.79Å; E10-H25 PolarHBondContact OE2-NE2 3.2Å; M17-H25 HydrophobicContact CE-CB 3.94Å; E21-H25 WeakPolarHBondContact O-CB 3.5Å; E21-H25 PolarHBondContact O-N 2.66Å; R22-H25 PolarHBondContact O-N 3.27Å; L23-H25 VanDerWaalsContact C-N 3.31Å; L23-H25 PolarHBondContact O-N 2.68Å; H25-Q27 PolarHBondContact O-N 3.47Å; H25-K28 PolarHBondContact O-N 2.95Å; H25-R29 WeakPolarHBondContact O-CB 3.26Å; H25-R29 PolarHBondContact O-N 3.34Å
26	A	94.1	Very high	93.7	Very high	58 Å²	58	99.9 Å²	99.9	48%	0.479	48%	0.479	S	S	.	.	H	α-helix	trans	-60.4	-43.9	177.6	0	0	0	0	0	111.9	R22 L23 R29 R30	R22-A26 WeakPolarHBondContact O-CB 3.48Å; R22-A26 PolarHBondContact O-N 2.84Å; L23-A26 PolarHBondContact O-N 3.44Å; A26-R29 PolarHBondContact O-N 3.37Å; A26-R30 WeakPolarHBondContact O-CB 3.28Å; A26-R30 PolarHBondContact O-N 3.01Å
27	Q	94.8	Very high	93.3	Very high	117 Å²	117	97.6 Å²	97.6	55%	0.547	47%	0.47	S	S	.	.	H	α-helix	trans	-61.2	-47.8	176.2	-73	173.7	-8.8	0	0	111.8	L23 K24 H25 R29 R30 A31	L23-Q27 VanDerWaalsContact O-CG 3.32Å; L23-Q27 WeakPolarHBondContact O-CG 3.41Å; L23-Q27 PolarHBondContact O-N 3.04Å; K24-Q27 PolarHBondContact O-N 3.3Å; H25-Q27 PolarHBondContact O-N 3.47Å; Q27-R29 PolarHBondContact O-N 3.36Å; Q27-R30 PolarHBondContact O-N 2.93Å; Q27-A31 PolarHBondContact O-N 3.46Å
28	K	93.4	Very high	93	Very high	134 Å²	134	98.3 Å²	98.3	58%	0.583	48%	0.482	S	S	*	.	H	α-helix	trans	-59.5	-46.6	177.8	-176.4	-179.1	178.3	-175.7	0	111.3	K24 H25 R30 A31 Q32	K24-K28 WeakPolarHBondContact O-CB 3.44Å; K24-K28 PolarHBondContact O-N 3.45Å; H25-K28 PolarHBondContact O-N 2.95Å; K28-R30 PolarHBondContact O-N 3.25Å; K28-A31 PolarHBondContact O-N 3.47Å; K28-Q32 WeakPolarHBondContact O-CG 3.47Å; K28-Q32 PolarHBondContact O-N 3.38Å
29	R	90.8	Very high	92.5	Very high	38 Å²	38	101 Å²	101	14%	0.143	49%	0.489	C	S	.	.	H	α-helix	trans	-61.7	-44.7	177.9	-172.7	174.9	-138	127.7	14.6	111.6	E10 H25 A26 Q27 A31 Q32 Q33	E10-R29 VanDerWaalsContact CD-NH1 3.28Å; E10-R29 VanDerWaalsContact CD-NH2 3.3Å; E10-R29 IonicContact OE1-CZ 3.39Å; E10-R29 IonicContact OE1-NH1 3.47Å; E10-R29 PolarHBondContact OE1-NH1 3.38Å; E10-R29 IonicContact OE1-NH2 2.68Å; E10-R29 PolarHBondContact OE1-NH2 2.98Å; E10-R29 IonicContact OE2-CZ 3.34Å; E10-R29 IonicContact OE2-NH1 2.66Å; E10-R29 PolarHBondContact OE2-NH1 3.19Å; E10-R29 IonicContact OE2-NH2 3.45Å; E10-R29 PolarHBondContact OE2-NH2 3.28Å; H25-R29 WeakPolarHBondContact O-CB 3.26Å; H25-R29 PolarHBondContact O-N 3.34Å; A26-R29 PolarHBondContact O-N 3.37Å; Q27-R29 PolarHBondContact O-N 3.36Å; R29-A31 VanDerWaalsContact C-N 3.31Å; R29-A31 PolarHBondContact O-N 3.46Å; R29-Q32 WeakPolarHBondContact O-CB 3.43Å; R29-Q32 PolarHBondContact O-N 3.35Å; R29-Q33 WeakPolarHBondContact O-CG 3.49Å; R29-Q33 PolarHBondContact O-N 3.28Å
30	R	92.4	Very high	92	Very high	167 Å²	167	98.5 Å²	98.5	63%	0.63	48%	0.478	S	S	*	.	H	α-helix	trans	-60.2	-43.2	177.3	-175	58.8	174.7	-171.6	-0.9	111.3	A26 Q27 K28 Q32 Q33 V34	A26-R30 WeakPolarHBondContact O-CB 3.28Å; A26-R30 PolarHBondContact O-N 3.01Å; Q27-R30 PolarHBondContact O-N 2.93Å; K28-R30 PolarHBondContact O-N 3.25Å; R30-Q32 PolarHBondContact O-N 2.99Å; R30-Q33 PolarHBondContact O-N 3.03Å; R30-V34 WeakPolarHBondContact O-CG2 3.33Å; R30-V34 PolarHBondContact O-N 3.28Å
31	A	92.6	Very high	91.4	Very high	49 Å²	49	95.5 Å²	95.5	41%	0.405	46%	0.464	S	S	.	.	H	α-helix	trans	-62.2	-41.1	176.2	0	0	0	0	0	112.4	Q27 K28 R29 V34 K35	Q27-A31 PolarHBondContact O-N 3.46Å; K28-A31 PolarHBondContact O-N 3.47Å; R29-A31 VanDerWaalsContact C-N 3.31Å; R29-A31 PolarHBondContact O-N 3.46Å; A31-V34 PolarHBondContact O-N 2.94Å; A31-K35 WeakPolarHBondContact O-CG 3.39Å; A31-K35 PolarHBondContact O-N 3.05Å
32	Q	91.3	Very high	90.7	Very high	101 Å²	101	98.9 Å²	98.9	47%	0.472	48%	0.477	S	S	.	.	H	α-helix	trans	-62.6	-45.7	175.3	-72.9	174.3	-13.6	0	0	112	K28 R29 R30 V34 K35 M36	K28-Q32 WeakPolarHBondContact O-CG 3.47Å; K28-Q32 PolarHBondContact O-N 3.38Å; R29-Q32 WeakPolarHBondContact O-CB 3.43Å; R29-Q32 PolarHBondContact O-N 3.35Å; R30-Q32 PolarHBondContact O-N 2.99Å; Q32-V34 PolarHBondContact O-N 3.34Å; Q32-K35 PolarHBondContact O-N 2.89Å; Q32-M36 WeakPolarHBondContact O-CG 3.38Å; Q32-M36 PolarHBondContact O-N 3.03Å
33	Q	91.4	Very high	90.1	Very high	74 Å²	74	99.1 Å²	99.1	35%	0.346	48%	0.483	S	S	.	.	H	α-helix	trans	-60.3	-44.6	177.4	-73.6	-179.8	-8.3	0	0	112	R29 R30 K35 M36 W37	R29-Q33 WeakPolarHBondContact O-CG 3.49Å; R29-Q33 PolarHBondContact O-N 3.28Å; R30-Q33 PolarHBondContact O-N 3.03Å; Q33-K35 VanDerWaalsContact C-N 3.33Å; Q33-K35 PolarHBondContact O-N 3.26Å; Q33-M36 PolarHBondContact O-N 3.26Å; Q33-W37 VanDerWaalsContact O-CB 3.28Å; Q33-W37 WeakPolarHBondContact O-CB 3.33Å; Q33-W37 PolarHBondContact O-N 3.31Å
34	V	91.3	Very high	89.1	Confident	75 Å²	75	97.4 Å²	97.4	46%	0.455	48%	0.483	S	S	.	.	H	α-helix	trans	-62	-42.1	177.7	171.6	0	0	0	0	111	R30 A31 Q32 W37 A38	R30-V34 WeakPolarHBondContact O-CG2 3.33Å; R30-V34 PolarHBondContact O-N 3.28Å; A31-V34 PolarHBondContact O-N 2.94Å; Q32-V34 PolarHBondContact O-N 3.34Å; V34-W37 PolarHBondContact O-N 3.47Å; V34-A38 WeakPolarHBondContact O-CB 3.45Å; V34-A38 PolarHBondContact O-N 3.42Å
35	K	90	Very high	87.6	Confident	159 Å²	159	97.3 Å²	97.3	69%	0.691	49%	0.485	S	S	*	.	H	α-helix	trans	-62.5	-47.8	176	-73.1	178.1	-178.7	-174.3	0	112.3	A31 Q32 Q33 W37 A38 Q39	A31-K35 WeakPolarHBondContact O-CG 3.39Å; A31-K35 PolarHBondContact O-N 3.05Å; Q32-K35 PolarHBondContact O-N 2.89Å; Q33-K35 VanDerWaalsContact C-N 3.33Å; Q33-K35 PolarHBondContact O-N 3.26Å; K35-W37 VanDerWaalsContact C-N 3.29Å; K35-W37 PolarHBondContact O-N 3.5Å; K35-A38 PolarHBondContact O-N 2.9Å; K35-Q39 PolarHBondContact O-N 2.89Å
36	M	88.4	Confident	85.9	Confident	94 Å²	94	98.2 Å²	98.2	46%	0.463	51%	0.506	S	S	.	.	H	α-helix	trans	-63.8	-37.1	177.6	-69.5	-177.5	82.7	0	0	111.9	Q32 Q33 Q39 A40	Q32-M36 WeakPolarHBondContact O-CG 3.38Å; Q32-M36 PolarHBondContact O-N 3.03Å; Q33-M36 PolarHBondContact O-N 3.26Å; M36-Q39 PolarHBondContact O-N 3.44Å; M36-A40 WeakPolarHBondContact O-CB 3.44Å; M36-A40 PolarHBondContact O-N 2.92Å
37	W	87.3	Confident	84	Confident	166 Å²	166	101.6 Å²	101.6	63%	0.629	51%	0.51	S	S	*	.	H	α-helix	trans	-67.5	-44.7	176.7	-176.7	67.4	0	0	0	111.7	Q33 V34 K35 Q39 A40 E41	Q33-W37 VanDerWaalsContact O-CB 3.28Å; Q33-W37 WeakPolarHBondContact O-CB 3.33Å; Q33-W37 PolarHBondContact O-N 3.31Å; V34-W37 PolarHBondContact O-N 3.47Å; K35-W37 VanDerWaalsContact C-N 3.29Å; K35-W37 PolarHBondContact O-N 3.5Å; W37-Q39 VanDerWaalsContact C-N 3.27Å; W37-Q39 PolarHBondContact O-N 3.3Å; W37-A40 PolarHBondContact O-N 3.29Å; W37-E41 VanDerWaalsContact CH2-OE2 3.26Å; W37-E41 WeakPolarHBondContact CH2-OE2 3.45Å; W37-E41 HydrophobicContact CZ2-CG 4.12Å; W37-E41 PolarHBondContact O-N 2.75Å
38	A	87.6	Confident	82	Confident	54 Å²	54	105.8 Å²	105.8	45%	0.446	53%	0.526	S	S	.	.	H	α-helix	trans	-59.9	-37.5	174.2	0	0	0	0	0	112.3	V34 K35 K42	V34-A38 WeakPolarHBondContact O-CB 3.45Å; V34-A38 PolarHBondContact O-N 3.42Å; K35-A38 PolarHBondContact O-N 2.9Å; A38-K42 PolarHBondContact O-N 3.42Å; A38-K42 VanDerWaalsContact O-N 3.12Å
39	Q	85.4	Confident	79.9	Confident	114 Å²	114	101.4 Å²	101.4	53%	0.533	52%	0.519	S	S	.	.	H	α-helix	trans	-67.1	-47.4	173.3	-179.9	176	-20.4	0	0	111.8	K35 M36 W37 E41 K42 E43	K35-Q39 PolarHBondContact O-N 2.89Å; M36-Q39 PolarHBondContact O-N 3.44Å; W37-Q39 VanDerWaalsContact C-N 3.27Å; W37-Q39 PolarHBondContact O-N 3.3Å; Q39-E41 VanDerWaalsContact C-N 3.28Å; Q39-E41 PolarHBondContact O-N 2.82Å; Q39-K42 WeakPolarHBondContact O-CB 3.44Å; Q39-K42 PolarHBondContact O-N 3.43Å; Q39-K42 VanDerWaalsContact O-N 3.11Å; Q39-E43 HydrophobicContact CG-CG 4.42Å; Q39-E43 PolarHBondContact NE2-OE1 3.46Å; Q39-E43 WeakPolarHBondContact O-CG 3.29Å; Q39-E43 PolarHBondContact O-N 2.95Å
40	A	84.6	Confident	77.9	Confident	48 Å²	48	106.5 Å²	106.5	40%	0.397	56%	0.557	S	S	.	*	H	α-helix	trans	-61.2	-36.8	178	0	0	0	0	0	111.9	M36 W37 E43 A44	M36-A40 WeakPolarHBondContact O-CB 3.44Å; M36-A40 PolarHBondContact O-N 2.92Å; W37-A40 PolarHBondContact O-N 3.29Å; A40-E43 PolarHBondContact O-N 2.96Å; A40-A44 VanDerWaalsContact O-CB 3.22Å; A40-A44 WeakPolarHBondContact O-CB 3.43Å; A40-A44 PolarHBondContact O-N 3.07Å
41	E	85.4	Confident	76	Confident	81 Å²	81	101.7 Å²	101.7	38%	0.379	56%	0.56	S	S	.	*	H	α-helix	trans	-60.7	-47.5	171.3	-93	-140.9	84.9	0	0	111.7	W37 Q39 E43 A44 Q45	W37-E41 VanDerWaalsContact CH2-OE2 3.26Å; W37-E41 WeakPolarHBondContact CH2-OE2 3.45Å; W37-E41 HydrophobicContact CZ2-CG 4.12Å; W37-E41 PolarHBondContact O-N 2.75Å; Q39-E41 VanDerWaalsContact C-N 3.28Å; Q39-E41 PolarHBondContact O-N 2.82Å; E41-E43 VanDerWaalsContact C-N 3.34Å; E41-E43 PolarHBondContact O-N 2.94Å; E41-A44 PolarHBondContact O-N 3.27Å; E41-Q45 WeakPolarHBondContact O-CB 3.25Å; E41-Q45 VanDerWaalsContact O-CG 3.27Å; E41-Q45 WeakPolarHBondContact O-CG 3.49Å; E41-Q45 PolarHBondContact O-N 3.19Å
42	K	81.8	Confident	73.8	Confident	164 Å²	164	107 Å²	107	71%	0.713	58%	0.576	S	S	*	*	H	α-helix	trans	-60.5	-42.9	177.3	-176.4	-175.3	174.2	-173.3	0	111.9	A38 Q39 Q45 G46	A38-K42 PolarHBondContact O-N 3.42Å; A38-K42 VanDerWaalsContact O-N 3.12Å; Q39-K42 WeakPolarHBondContact O-CB 3.44Å; Q39-K42 PolarHBondContact O-N 3.43Å; Q39-K42 VanDerWaalsContact O-N 3.11Å; K42-Q45 PolarHBondContact O-N 3.39Å; K42-G46 PolarHBondContact O-N 3.29Å
43	E	80.8	Confident	71.8	Confident	102 Å²	102	113.4 Å²	113.4	48%	0.477	60%	0.596	S	S	.	*	H	α-helix	trans	-68.7	-39	178.1	-70.8	172.6	160.6	0	0	112.1	Q39 A40 E41 G46 K47	Q39-E43 HydrophobicContact CG-CG 4.42Å; Q39-E43 PolarHBondContact NE2-OE1 3.46Å; Q39-E43 WeakPolarHBondContact O-CG 3.29Å; Q39-E43 PolarHBondContact O-N 2.95Å; A40-E43 PolarHBondContact O-N 2.96Å; E41-E43 VanDerWaalsContact C-N 3.34Å; E41-E43 PolarHBondContact O-N 2.94Å; E43-G46 PolarHBondContact O-N 3.48Å; E43-K47 WeakPolarHBondContact O-CB 3.32Å; E43-K47 WeakPolarHBondContact O-CG 3.47Å; E43-K47 PolarHBondContact O-N 3.05Å
44	A	76.1	Confident	69.8	Low	67 Å²	67	115.9 Å²	115.9	55%	0.554	62%	0.619	S	S	*	*	H	α-helix	trans	-66.2	-37.1	175	0	0	0	0	0	112.2	A40 E41	A40-A44 VanDerWaalsContact O-CB 3.22Å; A40-A44 WeakPolarHBondContact O-CB 3.43Å; A40-A44 PolarHBondContact O-N 3.07Å; E41-A44 PolarHBondContact O-N 3.27Å
45	Q	65.1	Low	67.6	Low	139 Å²	139	123 Å²	123	65%	0.65	64%	0.637	S	S	*	*	H	α-helix	trans	-69.2	-36.4	172.7	-70.6	178.2	16.4	0	0	111.8	E41 K42	E41-Q45 WeakPolarHBondContact O-CB 3.25Å; E41-Q45 VanDerWaalsContact O-CG 3.27Å; E41-Q45 WeakPolarHBondContact O-CG 3.49Å; E41-Q45 PolarHBondContact O-N 3.19Å; K42-Q45 PolarHBondContact O-N 3.39Å
46	G	59.7	Low	65.6	Low	61 Å²	61	123.9 Å²	123.9	63%	0.629	64%	0.641	S	S	*	*	H	α-helix	trans	-73.3	-24.8	175.9	0	0	0	0	0	114.8	K42 E43 K48	K42-G46 PolarHBondContact O-N 3.29Å; E43-G46 PolarHBondContact O-N 3.48Å; G46-K48 VanDerWaalsContact C-N 3.26Å; G46-K48 PolarHBondContact O-N 3.35Å
47	K	55.1	Low	63.3	Low	129 Å²	129	127.2 Å²	127.2	56%	0.561	66%	0.656	S	S	*	*	T	Hydrogen-bonded Turn	trans	-79.6	9.7	-179.7	-87.3	174.4	175.5	-79.1	0	115.2	E43 G49	E43-K47 WeakPolarHBondContact O-CB 3.32Å; E43-K47 WeakPolarHBondContact O-CG 3.47Å; E43-K47 PolarHBondContact O-N 3.05Å; K47-G49 PolarHBondContact O-N 2.66Å
48	K	51.1	Low	61	Low	205 Å²	205	123.7 Å²	123.7	89%	0.891	66%	0.662	S	S	*	*			trans	-75.6	33.4	160.8	-72.3	-168.2	178.1	-179.6	0	112.8	G46	G46-K48 VanDerWaalsContact C-N 3.26Å; G46-K48 PolarHBondContact O-N 3.35Å
49	G	50.3	Low	58.8	Low	42 Å²	42	125.6 Å²	125.6	43%	0.433	68%	0.678	S	S	.	*	S	Bend	trans	-123.7	134.6	167.6	0	0	0	0	0	109	K47 G51	K47-G49 PolarHBondContact O-N 2.66Å; G49-G51 PolarHBondContact O-N 3.38Å; G49-G51 VanDerWaalsContact O-N 3.1Å
50	P	48.5	Very low	56.6	Low	145 Å²	145	125.2 Å²	125.2	94%	0.942	69%	0.687	S	S	*	*	S	Bend	trans	-74.2	108.3	-170	29.7	-32.1	0	0	0	110.5
51	G	53.4	Low	54.4	Low	67 Å²	67	132.3 Å²	132.3	69%	0.691	71%	0.712	S	S	*	*			trans	118.8	85.7	154.3	0	0	0	0	0	115.6	G49	G49-G51 PolarHBondContact O-N 3.38Å; G49-G51 VanDerWaalsContact O-N 3.1Å
52	E	46.2	Very low	52	Low	160 Å²	160	132.1 Å²	132.1	75%	0.748	73%	0.732	S	S	*	*			trans	-136.1	103.9	148.1	-74.9	-167.5	99.7	0	0	109.4
53	R	48.9	Very low	50.3	Low	235 Å²	235	131.2 Å²	131.2	89%	0.887	73%	0.734	S	S	*	*			trans	-61.2	141.8	170.5	-59.6	176.2	-125.1	-171.3	0.5	108.7	R55	R53-R55 PolarHBondContact O-N 3.26Å; R53-R55 VanDerWaalsContact O-N 3.1Å
54	P	49.9	Very low	48.3	Very low	127 Å²	127	134.5 Å²	134.5	83%	0.825	75%	0.754	S	S	*	*			trans	-66.2	115	169.8	26.7	-30.4	0	0	0	108.6	K56	P54-K56 PolarHBondContact O-N 3.01Å
55	R	44.5	Very low	46.8	Very low	225 Å²	225	144 Å²	144	85%	0.849	78%	0.783	S	S	*	*			trans	-60.5	99.3	173	-177.6	177.8	177.8	-152	-0.3	108.8	R53	R53-R55 PolarHBondContact O-N 3.26Å; R53-R55 VanDerWaalsContact O-N 3.1Å
56	K	46.9	Very low	45.9	Very low	177 Å²	177	144.2 Å²	144.2	77%	0.77	79%	0.789	S	S	*	*			trans	-61.8	142.5	151.9	-97.4	-174.6	173.1	-175.7	0	108.4	P54	P54-K56 PolarHBondContact O-N 3.01Å
57	E	41.4	Very low	45.2	Very low	164 Å²	164	148.6 Å²	148.6	77%	0.766	80%	0.798	S	S	*	*			trans	80.1	108.5	155.5	-66.5	168.7	-157.3	0	0	119.3
58	A	38.4	Very low	44.7	Very low	92 Å²	92	149.7 Å²	149.7	76%	0.76	81%	0.811	S	S	*	*				-169	131.2	121.5	0	0	0	0	0	106.4
59	A	40.8	Very low	44.3	Very low	94 Å²	94	146.4 Å²	146.4	78%	0.777	81%	0.806	S	S	*	*			cis	-153.1	138.5	24.5	0	0	0	0	0	111.7
60	S	38.7	Very low	43.9	Very low	105 Å²	105	152.9 Å²	152.9	73%	0.734	83%	0.83	S	S	*	*			trans	-42.7	138.9	148.2	46.7	0	0	0	0	113.7
61	Q	39.9	Very low	43.6	Very low	197 Å²	197	153.5 Å²	153.5	92%	0.921	82%	0.822	S	S	*	*				165.7	125.1	122.6	-91.6	178	-3.4	0	0	110.9
62	G	33.7	Very low	42.9	Very low	77 Å²	77	159.6 Å²	159.6	79%	0.794	83%	0.832	S	S	*	*			trans	179.9	57	178.6	0	0	0	0	0	111.9	L64	G62-L64 PolarHBondContact O-N 2.99Å
63	L	46.4	Very low	42.6	Very low	146 Å²	146	159.6 Å²	159.6	76%	0.764	84%	0.838	S	S	*	*			trans	-46.3	120.1	167.7	168.6	72.6	0	0	0	111.5
64	L	38.2	Very low	42.1	Very low	171 Å²	171	153.3 Å²	153.3	90%	0.895	83%	0.834	S	S	*	*			trans	-142.6	116.9	149.1	-75.3	176.2	0	0	0	108.8	G62	G62-L64 PolarHBondContact O-N 2.99Å
65	K	46.6	Very low	41.4	Very low	265 Å²	265	155.7 Å²	155.7	100%	1.152	84%	0.835	S	S	*	*			trans	-76.5	0	162.4	-78.4	166	170.1	167.3	0	108.9

Retrieved 65 of 65 residues in 34.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).