A0A087WX56_HUMAN Loading...

Cytochrome c oxidase assembly protein COX16 homolog, mitochondrial

AlphaFold DB , UniProt , Accession A0A087WX56, Species HUMAN (Homo sapiens, Human), Gene COX16, Length 53 aa.

						>A0A087WX56_HUMAN|A0A087WX56|COX16
MDPELEKKLKENKISLESEYEKIKDSKFDDWKNIRGPRPWEDPDLLQGRNPES
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	60.7	Low	76	Confident	175 Å²	175	117 Å²	117	86%	0.862	57%	0.573	S	S	*	*				0	134.7	0	-75.9	-65.6	-69	0	0	107	L5 E6	M1-L5 HydrophobicContact CE-CD2 3.97Å; M1-E6 HydrophobicContact CB-CG 4.43Å; M1-E6 WeakPolarHBondContact CB-OE1 3.41Å
2	D	81.5	Confident	75.2	Confident	95 Å²	95	116.2 Å²	116.2	51%	0.508	57%	0.573	S	S	.	*			trans	-65.7	125.9	-177.9	-167.1	-36.2	0	0	0	110	E4 L5 E6	D2-E4 PolarHBondContact O-N 2.99Å; D2-E4 WeakPolarHBondContact OD1-CB 3.47Å; D2-E4 PolarHBondContact OD1-N 3.49Å; D2-L5 HydrophobicContact CB-CB 3.99Å; D2-L5 WeakPolarHBondContact O-CB 3.46Å; D2-L5 PolarHBondContact O-N 3.38Å; D2-E6 PolarHBondContact O-N 3.21Å
3	P	83.2	Confident	74.9	Confident	104 Å²	104	121.6 Å²	121.6	68%	0.675	59%	0.592	S	S	*	*	H	α-helix	trans	-55.4	-30.5	178.3	-24.1	32.7	0	0	0	113.5	K7	P3-K7 PolarHBondContact O-N 2.86Å
4	E	80.8	Confident	75.1	Confident	113 Å²	113	121.1 Å²	121.1	53%	0.528	59%	0.591	S	S	.	*	H	α-helix	trans	-72.9	-35.6	179	-159.6	-174.1	140	0	0	111.8	D2 K7 K8	D2-E4 PolarHBondContact O-N 2.99Å; D2-E4 WeakPolarHBondContact OD1-CB 3.47Å; D2-E4 PolarHBondContact OD1-N 3.49Å; E4-K7 PolarHBondContact O-N 3.15Å; E4-K8 PolarHBondContact O-N 3.28Å; E4-K8 VanDerWaalsContact O-N 3.1Å; E4-K8 IonicContact OE1-NZ 3.97Å; E4-K8 PolarHBondContact OE1-NZ 2.95Å
5	L	78.5	Confident	75.9	Confident	87 Å²	87	116.1 Å²	116.1	46%	0.455	57%	0.573	S	S	.	*	H	α-helix	trans	-68.2	-41.1	177.1	-174.7	62.1	0	0	0	111.2	M1 D2 K7 K8 L9	M1-L5 HydrophobicContact CE-CD2 3.97Å; D2-L5 HydrophobicContact CB-CB 3.99Å; D2-L5 WeakPolarHBondContact O-CB 3.46Å; D2-L5 PolarHBondContact O-N 3.38Å; L5-K7 VanDerWaalsContact C-N 3.34Å; L5-K7 PolarHBondContact O-N 2.64Å; L5-K8 PolarHBondContact O-N 2.89Å; L5-L9 WeakPolarHBondContact O-CB 3.42Å; L5-L9 PolarHBondContact O-N 3.06Å
6	E	79.1	Confident	76.4	Confident	83 Å²	83	118.1 Å²	118.1	39%	0.388	59%	0.586	S	S	.	*	H	α-helix	trans	-64.5	-38	176	-70.5	-171.4	-169.7	0	0	112.7	M1 D2 L9 K10	M1-E6 HydrophobicContact CB-CG 4.43Å; M1-E6 WeakPolarHBondContact CB-OE1 3.41Å; D2-E6 PolarHBondContact O-N 3.21Å; E6-L9 PolarHBondContact O-N 3.22Å; E6-K10 WeakPolarHBondContact O-CB 3.43Å; E6-K10 VanDerWaalsContact O-CG 3.31Å; E6-K10 WeakPolarHBondContact O-CG 3.38Å; E6-K10 PolarHBondContact O-N 2.93Å; E6-K10 IonicContact OE2-NZ 2.66Å
7	K	78.8	Confident	77.1	Confident	126 Å²	126	118.8 Å²	118.8	55%	0.548	59%	0.587	S	S	.	*	H	α-helix	trans	-64.4	-48.5	176.5	-178.8	178.5	168.3	-175.4	0	111.1	P3 E4 L5 L9 K10 E11	P3-K7 PolarHBondContact O-N 2.86Å; E4-K7 PolarHBondContact O-N 3.15Å; L5-K7 VanDerWaalsContact C-N 3.34Å; L5-K7 PolarHBondContact O-N 2.64Å; K7-L9 VanDerWaalsContact C-N 3.27Å; K7-L9 PolarHBondContact O-N 3.47Å; K7-K10 PolarHBondContact O-N 3.21Å; K7-E11 WeakPolarHBondContact CE-OE1 3.38Å; K7-E11 HydrophobicContact CG-CG 4.45Å; K7-E11 WeakPolarHBondContact CG-OE1 3.21Å; K7-E11 IonicContact NZ-OE1 2.74Å; K7-E11 WeakPolarHBondContact O-CB 3.16Å; K7-E11 VanDerWaalsContact O-CG 3.29Å; K7-E11 WeakPolarHBondContact O-CG 3.3Å; K7-E11 PolarHBondContact O-N 3.39Å
8	K	73.6	Confident	77.8	Confident	104 Å²	104	114.8 Å²	114.8	45%	0.452	57%	0.572	S	S	.	*	H	α-helix	trans	-60	-35.5	176.2	-77.4	169.7	170.5	160	0	112.7	E4 L5 N12	E4-K8 PolarHBondContact O-N 3.28Å; E4-K8 VanDerWaalsContact O-N 3.1Å; E4-K8 IonicContact OE1-NZ 3.97Å; E4-K8 PolarHBondContact OE1-NZ 2.95Å; L5-K8 PolarHBondContact O-N 2.89Å; K8-N12 WeakPolarHBondContact O-CB 3.2Å; K8-N12 PolarHBondContact O-N 3.4Å; K8-N12 VanDerWaalsContact O-N 3.07Å; K8-N12 PolarHBondContact O-ND2 3.14Å
9	L	74.1	Confident	78.4	Confident	124 Å²	124	112.5 Å²	112.5	65%	0.649	56%	0.56	S	S	*	*	H	α-helix	trans	-72.4	-37.2	177.5	-132.6	114	0	0	0	112.7	L5 E6 K7 N12	L5-L9 WeakPolarHBondContact O-CB 3.42Å; L5-L9 PolarHBondContact O-N 3.06Å; E6-L9 PolarHBondContact O-N 3.22Å; K7-L9 VanDerWaalsContact C-N 3.27Å; K7-L9 PolarHBondContact O-N 3.47Å; L9-N12 CarbonylContact O-C 3.52Å
10	K	72.1	Confident	79	Confident	154 Å²	154	114.1 Å²	114.1	67%	0.67	56%	0.56	S	S	*	*	H	α-helix	trans	-71	-36.4	175.6	-74.7	171	-176.3	168.1	0	112	E6 K7	E6-K10 WeakPolarHBondContact O-CB 3.43Å; E6-K10 VanDerWaalsContact O-CG 3.31Å; E6-K10 WeakPolarHBondContact O-CG 3.38Å; E6-K10 PolarHBondContact O-N 2.93Å; E6-K10 IonicContact OE2-NZ 2.66Å; K7-K10 PolarHBondContact O-N 3.21Å
11	E	73.5	Confident	79.6	Confident	122 Å²	122	113.4 Å²	113.4	57%	0.57	56%	0.556	S	S	*	*	H	α-helix	trans	-69.6	-37.8	176.4	-73.5	171	175.5	0	0	112	K7	K7-E11 WeakPolarHBondContact CE-OE1 3.38Å; K7-E11 HydrophobicContact CG-CG 4.45Å; K7-E11 WeakPolarHBondContact CG-OE1 3.21Å; K7-E11 IonicContact NZ-OE1 2.74Å; K7-E11 WeakPolarHBondContact O-CB 3.16Å; K7-E11 VanDerWaalsContact O-CG 3.29Å; K7-E11 WeakPolarHBondContact O-CG 3.3Å; K7-E11 PolarHBondContact O-N 3.39Å
12	N	67	Low	81	Confident	107 Å²	107	111.6 Å²	111.6	57%	0.572	54%	0.543	S	S	*	.	T	Hydrogen-bonded Turn	trans	-102.7	49.1	179.1	-59.6	-67.7	0	0	0	111.8	K8 L9 I14	K8-N12 WeakPolarHBondContact O-CB 3.2Å; K8-N12 PolarHBondContact O-N 3.4Å; K8-N12 VanDerWaalsContact O-N 3.07Å; K8-N12 PolarHBondContact O-ND2 3.14Å; L9-N12 CarbonylContact O-C 3.52Å; N12-I14 PolarHBondContact O-N 3.49Å
13	K	70.6	Confident	81.4	Confident	187 Å²	187	111 Å²	111	81%	0.813	54%	0.539	S	S	*	.			trans	-74.7	67.1	174.5	-163.9	-179.2	-178.4	-179.2	0	110.3
14	I	78.6	Confident	81.6	Confident	115 Å²	115	110.6 Å²	110.6	59%	0.59	53%	0.527	S	S	*	.			trans	-83.1	118.5	171.6	-60.6	171.9	0	0	0	106.3	N12 E19	N12-I14 PolarHBondContact O-N 3.49Å; I14-E19 HydrophobicContact CG2-CG 3.42Å; I14-E19 VanDerWaalsContact CG2-CG 3.42Å; I14-E19 WeakPolarHBondContact CG2-OE1 3.32Å
15	S	85.8	Confident	81.9	Confident	45 Å²	45	111.7 Å²	111.7	32%	0.315	54%	0.536	S	S	.	.			trans	-101.4	150.9	172.9	100.2	0	0	0	0	110.1	E17 S18 E19	S15-E17 WeakPolarHBondContact CB-OE2 3.48Å; S15-E17 PolarHBondContact O-N 3.14Å; S15-E17 PolarHBondContact OG-N 3.12Å; S15-E17 PolarHBondContact OG-OE2 3.02Å; S15-S18 PolarHBondContact N-OG 2.78Å; S15-S18 VanDerWaalsContact N-OG 3.14Å; S15-S18 PolarHBondContact O-N 3.12Å; S15-S18 VanDerWaalsContact O-N 3.12Å; S15-S18 PolarHBondContact O-OG 2.66Å; S15-S18 PolarHBondContact OG-N 3.26Å; S15-S18 VanDerWaalsContact OG-N 3.12Å; S15-E19 PolarHBondContact O-N 3.07Å; S15-E19 VanDerWaalsContact O-N 3.14Å
16	L	84.7	Confident	82.4	Confident	149 Å²	149	110.1 Å²	110.1	78%	0.78	53%	0.533	S	S	*	.	H	α-helix	trans	-57.8	-40.9	178.3	-69.9	173.7	0	0	0	111.4	S18 E19 Y20	L16-S18 PolarHBondContact O-N 2.7Å; L16-E19 PolarHBondContact O-N 2.91Å; L16-Y20 VanDerWaalsContact O-CB 3.32Å; L16-Y20 WeakPolarHBondContact O-CB 3.14Å; L16-Y20 PolarHBondContact O-N 2.95Å
17	E	88.1	Confident	82.4	Confident	130 Å²	130	114 Å²	114	61%	0.607	55%	0.548	S	S	*	.	H	α-helix	trans	-63.4	-41.5	177.8	-57.1	72.1	-157.8	0	0	111	S15 E19 Y20 E21	S15-E17 WeakPolarHBondContact CB-OE2 3.48Å; S15-E17 PolarHBondContact O-N 3.14Å; S15-E17 PolarHBondContact OG-N 3.12Å; S15-E17 PolarHBondContact OG-OE2 3.02Å; E17-E19 PolarHBondContact O-N 3.12Å; E17-Y20 PolarHBondContact O-N 3.43Å; E17-E21 VanDerWaalsContact O-CG 3.3Å; E17-E21 WeakPolarHBondContact O-CG 3.45Å; E17-E21 PolarHBondContact O-N 3.33Å
18	S	89.5	Confident	82.7	Confident	46 Å²	46	113.1 Å²	113.1	32%	0.322	55%	0.545	S	S	.	.	H	α-helix	trans	-67.2	-35.3	179.4	72.4	0	0	0	0	113.4	S15 L16 K22	S15-S18 PolarHBondContact N-OG 2.78Å; S15-S18 VanDerWaalsContact N-OG 3.14Å; S15-S18 PolarHBondContact O-N 3.12Å; S15-S18 VanDerWaalsContact O-N 3.12Å; S15-S18 PolarHBondContact O-OG 2.66Å; S15-S18 PolarHBondContact OG-N 3.26Å; S15-S18 VanDerWaalsContact OG-N 3.12Å; L16-S18 PolarHBondContact O-N 2.7Å; S18-K22 WeakPolarHBondContact O-CG 3.47Å
19	E	90.3	Very high	83.2	Confident	72 Å²	72	115.1 Å²	115.1	34%	0.336	56%	0.56	S	S	.	*	H	α-helix	trans	-75.7	-37.7	174.7	-69.8	-58	140.4	0	0	111.5	I14 S15 L16 E17 E21 K22 I23	I14-E19 HydrophobicContact CG2-CG 3.42Å; I14-E19 VanDerWaalsContact CG2-CG 3.42Å; I14-E19 WeakPolarHBondContact CG2-OE1 3.32Å; S15-E19 PolarHBondContact O-N 3.07Å; S15-E19 VanDerWaalsContact O-N 3.14Å; L16-E19 PolarHBondContact O-N 2.91Å; E17-E19 PolarHBondContact O-N 3.12Å; E19-E21 PolarHBondContact O-N 3.04Å; E19-K22 WeakPolarHBondContact O-CB 3.41Å; E19-K22 PolarHBondContact O-N 3.19Å; E19-K22 IonicContact OE1-NZ 2.64Å; E19-K22 PolarHBondContact OE1-NZ 3.17Å; E19-K22 IonicContact OE2-NZ 3.96Å; E19-I23 PolarHBondContact O-N 3Å
20	Y	89.1	Confident	83.6	Confident	143 Å²	143	114.8 Å²	114.8	56%	0.561	56%	0.559	S	S	*	*	H	α-helix	trans	-58.5	-47.1	174.8	177.7	-99.3	0	0	0	111.6	L16 E17 K22 I23 K24	L16-Y20 VanDerWaalsContact O-CB 3.32Å; L16-Y20 WeakPolarHBondContact O-CB 3.14Å; L16-Y20 PolarHBondContact O-N 2.95Å; E17-Y20 PolarHBondContact O-N 3.43Å; Y20-K22 PolarHBondContact O-N 3.32Å; Y20-I23 WeakPolarHBondContact O-CG1 3.31Å; Y20-I23 PolarHBondContact O-N 3.43Å; Y20-K24 HydrophobicContact CE1-CB 4.17Å; Y20-K24 WeakPolarHBondContact O-CB 3.43Å; Y20-K24 PolarHBondContact O-N 3.17Å
21	E	91.4	Very high	84.2	Confident	101 Å²	101	116.7 Å²	116.7	47%	0.472	56%	0.562	S	S	.	*	H	α-helix	trans	-60.5	-28.9	178.6	-74.3	-69.1	139.1	0	0	113.5	E17 E19 K24	E17-E21 VanDerWaalsContact O-CG 3.3Å; E17-E21 WeakPolarHBondContact O-CG 3.45Å; E17-E21 PolarHBondContact O-N 3.33Å; E19-E21 PolarHBondContact O-N 3.04Å; E21-K24 WeakPolarHBondContact O-CG 3.42Å; E21-K24 IonicContact OE1-NZ 3.57Å; E21-K24 WeakPolarHBondContact OE2-CD 3.44Å; E21-K24 WeakPolarHBondContact OE2-CE 3.44Å; E21-K24 IonicContact OE2-NZ 3.89Å; E21-K24 PolarHBondContact OE2-NZ 2.86Å
22	K	90.3	Very high	84.6	Confident	136 Å²	136	119 Å²	119	59%	0.591	57%	0.57	S	S	*	*	H	α-helix	trans	-71.6	-33.1	175.7	-66.5	170	-169.2	174.8	0	112.5	S18 E19 Y20	S18-K22 WeakPolarHBondContact O-CG 3.47Å; E19-K22 WeakPolarHBondContact O-CB 3.41Å; E19-K22 PolarHBondContact O-N 3.19Å; E19-K22 IonicContact OE1-NZ 2.64Å; E19-K22 PolarHBondContact OE1-NZ 3.17Å; E19-K22 IonicContact OE2-NZ 3.96Å; Y20-K22 PolarHBondContact O-N 3.32Å
23	I	89.6	Confident	85.1	Confident	84 Å²	84	119.2 Å²	119.2	43%	0.431	57%	0.572	S	S	.	*	H	α-helix	trans	-102.4	-13.2	-173	68.7	170.2	0	0	0	113.4	E19 Y20 D25 S26 F28	E19-I23 PolarHBondContact O-N 3Å; Y20-I23 WeakPolarHBondContact O-CG1 3.31Å; Y20-I23 PolarHBondContact O-N 3.43Å; I23-D25 PolarHBondContact O-N 3.48Å; I23-D25 VanDerWaalsContact O-N 3.15Å; I23-S26 WeakPolarHBondContact O-CB 3.46Å; I23-S26 PolarHBondContact O-N 3.45Å; I23-S26 PolarHBondContact O-OG 3.05Å; I23-F28 HydrophobicContact CB-CZ 4.21Å; I23-F28 WeakPolarHBondContact O-CE2 3.35Å
24	K	88.6	Confident	85.5	Confident	94 Å²	94	117.1 Å²	117.1	41%	0.409	57%	0.568	S	S	.	*	T	Hydrogen-bonded Turn	trans	-55.6	-35	-175.1	74.1	179.5	-177.8	178.4	0	113.6	Y20 E21	Y20-K24 HydrophobicContact CE1-CB 4.17Å; Y20-K24 WeakPolarHBondContact O-CB 3.43Å; Y20-K24 PolarHBondContact O-N 3.17Å; E21-K24 WeakPolarHBondContact O-CG 3.42Å; E21-K24 IonicContact OE1-NZ 3.57Å; E21-K24 WeakPolarHBondContact OE2-CD 3.44Å; E21-K24 WeakPolarHBondContact OE2-CE 3.44Å; E21-K24 IonicContact OE2-NZ 3.89Å; E21-K24 PolarHBondContact OE2-NZ 2.86Å
25	D	87.6	Confident	85.5	Confident	136 Å²	136	116.2 Å²	116.2	73%	0.727	56%	0.557	S	S	*	*	T	Hydrogen-bonded Turn	trans	-98.3	5.9	-178.2	-60.5	-42.8	0	0	0	112.2	I23	I23-D25 PolarHBondContact O-N 3.48Å; I23-D25 VanDerWaalsContact O-N 3.15Å
26	S	87.4	Confident	85.2	Confident	55 Å²	55	116.6 Å²	116.6	39%	0.385	57%	0.568	S	S	.	*	S	Bend	trans	-70.4	136.1	176.3	-63.7	0	0	0	0	110.6	I23 F28	I23-S26 WeakPolarHBondContact O-CB 3.46Å; I23-S26 PolarHBondContact O-N 3.45Å; I23-S26 PolarHBondContact O-OG 3.05Å; S26-F28 WeakPolarHBondContact O-CD2 3.29Å; S26-F28 WeakPolarHBondContact O-CE2 2.83Å; S26-F28 PolarHBondContact O-N 3.1Å
27	K	80.8	Confident	85	Confident	164 Å²	164	112.9 Å²	112.9	71%	0.713	55%	0.553	S	S	*	*			trans	-74.4	106.4	171.5	-90.4	-157.8	169.9	-162.9	0	110.5
28	F	84.3	Confident	84.8	Confident	108 Å²	108	113 Å²	113	47%	0.474	55%	0.548	S	S	.	.			trans	-93.6	-10.2	174	-61.8	-73.5	0	0	0	113.5	I23 S26 D30 W31	I23-F28 HydrophobicContact CB-CZ 4.21Å; I23-F28 WeakPolarHBondContact O-CE2 3.35Å; S26-F28 WeakPolarHBondContact O-CD2 3.29Å; S26-F28 WeakPolarHBondContact O-CE2 2.83Å; S26-F28 PolarHBondContact O-N 3.1Å; F28-D30 PolarHBondContact O-N 3.45Å; F28-W31 HydrophobicContact CD1-CE3 4.42Å; F28-W31 WeakPolarHBondContact O-CB 3.46Å; F28-W31 PolarHBondContact O-N 2.81Å
29	D	84.6	Confident	84.6	Confident	146 Å²	146	116.9 Å²	116.9	78%	0.781	57%	0.572	S	S	*	*	T	Hydrogen-bonded Turn	trans	-61.9	-31	-178.9	-59.5	-38.5	0	0	0	112.6	W31	D29-W31 VanDerWaalsContact C-N 3.33Å
30	D	82.9	Confident	84.4	Confident	117 Å²	117	122.6 Å²	122.6	63%	0.626	59%	0.59	S	S	*	*	T	Hydrogen-bonded Turn	trans	-91.9	7.9	178.8	-62	-48.6	0	0	0	112.7	F28 K32	F28-D30 PolarHBondContact O-N 3.45Å; D30-K32 PolarHBondContact O-N 3.23Å; D30-K32 VanDerWaalsContact O-N 3.12Å
31	W	84.6	Confident	84.1	Confident	194 Å²	194	118.1 Å²	118.1	74%	0.735	58%	0.575	S	S	*	*			trans	-65.1	115	-178.2	-177.3	-81	0	0	0	110.8	F28 D29	F28-W31 HydrophobicContact CD1-CE3 4.42Å; F28-W31 WeakPolarHBondContact O-CB 3.46Å; F28-W31 PolarHBondContact O-N 2.81Å; D29-W31 VanDerWaalsContact C-N 3.33Å
32	K	81.2	Confident	83.3	Confident	170 Å²	170	117.1 Å²	117.1	74%	0.739	57%	0.572	S	S	*	*			trans	-97.6	121.1	173	-66.2	-175.5	-179.3	178.9	0	109.4	D30 I34	D30-K32 PolarHBondContact O-N 3.23Å; D30-K32 VanDerWaalsContact O-N 3.12Å; K32-I34 VanDerWaalsContact C-N 3.3Å; K32-I34 HydrophobicContact CB-CG1 4.22Å; K32-I34 PolarHBondContact O-N 2.75Å
33	N	78.5	Confident	82.5	Confident	112 Å²	112	114.8 Å²	114.8	60%	0.599	57%	0.571	S	S	*	*			trans	-74.9	86.3	170.2	-176.3	-14.5	0	0	0	108.9	Q47	N33-Q47 PolarHBondContact O-NE2 2.91Å; N33-Q47 PolarHBondContact O-OE1 2.96Å
34	I	77.1	Confident	81.5	Confident	143 Å²	143	115.2 Å²	115.2	73%	0.733	57%	0.574	S	S	*	*			trans	-78.8	120	176.9	-57.1	177.6	0	0	0	108.3	K32	K32-I34 VanDerWaalsContact C-N 3.3Å; K32-I34 HydrophobicContact CB-CG1 4.22Å; K32-I34 PolarHBondContact O-N 2.75Å
35	R	79.2	Confident	80.3	Confident	95 Å²	95	117.3 Å²	117.3	36%	0.358	59%	0.589	S	S	.	*			trans	-124.3	140.8	171.7	73	-175.1	-164.4	104.5	-10.3	110.8	E41 Q47	R35-E41 IonicContact CZ-OE1 3.28Å; R35-E41 VanDerWaalsContact CZ-OE1 3.28Å; R35-E41 IonicContact CZ-OE2 3.29Å; R35-E41 VanDerWaalsContact CZ-OE2 3.29Å; R35-E41 VanDerWaalsContact NH1-CD 3.31Å; R35-E41 IonicContact NH1-OE1 2.99Å; R35-E41 PolarHBondContact NH1-OE1 3.24Å; R35-E41 IonicContact NH1-OE2 2.78Å; R35-E41 PolarHBondContact NH1-OE2 2.78Å; R35-E41 IonicContact NH2-OE1 2.67Å; R35-E41 PolarHBondContact NH2-OE1 2.86Å; R35-E41 IonicContact NH2-OE2 3.24Å; R35-E41 PolarHBondContact NH2-OE2 2.67Å; R35-Q47 VanDerWaalsContact N-OE1 3.13Å
36	G	78.8	Confident	79.2	Confident	53 Å²	53	112.6 Å²	112.6	55%	0.546	56%	0.564	S	S	.	*	P	Polyproline II helix	trans	-67.8	161.8	168.6	0	0	0	0	0	111.8	R38	G36-R38 PolarHBondContact O-N 3Å
37	P	82.1	Confident	78.1	Confident	71 Å²	71	115.2 Å²	115.2	46%	0.461	57%	0.57	S	S	.	*	P	Polyproline II helix	trans	-60.3	132.8	172	25.5	-32.4	0	0	0	111.2	E41 P43 L46	P37-E41 HydrophobicContact CB-CB 4.49Å; P37-P43 HydrophobicContact CG-CB 4.41Å; P37-L46 HydrophobicContact CB-CD1 3.72Å
38	R	83.4	Confident	77	Confident	133 Å²	133	111.3 Å²	111.3	50%	0.502	58%	0.577	S	S	.	*	P	Polyproline II helix	trans	-62.6	157.3	160.7	-60	-65.5	-176.6	124.4	2.8	108.8	G36 W40 E41	G36-R38 PolarHBondContact O-N 3Å; R38-W40 HydrophobicContact CB-CD2 3.97Å; R38-W40 HydrophobicContact CB-CE3 4.4Å; R38-W40 HydrophobicContact CB-CG 4.42Å; R38-W40 HydrophobicContact CB-CH2 4.39Å; R38-W40 HydrophobicContact CB-CZ2 3.93Å; R38-W40 HydrophobicContact CG-CZ2 4Å; R38-W40 PolarHBondContact O-N 3.45Å; R38-E41 HydrophobicContact CB-CB 4.16Å; R38-E41 VanDerWaalsContact CB-CD 3.46Å; R38-E41 HydrophobicContact CB-CG 3.76Å; R38-E41 WeakPolarHBondContact CB-OE2 3.34Å; R38-E41 HydrophobicContact CG-CG 4.15Å; R38-E41 WeakPolarHBondContact CG-OE1 3.22Å; R38-E41 WeakPolarHBondContact CG-OE2 3.1Å; R38-E41 PolarHBondContact N-OE2 2.99Å; R38-E41 PolarHBondContact O-N 2.74Å
39	P	85.9	Confident	75.6	Confident	127 Å²	127	114.7 Å²	114.7	83%	0.825	59%	0.586	S	S	*	*	T	Hydrogen-bonded Turn	trans	-58.1	-17.9	178.9	-26.3	35.3	0	0	0	115.2
40	W	85.6	Confident	74.3	Confident	193 Å²	193	112.6 Å²	112.6	73%	0.731	58%	0.575	S	S	*	*	T	Hydrogen-bonded Turn	trans	-111	6.3	177.9	58.2	82	0	0	0	113.3	R38	R38-W40 HydrophobicContact CB-CD2 3.97Å; R38-W40 HydrophobicContact CB-CE3 4.4Å; R38-W40 HydrophobicContact CB-CG 4.42Å; R38-W40 HydrophobicContact CB-CH2 4.39Å; R38-W40 HydrophobicContact CB-CZ2 3.93Å; R38-W40 HydrophobicContact CG-CZ2 4Å; R38-W40 PolarHBondContact O-N 3.45Å
41	E	82.3	Confident	73	Confident	49 Å²	49	112.6 Å²	112.6	23%	0.229	58%	0.582	C	S	.	*	S	Bend	trans	-99.7	145.2	175.9	-73	168.5	171	0	0	110	R35 P37 R38 P43 L46	R35-E41 IonicContact CZ-OE1 3.28Å; R35-E41 VanDerWaalsContact CZ-OE1 3.28Å; R35-E41 IonicContact CZ-OE2 3.29Å; R35-E41 VanDerWaalsContact CZ-OE2 3.29Å; R35-E41 VanDerWaalsContact NH1-CD 3.31Å; R35-E41 IonicContact NH1-OE1 2.99Å; R35-E41 PolarHBondContact NH1-OE1 3.24Å; R35-E41 IonicContact NH1-OE2 2.78Å; R35-E41 PolarHBondContact NH1-OE2 2.78Å; R35-E41 IonicContact NH2-OE1 2.67Å; R35-E41 PolarHBondContact NH2-OE1 2.86Å; R35-E41 IonicContact NH2-OE2 3.24Å; R35-E41 PolarHBondContact NH2-OE2 2.67Å; P37-E41 HydrophobicContact CB-CB 4.49Å; R38-E41 HydrophobicContact CB-CB 4.16Å; R38-E41 VanDerWaalsContact CB-CD 3.46Å; R38-E41 HydrophobicContact CB-CG 3.76Å; R38-E41 WeakPolarHBondContact CB-OE2 3.34Å; R38-E41 HydrophobicContact CG-CG 4.15Å; R38-E41 WeakPolarHBondContact CG-OE1 3.22Å; R38-E41 WeakPolarHBondContact CG-OE2 3.1Å; R38-E41 PolarHBondContact N-OE2 2.99Å; R38-E41 PolarHBondContact O-N 2.74Å; E41-P43 WeakPolarHBondContact O-CD 3.39Å; E41-L46 HydrophobicContact CB-CD1 3.71Å; E41-L46 HydrophobicContact CG-CD1 4.37Å; E41-L46 VanDerWaalsContact OE2-CD1 3.22Å; E41-L46 WeakPolarHBondContact OE2-CD1 3.38Å
42	D	75.4	Confident	71.7	Confident	79 Å²	79	111.7 Å²	111.7	42%	0.422	59%	0.586	S	S	.	*			trans	-68.9	122.1	175.3	-169.3	-29.8	0	0	0	109.8	D44 L45	D42-D44 PolarHBondContact O-N 3.2Å; D42-D44 PolarHBondContact OD1-N 3.44Å; D42-L45 HydrophobicContact CB-CB 4.09Å; D42-L45 HydrophobicContact CB-CD1 3.74Å; D42-L45 HydrophobicContact CB-CG 3.76Å; D42-L45 PolarHBondContact O-N 3.39Å
43	P	72.6	Confident	70.2	Confident	88 Å²	88	111.3 Å²	111.3	57%	0.571	60%	0.604	S	S	*	*	G	3₁₀ helix	trans	-57.9	-30.5	177.6	-21.7	32.4	0	0	0	113.7	P37 E41 L45	P37-P43 HydrophobicContact CG-CB 4.41Å; E41-P43 WeakPolarHBondContact O-CD 3.39Å; P43-L45 VanDerWaalsContact C-N 3.35Å
44	D	68	Low	69.8	Low	92 Å²	92	111.3 Å²	111.3	49%	0.492	60%	0.604	S	S	.	*	G	3₁₀ helix	trans	-83	-13.7	-176.7	-69.6	-36.8	0	0	0	112.6	D42 R49	D42-D44 PolarHBondContact O-N 3.2Å; D42-D44 PolarHBondContact OD1-N 3.44Å; D44-R49 IonicContact OD1-NH1 3.22Å; D44-R49 PolarHBondContact OD1-NH1 2.97Å
45	L	64.8	Low	69.4	Low	138 Å²	138	109.6 Å²	109.6	72%	0.723	60%	0.597	S	S	*	*	G	3₁₀ helix	trans	-91.3	-4	177.2	-62.9	-177.8	0	0	0	113.5	D42 P43	D42-L45 HydrophobicContact CB-CB 4.09Å; D42-L45 HydrophobicContact CB-CD1 3.74Å; D42-L45 HydrophobicContact CB-CG 3.76Å; D42-L45 PolarHBondContact O-N 3.39Å; P43-L45 VanDerWaalsContact C-N 3.35Å
46	L	64.6	Low	68.9	Low	37 Å²	37	110.4 Å²	110.4	19%	0.194	61%	0.611	C	S	.	*	S	Bend	trans	-107.9	107.8	-174.3	-72.1	169.8	0	0	0	113.1	P37 E41	P37-L46 HydrophobicContact CB-CD1 3.72Å; E41-L46 HydrophobicContact CB-CD1 3.71Å; E41-L46 HydrophobicContact CG-CD1 4.37Å; E41-L46 VanDerWaalsContact OE2-CD1 3.22Å; E41-L46 WeakPolarHBondContact OE2-CD1 3.38Å
47	Q	63.9	Low	68.3	Low	110 Å²	110	113.8 Å²	113.8	51%	0.514	61%	0.614	S	S	.	*	S	Bend	trans	46.6	85.4	159.9	-71.4	-178.3	-39.4	0	0	116.9	N33 R35	N33-Q47 PolarHBondContact O-NE2 2.91Å; N33-Q47 PolarHBondContact O-OE1 2.96Å; R35-Q47 VanDerWaalsContact N-OE1 3.13Å
48	G	56.9	Low	67.5	Low	83 Å²	83	116.4 Å²	116.4	86%	0.856	62%	0.624	S	S	*	*	S	Bend	trans	113.3	-6.2	147.9	0	0	0	0	0	115.6	N50	G48-N50 PolarHBondContact O-N 2.9Å
49	R	55.3	Low	66.4	Low	178 Å²	178	115.3 Å²	115.3	67%	0.672	63%	0.632	S	S	*	*			trans	-83.4	112.1	168	-163.3	172.2	-177.5	-170.3	1.7	108.3	D44 P51	D44-R49 IonicContact OD1-NH1 3.22Å; D44-R49 PolarHBondContact OD1-NH1 2.97Å; R49-P51 WeakPolarHBondContact O-CD 3.41Å
50	N	56.8	Low	65	Low	102 Å²	102	114.5 Å²	114.5	55%	0.545	62%	0.618	S	S	.	*			trans	-65.7	121.3	168.3	-156.4	2.8	0	0	0	106.4	G48 E52 S53	G48-N50 PolarHBondContact O-N 2.9Å; N50-E52 PolarHBondContact O-N 3.26Å; N50-S53 PolarHBondContact O-N 3.22Å
51	P	56	Low	63.4	Low	118 Å²	118	108.5 Å²	108.5	77%	0.766	61%	0.61	S	S	*	*	T	Hydrogen-bonded Turn	trans	-64.3	-4.6	-179.1	24.7	-32.9	0	0	0	113.2	R49	R49-P51 WeakPolarHBondContact O-CD 3.41Å
52	E	57.5	Low	61.8	Low	175 Å²	175	113.4 Å²	113.4	82%	0.818	64%	0.642	S	S	*	*	T	Hydrogen-bonded Turn	trans	-110.6	23.9	-178	-56.9	-164.8	146.6	0	0	114.7	N50	N50-E52 PolarHBondContact O-N 3.26Å
53	S	50.2	Low	60.6	Low	161 Å²	161	116.5 Å²	116.5	100%	1.126	66%	0.661	S	S	*	*			trans	-106.9	0	175.3	-64.9	0	0	0	0	114.1	N50	N50-S53 PolarHBondContact O-N 3.22Å

Retrieved 53 of 53 residues in 70 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).