A0A087WX72_HUMAN Loading...

Caspase 9

AlphaFold DB , UniProt , Accession A0A087WX72, Species HUMAN (Homo sapiens, Human), Gene CASP9, Length 47 aa.

						>A0A087WX72_HUMAN|A0A087WX72|CASP9
MLASFLRTNRQAAKLSKPTLENLTPVVLRPEIRKPEVLRPETPRPVD
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	87.6	Confident	92.2	Very high	212 Å²	212	121.6 Å²	121.6	100%	1.044	61%	0.611	S	S	*	*				0	-54.9	0	-160.9	170.1	167.5	0	0	112.3	A3 S4 F5	M1-A3 PolarHBondContact O-N 3.43Å; M1-S4 PolarHBondContact O-N 3.36Å; M1-F5 VanDerWaalsContact O-N 3.14Å; M1-F5 PolarHBondContact O-N 3.29Å
2	L	94.6	Very high	91.7	Very high	124 Å²	124	116.3 Å²	116.3	65%	0.649	60%	0.599	S	S	*	*	H	α-helix	trans	-60.7	-45.4	-178.6	-173.6	64.7	0	0	0	114.4	S4 F5 L6	L2-S4 PolarHBondContact O-N 3.47Å; L2-S4 VanDerWaalsContact C-N 3.3Å; L2-F5 WeakPolarHBondContact O-CB 3.26Å; L2-F5 PolarHBondContact O-N 3.38Å; L2-F5 VanDerWaalsContact O-N 3.14Å; L2-L6 HydrophobicContact CD1-CG 4.44Å; L2-L6 HydrophobicContact CG-CD1 4.18Å; L2-L6 HydrophobicContact CG-CG 4.41Å; L2-L6 WeakPolarHBondContact O-CG 3.44Å; L2-L6 PolarHBondContact O-N 3.17Å
3	A	93.5	Very high	91	Very high	77 Å²	77	111.6 Å²	111.6	64%	0.636	59%	0.589	S	S	*	*	H	α-helix	trans	-60.1	-39.3	179.7	0	0	0	0	0	112.7	M1 R7	M1-A3 PolarHBondContact O-N 3.43Å; A3-R7 WeakPolarHBondContact O-CB 3.36Å; A3-R7 PolarHBondContact O-N 3.47Å
4	S	94.6	Very high	90.2	Very high	78 Å²	78	112.2 Å²	112.2	55%	0.545	58%	0.584	S	S	.	*	H	α-helix	trans	-64.9	-45.5	174.7	-51	0	0	0	0	110.9	M1 L2 L6 R7 T8	M1-S4 PolarHBondContact O-N 3.36Å; L2-S4 PolarHBondContact O-N 3.47Å; L2-S4 VanDerWaalsContact C-N 3.3Å; S4-L6 PolarHBondContact O-N 3.48Å; S4-R7 WeakPolarHBondContact O-CB 3.47Å; S4-R7 PolarHBondContact O-N 3.42Å; S4-T8 PolarHBondContact O-N 3.21Å; S4-T8 PolarHBondContact O-OG1 2.82Å
5	F	95.1	Very high	89.3	Confident	127 Å²	127	114.9 Å²	114.9	56%	0.557	60%	0.598	S	S	*	*	H	α-helix	trans	-59.3	-43.5	177.2	178.3	-98.7	0	0	0	112.8	M1 L2 T8 N9	M1-F5 VanDerWaalsContact O-N 3.14Å; M1-F5 PolarHBondContact O-N 3.29Å; L2-F5 WeakPolarHBondContact O-CB 3.26Å; L2-F5 PolarHBondContact O-N 3.38Å; L2-F5 VanDerWaalsContact O-N 3.14Å; F5-T8 PolarHBondContact O-N 3.31Å; F5-N9 PolarHBondContact O-ND2 3.25Å; F5-N9 PolarHBondContact O-N 3.36Å; F5-N9 WeakPolarHBondContact CZ-ND2 3.46Å; F5-N9 WeakPolarHBondContact CE2-ND2 3.41Å; F5-N9 WeakPolarHBondContact CE1-ND2 3.38Å; F5-N9 WeakPolarHBondContact O-CB 3.45Å
6	L	94.6	Very high	88.4	Confident	103 Å²	103	113.3 Å²	113.3	54%	0.539	60%	0.6	S	S	.	*	H	α-helix	trans	-65.1	-39.1	176.2	-67.5	176.3	0	0	0	111.8	L2 S4 R10	L2-L6 HydrophobicContact CD1-CG 4.44Å; L2-L6 HydrophobicContact CG-CD1 4.18Å; L2-L6 HydrophobicContact CG-CG 4.41Å; L2-L6 WeakPolarHBondContact O-CG 3.44Å; L2-L6 PolarHBondContact O-N 3.17Å; S4-L6 PolarHBondContact O-N 3.48Å; L6-R10 WeakPolarHBondContact O-CB 3.27Å; L6-R10 PolarHBondContact O-N 3.49Å
7	R	93.2	Very high	87.7	Confident	183 Å²	183	115.9 Å²	115.9	69%	0.691	61%	0.605	S	S	*	*	H	α-helix	trans	-63.5	-45.6	177	-170.6	176.6	-169.9	166.5	3.2	111.6	A3 S4 R10 Q11	A3-R7 WeakPolarHBondContact O-CB 3.36Å; A3-R7 PolarHBondContact O-N 3.47Å; S4-R7 WeakPolarHBondContact O-CB 3.47Å; S4-R7 PolarHBondContact O-N 3.42Å; R7-R10 PolarHBondContact O-N 3.1Å; R7-Q11 WeakPolarHBondContact O-CG 3.4Å; R7-Q11 PolarHBondContact O-N 3.23Å; R7-Q11 VanDerWaalsContact O-N 3.08Å
8	T	91.8	Very high	86.9	Confident	85 Å²	85	114.2 Å²	114.2	52%	0.521	60%	0.602	S	S	.	*	H	α-helix	trans	-65.8	-44.2	179.3	-45.8	0	0	0	0	111.4	S4 F5 R10 Q11 A12	S4-T8 PolarHBondContact O-N 3.21Å; S4-T8 PolarHBondContact O-OG1 2.82Å; F5-T8 PolarHBondContact O-N 3.31Å; T8-R10 PolarHBondContact O-N 3.36Å; T8-R10 VanDerWaalsContact C-N 3.31Å; T8-Q11 PolarHBondContact O-N 3.22Å; T8-Q11 VanDerWaalsContact O-N 3.12Å; T8-A12 PolarHBondContact O-N 3.19Å
9	N	91.3	Very high	86.3	Confident	80 Å²	80	111.6 Å²	111.6	43%	0.428	59%	0.591	S	S	.	*	H	α-helix	trans	-59.8	-41.9	175.5	-91	-85.1	0	0	0	112.1	F5 Q11 A12 A13	F5-N9 PolarHBondContact O-ND2 3.25Å; F5-N9 PolarHBondContact O-N 3.36Å; F5-N9 WeakPolarHBondContact CZ-ND2 3.46Å; F5-N9 WeakPolarHBondContact CE2-ND2 3.41Å; F5-N9 WeakPolarHBondContact CE1-ND2 3.38Å; F5-N9 WeakPolarHBondContact O-CB 3.45Å; N9-Q11 VanDerWaalsContact C-N 3.29Å; N9-Q11 PolarHBondContact O-N 3.26Å; N9-A12 PolarHBondContact O-N 3.17Å; N9-A13 WeakPolarHBondContact O-CB 3.4Å; N9-A13 PolarHBondContact O-N 2.86Å
10	R	89.3	Confident	85.4	Confident	166 Å²	166	113.8 Å²	113.8	63%	0.626	60%	0.602	S	S	*	*	H	α-helix	trans	-64.9	-33.3	176.9	-172.7	176.6	-176.6	-118.6	4.3	112.5	L6 R7 T8 K14	L6-R10 WeakPolarHBondContact O-CB 3.27Å; L6-R10 PolarHBondContact O-N 3.49Å; R7-R10 PolarHBondContact O-N 3.1Å; T8-R10 PolarHBondContact O-N 3.36Å; T8-R10 VanDerWaalsContact C-N 3.31Å; R10-K14 PolarHBondContact O-N 3.02Å; R10-K14 WeakPolarHBondContact O-CG 3.44Å; R10-K14 VanDerWaalsContact O-CG 3.27Å
11	Q	89.1	Confident	84.8	Confident	103 Å²	103	117 Å²	117	48%	0.481	61%	0.614	S	S	.	*	H	α-helix	trans	-71	-43.8	176	-74	171.4	-31.4	0	0	111.4	R7 T8 N9 A13 K14 L15	R7-Q11 WeakPolarHBondContact O-CG 3.4Å; R7-Q11 PolarHBondContact O-N 3.23Å; R7-Q11 VanDerWaalsContact O-N 3.08Å; T8-Q11 PolarHBondContact O-N 3.22Å; T8-Q11 VanDerWaalsContact O-N 3.12Å; N9-Q11 VanDerWaalsContact C-N 3.29Å; N9-Q11 PolarHBondContact O-N 3.26Å; Q11-A13 PolarHBondContact O-N 3.33Å; Q11-K14 PolarHBondContact O-N 3.18Å; Q11-L15 PolarHBondContact O-N 3.08Å
12	A	85.5	Confident	84.1	Confident	57 Å²	57	112.7 Å²	112.7	47%	0.471	60%	0.595	S	S	.	*	H	α-helix	trans	-59.9	-45.5	175.6	0	0	0	0	0	112	T8 N9 K14 L15 S16	T8-A12 PolarHBondContact O-N 3.19Å; N9-A12 PolarHBondContact O-N 3.17Å; A12-K14 PolarHBondContact O-N 3.01Å; A12-L15 PolarHBondContact O-N 3.4Å; A12-S16 PolarHBondContact O-N 3.12Å
13	A	82.4	Confident	83.3	Confident	56 Å²	56	111.8 Å²	111.8	46%	0.463	59%	0.59	S	S	.	*	H	α-helix	trans	-65.7	-23.6	178.7	0	0	0	0	0	114.2	N9 Q11 S16	N9-A13 WeakPolarHBondContact O-CB 3.4Å; N9-A13 PolarHBondContact O-N 2.86Å; Q11-A13 PolarHBondContact O-N 3.33Å; A13-S16 WeakPolarHBondContact CA-OG 3.37Å; A13-S16 PolarHBondContact O-OG 3.43Å
14	K	80.1	Confident	82.6	Confident	120 Å²	120	114.4 Å²	114.4	52%	0.522	60%	0.599	S	S	.	*	H	α-helix	trans	-77.6	-35.6	174.6	-76.5	172.5	178.6	-169.9	0	112	R10 Q11 A12	R10-K14 PolarHBondContact O-N 3.02Å; R10-K14 WeakPolarHBondContact O-CG 3.44Å; R10-K14 VanDerWaalsContact O-CG 3.27Å; Q11-K14 PolarHBondContact O-N 3.18Å; A12-K14 PolarHBondContact O-N 3.01Å
15	L	77.3	Confident	81.8	Confident	153 Å²	153	115.9 Å²	115.9	80%	0.801	61%	0.606	S	S	*	*	H	α-helix	trans	-74.3	-29.7	177.3	-78.1	160.4	0	0	0	112.2	Q11 A12 K17	Q11-L15 PolarHBondContact O-N 3.08Å; A12-L15 PolarHBondContact O-N 3.4Å; L15-K17 VanDerWaalsContact C-N 3.26Å; L15-K17 PolarHBondContact O-N 3.37Å
16	S	74.3	Confident	81.1	Confident	89 Å²	89	115.9 Å²	115.9	62%	0.622	62%	0.617	S	S	*	*	T	Hydrogen-bonded Turn	trans	-80.4	-2.9	178.1	70.3	0	0	0	0	114	A12 A13 P18	A12-S16 PolarHBondContact O-N 3.12Å; A13-S16 WeakPolarHBondContact CA-OG 3.37Å; A13-S16 PolarHBondContact O-OG 3.43Å; S16-P18 WeakPolarHBondContact O-CD 3.49Å
17	K	76.3	Confident	80.5	Confident	158 Å²	158	116.3 Å²	116.3	69%	0.687	62%	0.623	S	S	*	*	S	Bend	trans	-76.4	119	175.4	-105.5	176.2	176.9	-179.5	0	108.4	L15 T19	L15-K17 VanDerWaalsContact C-N 3.26Å; L15-K17 PolarHBondContact O-N 3.37Å; K17-T19 PolarHBondContact O-N 3.38Å; K17-T19 VanDerWaalsContact O-N 3.17Å
18	P	73.4	Confident	79.9	Confident	84 Å²	84	114.9 Å²	114.9	55%	0.545	63%	0.629	S	S	.	*	P	Polyproline II helix	trans	-59.7	125.4	172.1	25.4	-31.7	0	0	0	107.7	S16 L23	S16-P18 WeakPolarHBondContact O-CD 3.49Å; P18-L23 HydrophobicContact CB-CD2 3.89Å; P18-L23 HydrophobicContact CB-CG 4.33Å; P18-L23 HydrophobicContact CG-CD2 4.16Å
19	T	74.9	Confident	79.4	Confident	66 Å²	66	121.5 Å²	121.5	41%	0.405	64%	0.644	S	S	.	*	P	Polyproline II helix	trans	-67.8	153.4	168.8	53.3	0	0	0	0	108.4	K17 E21 N22	K17-T19 PolarHBondContact O-N 3.38Å; K17-T19 VanDerWaalsContact O-N 3.17Å; T19-E21 PolarHBondContact O-N 3.25Å; T19-E21 VanDerWaalsContact O-N 3.1Å; T19-N22 WeakPolarHBondContact O-CB 3.18Å; T19-N22 PolarHBondContact O-N 3.17Å; T19-N22 PolarHBondContact OG1-ND2 3.36Å
20	L	69.6	Low	79	Confident	154 Å²	154	123.1 Å²	123.1	81%	0.806	66%	0.659	S	S	*	*	G	3₁₀ helix	trans	-55.1	-31.1	177.2	-171.7	149.7	0	0	0	111.4	N22 L23	L20-N22 VanDerWaalsContact C-N 3.26Å; L20-N22 PolarHBondContact O-N 3.48Å; L20-L23 PolarHBondContact O-N 2.99Å
21	E	71.9	Confident	78.7	Confident	181 Å²	181	123.5 Å²	123.5	85%	0.846	67%	0.668	S	S	*	*	G	3₁₀ helix	trans	-63.1	-25.9	174.4	-54.8	173	-151	0	0	113.9	T19	T19-E21 PolarHBondContact O-N 3.25Å; T19-E21 VanDerWaalsContact O-N 3.1Å
22	N	73.1	Confident	78.4	Confident	123 Å²	123	126 Å²	126	66%	0.658	68%	0.683	S	S	*	*	G	3₁₀ helix	trans	-91.2	-3.2	178.4	-79.3	-53.3	0	0	0	113.5	T19 L20	T19-N22 WeakPolarHBondContact O-CB 3.18Å; T19-N22 PolarHBondContact O-N 3.17Å; T19-N22 PolarHBondContact OG1-ND2 3.36Å; L20-N22 VanDerWaalsContact C-N 3.26Å; L20-N22 PolarHBondContact O-N 3.48Å
23	L	78.5	Confident	78.3	Confident	104 Å²	104	133.6 Å²	133.6	55%	0.545	70%	0.699	S	S	.	*	P	Polyproline II helix	trans	-98.4	116.7	-178.8	-63.7	177.8	0	0	0	109.8	P18 L20 P25	P18-L23 HydrophobicContact CB-CD2 3.89Å; P18-L23 HydrophobicContact CB-CG 4.33Å; P18-L23 HydrophobicContact CG-CD2 4.16Å; L20-L23 PolarHBondContact O-N 2.99Å; L23-P25 WeakPolarHBondContact O-CD 3.37Å
24	T	78.8	Confident	78.3	Confident	133 Å²	133	140.2 Å²	140.2	82%	0.816	72%	0.718	S	S	*	*	P	Polyproline II helix	trans	-74	118.4	167.5	-12.3	0	0	0	0	108.5	V26	T24-V26 PolarHBondContact O-N 3.06Å
25	P	76.3	Confident	78.4	Confident	108 Å²	108	139.9 Å²	139.9	70%	0.701	73%	0.728	S	S	*	*	P	Polyproline II helix	trans	-67.9	126.7	178.8	26.4	-32.4	0	0	0	109.7	L23 V27	L23-P25 WeakPolarHBondContact O-CD 3.37Å; P25-V27 PolarHBondContact O-N 3.48Å
26	V	82.3	Confident	78.7	Confident	128 Å²	128	141.3 Å²	141.3	78%	0.776	73%	0.73	S	S	*	*			trans	-77.8	104.2	170.1	178.9	0	0	0	0	107.8	T24 L28	T24-V26 PolarHBondContact O-N 3.06Å; V26-L28 HydrophobicContact CG1-CD2 3.99Å; V26-L28 HydrophobicContact CG1-CG 4.34Å; V26-L28 PolarHBondContact O-N 3.33Å
27	V	80.4	Confident	79	Confident	112 Å²	112	143 Å²	143	68%	0.679	74%	0.736	S	S	*	*			trans	-87.4	102.4	174.5	-177.9	0	0	0	0	108.6	P25 R29	P25-V27 PolarHBondContact O-N 3.48Å; V27-R29 PolarHBondContact O-N 2.92Å
28	L	81.4	Confident	79.3	Confident	153 Å²	153	142.6 Å²	142.6	80%	0.801	74%	0.741	S	S	*	*	P	Polyproline II helix	trans	-76.7	120.9	170.6	-62.2	177.6	0	0	0	109	V26	V26-L28 HydrophobicContact CG1-CD2 3.99Å; V26-L28 HydrophobicContact CG1-CG 4.34Å; V26-L28 PolarHBondContact O-N 3.33Å
29	R	81.2	Confident	79.6	Confident	223 Å²	223	149.6 Å²	149.6	84%	0.842	76%	0.757	S	S	*	*	P	Polyproline II helix	trans	-92.2	137.3	173.3	-66.8	-175.2	-178.6	-177.2	0.5	109.4	V27 E31	V27-R29 PolarHBondContact O-N 2.92Å; R29-E31 PolarHBondContact O-N 3.14Å
30	P	81.9	Confident	79.8	Confident	115 Å²	115	152.1 Å²	152.1	75%	0.747	77%	0.774	S	S	*	*	P	Polyproline II helix	trans	-59.5	137.4	172.2	-19.7	30.7	0	0	0	110.6	I32	P30-I32 PolarHBondContact O-N 3.45Å
31	E	84.5	Confident	80.2	Confident	173 Å²	173	153.8 Å²	153.8	81%	0.808	78%	0.778	S	S	*	*			trans	-78.8	104.8	172.7	-164.4	168.4	-165.2	0	0	108.9	R29 R33	R29-E31 PolarHBondContact O-N 3.14Å; E31-R33 PolarHBondContact O-N 2.96Å
32	I	82.2	Confident	80.6	Confident	157 Å²	157	151.3 Å²	151.3	81%	0.805	78%	0.775	S	S	*	*			trans	-82.5	108.3	179	-56	178	0	0	0	108.4	P30	P30-I32 PolarHBondContact O-N 3.45Å
33	R	82.9	Confident	80.8	Confident	216 Å²	216	151 Å²	151	82%	0.815	78%	0.78	S	S	*	*	P	Polyproline II helix	trans	-79.6	131.9	169.9	-67.9	-170.5	176.5	-176.7	-0.8	109.9	E31	E31-R33 PolarHBondContact O-N 2.96Å
34	K	83.5	Confident	80.8	Confident	195 Å²	195	156.9 Å²	156.9	85%	0.848	80%	0.795	S	S	*	*	P	Polyproline II helix	trans	-67.9	135.9	172.5	-70.6	-175.6	-179.9	177.9	0	109.2
35	P	82.8	Confident	80.8	Confident	113 Å²	113	156.2 Å²	156.2	73%	0.734	79%	0.793	S	S	*	*	P	Polyproline II helix	trans	-65.6	137.4	173.2	25.9	-31.7	0	0	0	110	V37	P35-V37 PolarHBondContact O-N 3.42Å
36	E	82.6	Confident	80.8	Confident	182 Å²	182	157.9 Å²	157.9	85%	0.85	80%	0.801	S	S	*	*			trans	-76.2	109	172.6	-166.5	163.1	-166	0	0	108.2	L38	E36-L38 PolarHBondContact O-N 3Å
37	V	80.8	Confident	80.6	Confident	124 Å²	124	162.7 Å²	162.7	75%	0.752	82%	0.822	S	S	*	*			trans	-85.5	104	179.7	-179	0	0	0	0	108.1	P35 R39	P35-V37 PolarHBondContact O-N 3.42Å; V37-R39 PolarHBondContact O-N 3.01Å
38	L	81.7	Confident	80.6	Confident	150 Å²	150	165.3 Å²	165.3	79%	0.785	83%	0.829	S	S	*	*	P	Polyproline II helix	trans	-68.9	127.2	168.7	-63.7	177.6	0	0	0	108.9	E36	E36-L38 PolarHBondContact O-N 3Å
39	R	79.7	Confident	80.6	Confident	232 Å²	232	165.9 Å²	165.9	88%	0.875	83%	0.831	S	S	*	*	P	Polyproline II helix	trans	-73.8	134.9	172.1	-68	-175.5	-178.6	-179.7	0.8	108.5	V37 E41	V37-R39 PolarHBondContact O-N 3.01Å; R39-E41 PolarHBondContact O-N 3.14Å
40	P	78.9	Confident	80.5	Confident	118 Å²	118	162.7 Å²	162.7	77%	0.766	83%	0.83	S	S	*	*	P	Polyproline II helix	trans	-57.9	136	170.2	-18.2	29.4	0	0	0	109.4	T42	P40-T42 PolarHBondContact O-N 2.99Å; P40-T42 VanDerWaalsContact O-N 3.17Å
41	E	79.4	Confident	80.4	Confident	189 Å²	189	165.5 Å²	165.5	88%	0.883	84%	0.835	S	S	*	*			trans	-65.8	114.4	165	-74	-172.1	153.9	0	0	107.7	R39 P43	R39-E41 PolarHBondContact O-N 3.14Å; E41-P43 VanDerWaalsContact O-CD 3.26Å; E41-P43 WeakPolarHBondContact O-CD 3.35Å
42	T	78.9	Confident	80.2	Confident	130 Å²	130	165.1 Å²	165.1	80%	0.798	84%	0.837	S	S	*	*	P	Polyproline II helix	trans	-70.1	116.9	172.4	-21.6	0	0	0	0	107.6	P40 R44	P40-T42 PolarHBondContact O-N 2.99Å; P40-T42 VanDerWaalsContact O-N 3.17Å; T42-R44 PolarHBondContact O-N 3.36Å
43	P	78.6	Confident	80.1	Confident	116 Å²	116	165.6 Å²	165.6	75%	0.753	84%	0.839	S	S	*	*	P	Polyproline II helix	trans	-62.1	135.2	175	24.5	-31.2	0	0	0	108.8	E41	E41-P43 VanDerWaalsContact O-CD 3.26Å; E41-P43 WeakPolarHBondContact O-CD 3.35Å
44	R	77.3	Confident	79.9	Confident	227 Å²	227	162 Å²	162	86%	0.857	84%	0.841	S	S	*	*	P	Polyproline II helix	trans	-71.8	139.5	175	-61.8	-175.5	-135.2	171.6	5.2	108.6	T42 V46	T42-R44 PolarHBondContact O-N 3.36Å; R44-V46 PolarHBondContact O-N 2.91Å
45	P	79.1	Confident	79.6	Confident	120 Å²	120	159.5 Å²	159.5	78%	0.779	84%	0.84	S	S	*	*	P	Polyproline II helix	trans	-60.4	138.9	173.5	23.3	-28.7	0	0	0	109.5
46	V	77.4	Confident	79.3	Confident	143 Å²	143	163.3 Å²	163.3	87%	0.867	85%	0.849	S	S	*	*	P	Polyproline II helix	trans	-88.8	123.2	170.6	-168.8	0	0	0	0	106	R44	R44-V46 PolarHBondContact O-N 2.91Å
47	D	77.4	Confident	79	Confident	229 Å²	229	161.6 Å²	161.6	100%	1.225	85%	0.849	S	S	*	*			trans	-58.8	0	178.9	-66.9	-45.2	0	0	0	112.8

Retrieved 47 of 47 residues in 48.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).