A0A087WX76_HUMAN Loading...

Chromosome 9 open reading frame 50

AlphaFold DB , UniProt , Accession A0A087WX76, Species HUMAN (Homo sapiens, Human), Gene C9orf50, Length 69 aa.

						>A0A087WX76_HUMAN|A0A087WX76|C9orf50
MNSSLPFCSWKKAAAQRPRSSLRAFLDPHRNLEQESLLPNRVLQSVLKQGCPKGYHLLLASATLQPDKR
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	37.9	Very low	55.3	Low	233 Å²	233	152.5 Å²	152.5	100%	1.148	82%	0.819	S	S	*	*				0	106.4	0	-90.6	141.5	65.2	0	0	107.2
2	N	51.3	Low	55.2	Low	161 Å²	161	151.3 Å²	151.3	86%	0.861	80%	0.801	S	S	*	*			trans	-101	99.9	-169.7	-56.3	-16.6	0	0	0	108	S4	N2-S4 PolarHBondContact O-N 2.78Å
3	S	54.6	Low	55.6	Low	114 Å²	114	147.6 Å²	147.6	80%	0.797	81%	0.805	S	S	*	*			trans	-87.3	87.8	177.1	55.8	0	0	0	0	110	L5	S3-L5 PolarHBondContact O-N 2.82Å
4	S	65.6	Low	55.5	Low	119 Å²	119	141.6 Å²	141.6	83%	0.832	79%	0.785	S	S	*	*			trans	-71.8	114.5	164.2	-80.8	0	0	0	0	109.1	N2	N2-S4 PolarHBondContact O-N 2.78Å
5	L	67.1	Low	55.8	Low	158 Å²	158	137.9 Å²	137.9	83%	0.827	78%	0.78	S	S	*	*			trans	-72.9	139.4	168.2	-68.5	169.1	0	0	0	109.2	S3 F7	S3-L5 PolarHBondContact O-N 2.82Å; L5-F7 PolarHBondContact O-N 3.45Å
6	P	62.2	Low	55.5	Low	111 Å²	111	141.1 Å²	141.1	72%	0.721	79%	0.786	S	S	*	*			trans	-68.6	121.4	176.9	28.4	-31.1	0	0	0	108.5	C8	P6-C8 PolarHBondContact O-N 3.24Å
7	F	56.5	Low	55.8	Low	194 Å²	194	145.9 Å²	145.9	85%	0.851	79%	0.789	S	S	*	*			trans	-63.1	101.2	168.5	-171.8	-96.8	0	0	0	107.2	L5 S9	L5-F7 PolarHBondContact O-N 3.45Å; F7-S9 VanDerWaalsContact C-N 3.32Å; F7-S9 PolarHBondContact O-N 3.3Å
8	C	55.6	Low	55.7	Low	113 Å²	113	144.2 Å²	144.2	76%	0.764	79%	0.787	S	S	*	*			trans	-59.9	96.8	173.5	-71.7	0	0	0	0	108.4	P6 W10	P6-C8 PolarHBondContact O-N 3.24Å; C8-W10 PolarHBondContact O-N 3.35Å
9	S	59.9	Low	56.1	Low	94 Å²	94	149.5 Å²	149.5	66%	0.657	79%	0.794	S	S	*	*			trans	-69.8	79.8	171.5	70	0	0	0	0	108.3	F7 K11	F7-S9 VanDerWaalsContact C-N 3.32Å; F7-S9 PolarHBondContact O-N 3.3Å; S9-K11 PolarHBondContact O-N 3.19Å
10	W	45.2	Very low	56.5	Low	183 Å²	183	145.1 Å²	145.1	69%	0.693	78%	0.776	S	S	*	*			trans	-70.5	82.5	173.3	179	-78.8	0	0	0	107.5	C8 K12	C8-W10 PolarHBondContact O-N 3.35Å; W10-K12 HydrophobicContact CZ2-CD 3.77Å; W10-K12 HydrophobicContact CZ2-CG 3.64Å; W10-K12 PolarHBondContact O-N 3.29Å
11	K	53	Low	57.3	Low	198 Å²	198	141.1 Å²	141.1	86%	0.861	76%	0.76	S	S	*	*			trans	-73.4	83.1	163.3	-73.5	-160.6	-177	-160.4	0	107.4	S9 A13	S9-K11 PolarHBondContact O-N 3.19Å; K11-A13 PolarHBondContact O-N 3.41Å
12	K	54.1	Low	58.4	Low	138 Å²	138	136.9 Å²	136.9	60%	0.6	74%	0.741	S	S	*	*			trans	-66.4	102.8	162.6	-127.4	172.8	-75.9	-94.5	0	105.7	W10 A14	W10-K12 HydrophobicContact CZ2-CD 3.77Å; W10-K12 HydrophobicContact CZ2-CG 3.64Å; W10-K12 PolarHBondContact O-N 3.29Å; K12-A14 HydrophobicContact CB-CB 4.13Å; K12-A14 HydrophobicContact CD-CB 4.35Å; K12-A14 HydrophobicContact CG-CB 4.19Å; K12-A14 PolarHBondContact O-N 3.33Å
13	A	59.2	Low	58.9	Low	103 Å²	103	138.7 Å²	138.7	85%	0.851	74%	0.736	S	S	*	*			trans	-64.9	70.8	146.9	0	0	0	0	0	106.8	K11 A15	K11-A13 PolarHBondContact O-N 3.41Å; A13-A15 VanDerWaalsContact C-N 3.29Å; A13-A15 PolarHBondContact O-N 2.97Å
14	A	54.6	Low	59.2	Low	63 Å²	63	134.6 Å²	134.6	52%	0.521	71%	0.709	S	S	.	*			trans	-74.9	94	170.6	0	0	0	0	0	105.1	K12 Q16	K12-A14 HydrophobicContact CB-CB 4.13Å; K12-A14 HydrophobicContact CD-CB 4.35Å; K12-A14 HydrophobicContact CG-CB 4.19Å; K12-A14 PolarHBondContact O-N 3.33Å; A14-Q16 PolarHBondContact O-N 3.41Å
15	A	59.8	Low	58.9	Low	86 Å²	86	135.4 Å²	135.4	71%	0.711	70%	0.698	S	S	*	*			trans	-40.9	120.5	147.3	0	0	0	0	0	105.7	A13 R17	A13-A15 VanDerWaalsContact C-N 3.29Å; A13-A15 PolarHBondContact O-N 2.97Å; A15-R17 VanDerWaalsContact C-N 3.28Å; A15-R17 PolarHBondContact O-N 3.4Å
16	Q	51.6	Low	58.7	Low	189 Å²	189	134.4 Å²	134.4	88%	0.883	69%	0.692	S	S	*	*			trans	-52.9	96.5	-175	-80.3	-134.5	-33.8	0	0	108.4	A14 P18	A14-Q16 PolarHBondContact O-N 3.41Å; Q16-P18 VanDerWaalsContact O-CD 3.25Å; Q16-P18 WeakPolarHBondContact O-CD 3.38Å
17	R	60.4	Low	58.9	Low	223 Å²	223	131.9 Å²	131.9	84%	0.842	67%	0.673	S	S	*	*			trans	-67.5	119.2	163.7	-90.8	-173.3	170.3	105.7	-3.2	103.7	A15 R19	A15-R17 VanDerWaalsContact C-N 3.28Å; A15-R17 PolarHBondContact O-N 3.4Å; R17-R19 PolarHBondContact O-N 3.5Å
18	P	54.5	Low	59.1	Low	115 Å²	115	126.9 Å²	126.9	75%	0.747	66%	0.66	S	S	*	*			trans	-55.1	111.8	168.5	-16.4	29.3	0	0	0	104.9	Q16 S20	Q16-P18 VanDerWaalsContact O-CD 3.25Å; Q16-P18 WeakPolarHBondContact O-CD 3.38Å; P18-S20 PolarHBondContact O-N 2.91Å
19	R	62.9	Low	59.2	Low	246 Å²	246	128.2 Å²	128.2	93%	0.928	66%	0.655	S	S	*	*			trans	-70.4	80.4	172.7	-71.9	-178.5	79.5	136.1	0.1	105.3	R17 S21	R17-R19 PolarHBondContact O-N 3.5Å; R19-S21 PolarHBondContact O-N 3.34Å
20	S	64.2	Low	59.1	Low	61 Å²	61	131.7 Å²	131.7	43%	0.427	65%	0.653	S	S	.	*			trans	-55.8	123.3	170.2	54.4	0	0	0	0	106.3	P18	P18-S20 PolarHBondContact O-N 2.91Å
21	S	72.5	Confident	59.5	Low	62 Å²	62	125.8 Å²	125.8	43%	0.434	64%	0.635	S	S	.	*			trans	-53.9	152.2	179.4	70.8	0	0	0	0	109.8	R19 R23 A24	R19-S21 PolarHBondContact O-N 3.34Å; S21-R23 PolarHBondContact O-N 2.89Å; S21-A24 VanDerWaalsContact O-CB 3.28Å; S21-A24 WeakPolarHBondContact O-CB 3.48Å; S21-A24 PolarHBondContact O-N 3.33Å
22	L	62.3	Low	59.6	Low	144 Å²	144	121.9 Å²	121.9	75%	0.754	62%	0.623	S	S	*	*	H	α-helix	trans	-50.7	-27.6	175.9	-77.8	166.9	0	0	0	112.4	A24 F25 L26	L22-A24 VanDerWaalsContact C-N 3.27Å; L22-A24 PolarHBondContact O-N 2.96Å; L22-F25 WeakPolarHBondContact O-CB 3.33Å; L22-F25 PolarHBondContact O-N 3.07Å; L22-F25 VanDerWaalsContact O-N 3.08Å; L22-L26 PolarHBondContact O-N 2.96Å
23	R	61.6	Low	59.7	Low	198 Å²	198	121.3 Å²	121.3	75%	0.747	62%	0.623	S	S	*	*	H	α-helix	trans	-61.2	-28.5	173.8	-64	-176.7	-83.5	-145.8	-2.6	114.2	S21 F25 L26 D27	S21-R23 PolarHBondContact O-N 2.89Å; R23-F25 VanDerWaalsContact C-N 3.26Å; R23-F25 PolarHBondContact O-N 3.36Å; R23-L26 CarbonylContact O-C 3.57Å; R23-L26 PolarHBondContact O-N 3.18Å; R23-D27 PolarHBondContact O-N 3.26Å; R23-D27 VanDerWaalsContact O-N 3.07Å
24	A	60.9	Low	59.7	Low	29 Å²	29	122.9 Å²	122.9	24%	0.24	61%	0.612	C	S	.	*	H	α-helix	trans	-71.3	-22.1	175.2	0	0	0	0	0	113	S21 L22	S21-A24 VanDerWaalsContact O-CB 3.28Å; S21-A24 WeakPolarHBondContact O-CB 3.48Å; S21-A24 PolarHBondContact O-N 3.33Å; L22-A24 VanDerWaalsContact C-N 3.27Å; L22-A24 PolarHBondContact O-N 2.96Å
25	F	57.8	Low	59.6	Low	135 Å²	135	124.9 Å²	124.9	59%	0.592	61%	0.611	S	S	*	*	H	α-helix	trans	-84.6	-22.6	172.2	-62.9	-86.5	0	0	0	112.2	L22 R23	L22-F25 WeakPolarHBondContact O-CB 3.33Å; L22-F25 PolarHBondContact O-N 3.07Å; L22-F25 VanDerWaalsContact O-N 3.08Å; R23-F25 VanDerWaalsContact C-N 3.26Å; R23-F25 PolarHBondContact O-N 3.36Å
26	L	63.4	Low	59.5	Low	137 Å²	137	123.5 Å²	123.5	72%	0.717	60%	0.596	S	S	*	*	S	Bend	trans	-92.7	-1.9	177.2	-62.1	173	0	0	0	112.8	L22 R23 P28	L22-L26 PolarHBondContact O-N 2.96Å; R23-L26 CarbonylContact O-C 3.57Å; R23-L26 PolarHBondContact O-N 3.18Å; L26-P28 WeakPolarHBondContact O-CD 3.44Å
27	D	66.7	Low	59.8	Low	59 Å²	59	118.9 Å²	118.9	32%	0.316	58%	0.577	S	S	.	*			trans	-71.2	107.3	176.1	-178.8	8.2	0	0	0	109	R23 H29 R30 N31	R23-D27 PolarHBondContact O-N 3.26Å; R23-D27 VanDerWaalsContact O-N 3.07Å; D27-H29 PolarHBondContact O-N 3.36Å; D27-H29 VanDerWaalsContact O-N 3.15Å; D27-H29 PolarHBondContact OD1-N 3.38Å; D27-R30 HydrophobicContact CB-CB 4.29Å; D27-R30 PolarHBondContact O-N 3.16Å; D27-R30 VanDerWaalsContact O-N 3.17Å; D27-R30 WeakPolarHBondContact OD2-CD 3.23Å; D27-R30 WeakPolarHBondContact OD2-CG 3.41Å; D27-R30 IonicContact OD2-NE 3.95Å; D27-N31 WeakPolarHBondContact O-CB 3.21Å; D27-N31 PolarHBondContact O-N 3.49Å
28	P	60.2	Low	59.7	Low	89 Å²	89	112.8 Å²	112.8	58%	0.578	56%	0.561	S	S	*	*	H	α-helix	trans	-60.4	-30.1	-175.2	-19.7	33.1	0	0	0	111.3	L26 L32	L26-P28 WeakPolarHBondContact O-CD 3.44Å; P28-L32 WeakPolarHBondContact O-CB 3.14Å; P28-L32 WeakPolarHBondContact O-CD1 3.44Å; P28-L32 WeakPolarHBondContact O-CG 3.21Å; P28-L32 PolarHBondContact O-N 2.85Å
29	H	58.6	Low	60	Low	141 Å²	141	110.3 Å²	110.3	65%	0.653	55%	0.545	S	S	*	.	H	α-helix	trans	-73	-31.7	-176.9	-162.8	-63.2	0	0	0	112.7	D27 E33	D27-H29 PolarHBondContact O-N 3.36Å; D27-H29 VanDerWaalsContact O-N 3.15Å; D27-H29 PolarHBondContact OD1-N 3.38Å; H29-E33 WeakPolarHBondContact O-CG 3.36Å
30	R	57.1	Low	60	Low	167 Å²	167	103.1 Å²	103.1	63%	0.63	53%	0.525	S	S	*	.	H	α-helix	trans	-84.9	-35.2	176.1	-77.3	-178.2	171.5	-138.6	-3.4	112.6	D27 Q34	D27-R30 HydrophobicContact CB-CB 4.29Å; D27-R30 PolarHBondContact O-N 3.16Å; D27-R30 VanDerWaalsContact O-N 3.17Å; D27-R30 WeakPolarHBondContact OD2-CD 3.23Å; D27-R30 WeakPolarHBondContact OD2-CG 3.41Å; D27-R30 IonicContact OD2-NE 3.95Å; R30-Q34 PolarHBondContact O-N 2.88Å
31	N	54.4	Low	60.1	Low	58 Å²	58	109 Å²	109	31%	0.31	54%	0.537	S	S	.	.	H	α-helix	trans	-68.6	-43.5	179.3	177.8	-86.6	0	0	0	111	D27 E33 Q34 E35	D27-N31 WeakPolarHBondContact O-CB 3.21Å; D27-N31 PolarHBondContact O-N 3.49Å; N31-E33 PolarHBondContact O-N 2.66Å; N31-Q34 PolarHBondContact O-N 3.24Å; N31-E35 PolarHBondContact ND2-OE1 3.42Å; N31-E35 VanDerWaalsContact O-CB 3.24Å; N31-E35 WeakPolarHBondContact O-CB 3.25Å; N31-E35 VanDerWaalsContact O-CG 3.32Å; N31-E35 WeakPolarHBondContact O-CG 3.43Å; N31-E35 PolarHBondContact O-N 2.87Å; N31-E35 PolarHBondContact OD1-OE1 2.89Å; N31-E35 VanDerWaalsContact OD1-OE1 3.13Å; N31-E35 PolarHBondContact OD1-OE2 2.84Å
32	L	55.1	Low	59.8	Low	116 Å²	116	110 Å²	110	61%	0.607	54%	0.541	S	S	*	.	H	α-helix	trans	-64.6	-39.1	178.7	-71.7	170.2	0	0	0	113.7	P28 Q34 S36	P28-L32 WeakPolarHBondContact O-CB 3.14Å; P28-L32 WeakPolarHBondContact O-CD1 3.44Å; P28-L32 WeakPolarHBondContact O-CG 3.21Å; P28-L32 PolarHBondContact O-N 2.85Å; L32-Q34 VanDerWaalsContact C-N 3.35Å; L32-Q34 PolarHBondContact O-N 2.89Å; L32-S36 VanDerWaalsContact O-CB 3.24Å; L32-S36 WeakPolarHBondContact O-CB 3.19Å; L32-S36 PolarHBondContact O-N 2.81Å; L32-S36 PolarHBondContact O-OG 3.37Å
33	E	56.9	Low	60	Low	127 Å²	127	107.9 Å²	107.9	59%	0.593	53%	0.53	S	S	*	.	H	α-helix	trans	-62.1	-43.9	175.3	-75	-100.4	130.9	0	0	111.1	H29 N31 S36	H29-E33 WeakPolarHBondContact O-CG 3.36Å; N31-E33 PolarHBondContact O-N 2.66Å; E33-S36 PolarHBondContact O-OG 2.93Å
34	Q	57.2	Low	60.3	Low	135 Å²	135	103.4 Å²	103.4	63%	0.631	52%	0.517	S	S	*	.	H	α-helix	trans	-75.1	-38.5	-178.5	-164.8	173.7	-52.9	0	0	112.5	R30 N31 L32 S36 L37 L38	R30-Q34 PolarHBondContact O-N 2.88Å; N31-Q34 PolarHBondContact O-N 3.24Å; L32-Q34 VanDerWaalsContact C-N 3.35Å; L32-Q34 PolarHBondContact O-N 2.89Å; Q34-S36 VanDerWaalsContact C-N 3.32Å; Q34-L37 PolarHBondContact O-N 3.42Å; Q34-L38 HydrophobicContact CG-CD1 4.35Å; Q34-L38 WeakPolarHBondContact O-CD1 3.05Å; Q34-L38 WeakPolarHBondContact O-CG 3.2Å; Q34-L38 PolarHBondContact O-N 3.14Å
35	E	54.5	Low	60.6	Low	105 Å²	105	104.8 Å²	104.8	49%	0.491	53%	0.525	S	S	.	.	H	α-helix	trans	-77.8	-11.2	175.5	-69.6	-171.3	-178.2	0	0	113.4	N31 P39	N31-E35 PolarHBondContact ND2-OE1 3.42Å; N31-E35 VanDerWaalsContact O-CB 3.24Å; N31-E35 WeakPolarHBondContact O-CB 3.25Å; N31-E35 VanDerWaalsContact O-CG 3.32Å; N31-E35 WeakPolarHBondContact O-CG 3.43Å; N31-E35 PolarHBondContact O-N 2.87Å; N31-E35 PolarHBondContact OD1-OE1 2.89Å; N31-E35 VanDerWaalsContact OD1-OE1 3.13Å; N31-E35 PolarHBondContact OD1-OE2 2.84Å; E35-P39 WeakPolarHBondContact O-CD 3.49Å; E35-P39 WeakPolarHBondContact O-CG 3.09Å
36	S	56.8	Low	61	Low	57 Å²	57	101 Å²	101	40%	0.399	51%	0.513	S	S	.	.	H	α-helix	trans	-81.9	-29.6	168.9	77.7	0	0	0	0	112	L32 E33 Q34 N40	L32-S36 VanDerWaalsContact O-CB 3.24Å; L32-S36 WeakPolarHBondContact O-CB 3.19Å; L32-S36 PolarHBondContact O-N 2.81Å; L32-S36 PolarHBondContact O-OG 3.37Å; E33-S36 PolarHBondContact O-OG 2.93Å; Q34-S36 VanDerWaalsContact C-N 3.32Å; S36-N40 WeakPolarHBondContact O-CB 3.42Å; S36-N40 PolarHBondContact O-ND2 3.44Å
37	L	57.3	Low	61.2	Low	92 Å²	92	99.6 Å²	99.6	48%	0.482	51%	0.506	S	S	.	.	H	α-helix	trans	-82.5	-34.6	-178.4	-74	166.8	0	0	0	112.3	Q34 R41	Q34-L37 PolarHBondContact O-N 3.42Å; L37-R41 WeakPolarHBondContact O-CB 3.18Å; L37-R41 WeakPolarHBondContact O-CG 3.17Å; L37-R41 PolarHBondContact O-N 3.35Å
38	L	58.1	Low	61.2	Low	95 Å²	95	105 Å²	105	50%	0.497	53%	0.527	S	S	.	.	H	α-helix	trans	-64.6	-54	179.5	-78.3	162.2	0	0	0	114	Q34 N40 R41 V42	Q34-L38 HydrophobicContact CG-CD1 4.35Å; Q34-L38 WeakPolarHBondContact O-CD1 3.05Å; Q34-L38 WeakPolarHBondContact O-CG 3.2Å; Q34-L38 PolarHBondContact O-N 3.14Å; L38-N40 VanDerWaalsContact C-N 3.34Å; L38-N40 PolarHBondContact O-N 3.28Å; L38-R41 PolarHBondContact O-N 2.87Å; L38-V42 WeakPolarHBondContact O-CB 3.44Å; L38-V42 VanDerWaalsContact O-CG2 3.25Å; L38-V42 WeakPolarHBondContact O-CG2 3.32Å; L38-V42 PolarHBondContact O-N 3.47Å
39	P	61.9	Low	61.7	Low	64 Å²	64	109 Å²	109	42%	0.416	54%	0.537	S	S	.	.	H	α-helix	trans	-66.9	-38.6	179.5	26.2	-31.9	0	0	0	110.4	E35 V42 L43	E35-P39 WeakPolarHBondContact O-CD 3.49Å; E35-P39 WeakPolarHBondContact O-CG 3.09Å; P39-V42 PolarHBondContact O-N 2.92Å; P39-L43 WeakPolarHBondContact O-CB 3.24Å; P39-L43 WeakPolarHBondContact O-CD1 3.43Å; P39-L43 WeakPolarHBondContact O-CG 3.21Å; P39-L43 PolarHBondContact O-N 3.2Å
40	N	63.5	Low	62	Low	95 Å²	95	104.3 Å²	104.3	51%	0.508	53%	0.527	S	S	.	.	H	α-helix	trans	-65.1	-42.8	175.5	-82.8	-46.3	0	0	0	112.4	S36 L38 Q44	S36-N40 WeakPolarHBondContact O-CB 3.42Å; S36-N40 PolarHBondContact O-ND2 3.44Å; L38-N40 VanDerWaalsContact C-N 3.34Å; L38-N40 PolarHBondContact O-N 3.28Å; N40-Q44 WeakPolarHBondContact O-CB 2.7Å; N40-Q44 WeakPolarHBondContact O-CG 2.97Å; N40-Q44 PolarHBondContact O-N 2.94Å
41	R	64.4	Low	62.3	Low	183 Å²	183	98.8 Å²	98.8	69%	0.691	51%	0.514	S	S	*	.	H	α-helix	trans	-66.4	-40.4	177	-78.8	177.6	176.2	-155.1	0.3	112.3	L37 L38 S45	L37-R41 WeakPolarHBondContact O-CB 3.18Å; L37-R41 WeakPolarHBondContact O-CG 3.17Å; L37-R41 PolarHBondContact O-N 3.35Å; L38-R41 PolarHBondContact O-N 2.87Å; R41-S45 WeakPolarHBondContact O-CB 3.4Å; R41-S45 PolarHBondContact O-N 2.77Å; R41-S45 PolarHBondContact O-OG 2.81Å
42	V	66.6	Low	62.7	Low	85 Å²	85	98.8 Å²	98.8	52%	0.515	52%	0.517	S	S	.	.	H	α-helix	trans	-65.9	-48	176.4	172.7	0	0	0	0	110.3	L38 P39 Q44 S45 V46	L38-V42 WeakPolarHBondContact O-CB 3.44Å; L38-V42 VanDerWaalsContact O-CG2 3.25Å; L38-V42 WeakPolarHBondContact O-CG2 3.32Å; L38-V42 PolarHBondContact O-N 3.47Å; P39-V42 PolarHBondContact O-N 2.92Å; V42-Q44 PolarHBondContact O-N 3.37Å; V42-S45 WeakPolarHBondContact CA-OG 3.39Å; V42-S45 PolarHBondContact O-N 2.8Å; V42-S45 VanDerWaalsContact O-N 3.14Å; V42-S45 PolarHBondContact O-OG 3.42Å; V42-V46 HydrophobicContact CG1-CG2 4.46Å; V42-V46 WeakPolarHBondContact O-CG2 3.15Å; V42-V46 PolarHBondContact O-N 3.21Å
43	L	67.8	Low	63	Low	99 Å²	99	102.6 Å²	102.6	52%	0.518	53%	0.528	S	S	.	.	H	α-helix	trans	-58.8	-45.7	175.4	-71.7	169.6	0	0	0	111.6	P39 S45 V46 L47	P39-L43 WeakPolarHBondContact O-CB 3.24Å; P39-L43 WeakPolarHBondContact O-CD1 3.43Å; P39-L43 WeakPolarHBondContact O-CG 3.21Å; P39-L43 PolarHBondContact O-N 3.2Å; L43-S45 VanDerWaalsContact C-N 3.32Å; L43-S45 PolarHBondContact O-N 2.85Å; L43-V46 PolarHBondContact O-N 2.88Å; L43-L47 WeakPolarHBondContact O-CB 3.24Å; L43-L47 VanDerWaalsContact O-CG 3.23Å; L43-L47 WeakPolarHBondContact O-CG 3.47Å; L43-L47 PolarHBondContact O-N 2.78Å
44	Q	67.7	Low	63.3	Low	103 Å²	103	99.1 Å²	99.1	48%	0.481	53%	0.527	S	S	.	.	H	α-helix	trans	-62.6	-38.5	176.2	-71.7	-71.9	-24.6	0	0	111.8	N40 V42 K48	N40-Q44 WeakPolarHBondContact O-CB 2.7Å; N40-Q44 WeakPolarHBondContact O-CG 2.97Å; N40-Q44 PolarHBondContact O-N 2.94Å; V42-Q44 PolarHBondContact O-N 3.37Å; Q44-K48 WeakPolarHBondContact O-CB 3.32Å; Q44-K48 WeakPolarHBondContact O-CG 3.45Å; Q44-K48 PolarHBondContact O-N 3.5Å
45	S	67.9	Low	63.4	Low	58 Å²	58	99.1 Å²	99.1	41%	0.406	52%	0.522	S	S	.	.	H	α-helix	trans	-65.4	-42.8	174.1	68.1	0	0	0	0	112.3	R41 V42 L43 K48 Q49	R41-S45 WeakPolarHBondContact O-CB 3.4Å; R41-S45 PolarHBondContact O-N 2.77Å; R41-S45 PolarHBondContact O-OG 2.81Å; V42-S45 WeakPolarHBondContact CA-OG 3.39Å; V42-S45 PolarHBondContact O-N 2.8Å; V42-S45 VanDerWaalsContact O-N 3.14Å; V42-S45 PolarHBondContact O-OG 3.42Å; L43-S45 VanDerWaalsContact C-N 3.32Å; L43-S45 PolarHBondContact O-N 2.85Å; S45-K48 PolarHBondContact O-N 3.23Å; S45-Q49 WeakPolarHBondContact O-CB 3.28Å; S45-Q49 PolarHBondContact O-N 3.13Å
46	V	66	Low	63.6	Low	55 Å²	55	99 Å²	99	33%	0.333	52%	0.522	S	S	.	.	H	α-helix	trans	-65.4	-41.1	178.4	171.4	0	0	0	0	111.1	V42 L43 P52	V42-V46 HydrophobicContact CG1-CG2 4.46Å; V42-V46 WeakPolarHBondContact O-CG2 3.15Å; V42-V46 PolarHBondContact O-N 3.21Å; L43-V46 PolarHBondContact O-N 2.88Å; V46-P52 HydrophobicContact CG1-CG 4.38Å
47	L	67.3	Low	63.6	Low	108 Å²	108	102.6 Å²	102.6	57%	0.565	54%	0.535	S	S	*	.	H	α-helix	trans	-69.5	-40.3	176.7	-67.4	172.5	0	0	0	112.1	L43 G50	L43-L47 WeakPolarHBondContact O-CB 3.24Å; L43-L47 VanDerWaalsContact O-CG 3.23Å; L43-L47 WeakPolarHBondContact O-CG 3.47Å; L43-L47 PolarHBondContact O-N 2.78Å; L47-G50 PolarHBondContact O-N 3.32Å
48	K	67.3	Low	63.8	Low	174 Å²	174	104 Å²	104	76%	0.757	54%	0.543	S	S	*	.	H	α-helix	trans	-74	-27.4	178.3	-75.1	-173.6	175.6	-168.2	0	113.7	Q44 S45 G50	Q44-K48 WeakPolarHBondContact O-CB 3.32Å; Q44-K48 WeakPolarHBondContact O-CG 3.45Å; Q44-K48 PolarHBondContact O-N 3.5Å; S45-K48 PolarHBondContact O-N 3.23Å; K48-G50 PolarHBondContact O-N 3.26Å; K48-G50 VanDerWaalsContact O-N 3.16Å
49	Q	69.6	Low	63.7	Low	171 Å²	171	104.6 Å²	104.6	80%	0.799	55%	0.546	S	S	*	.	T	Hydrogen-bonded Turn	trans	-74.1	3.2	177.5	-166	167.3	-11.2	0	0	112.7	S45	S45-Q49 WeakPolarHBondContact O-CB 3.28Å; S45-Q49 PolarHBondContact O-N 3.13Å
50	G	65.3	Low	63.5	Low	43 Å²	43	104 Å²	104	44%	0.443	55%	0.547	S	S	.	.			trans	92.1	131.7	-179.4	0	0	0	0	0	110.1	L47 K48 P52	L47-G50 PolarHBondContact O-N 3.32Å; K48-G50 PolarHBondContact O-N 3.26Å; K48-G50 VanDerWaalsContact O-N 3.16Å; G50-P52 WeakPolarHBondContact O-CD 3.13Å
51	C	62.4	Low	63.2	Low	52 Å²	52	103.5 Å²	103.5	35%	0.351	55%	0.55	S	S	.	*			trans	-47.7	113.8	178.3	-91.9	0	0	0	0	109.6	K53 H56	C51-K53 PolarHBondContact O-N 3.45Å; C51-H56 WeakPolarHBondContact CB-NE2 3.25Å; C51-H56 PolarHBondContact O-NE2 3.48Å
52	P	63.6	Low	62.8	Low	57 Å²	57	98.7 Å²	98.7	37%	0.37	55%	0.55	S	S	.	*			trans	-60.8	137.8	173.4	-11.2	22.6	0	0	0	106.9	V46 G50 G54 Y55	V46-P52 HydrophobicContact CG1-CG 4.38Å; G50-P52 WeakPolarHBondContact O-CD 3.13Å; P52-G54 PolarHBondContact O-N 2.91Å; P52-Y55 HydrophobicContact CB-CD2 3.65Å; P52-Y55 HydrophobicContact CB-CE2 3.99Å; P52-Y55 HydrophobicContact CG-CD2 3.47Å; P52-Y55 VanDerWaalsContact CG-CD2 3.47Å; P52-Y55 HydrophobicContact CG-CE2 3.69Å; P52-Y55 PolarHBondContact O-N 2.8Å
53	K	61.5	Low	62.1	Low	196 Å²	196	99.6 Å²	99.6	85%	0.852	56%	0.556	S	S	*	*	T	Hydrogen-bonded Turn	trans	-52.6	-21	-167.9	-142.7	153	-176.3	171	0	114.5	C51	C51-K53 PolarHBondContact O-N 3.45Å
54	G	62.4	Low	61.5	Low	55 Å²	55	101.5 Å²	101.5	57%	0.567	57%	0.566	S	S	*	*	T	Hydrogen-bonded Turn	trans	-80	-19.2	173.6	0	0	0	0	0	116.4	P52	P52-G54 PolarHBondContact O-N 2.91Å
55	Y	58.8	Low	61.2	Low	135 Å²	135	104.3 Å²	104.3	53%	0.529	58%	0.579	S	S	.	*	T	Hydrogen-bonded Turn	trans	-87.9	-9.1	177	-66.9	-91.5	0	0	0	113.2	P52 L57 L58 L59	P52-Y55 HydrophobicContact CB-CD2 3.65Å; P52-Y55 HydrophobicContact CB-CE2 3.99Å; P52-Y55 HydrophobicContact CG-CD2 3.47Å; P52-Y55 VanDerWaalsContact CG-CD2 3.47Å; P52-Y55 HydrophobicContact CG-CE2 3.69Å; P52-Y55 PolarHBondContact O-N 2.8Å; Y55-L57 PolarHBondContact O-N 2.96Å; Y55-L58 HydrophobicContact CD1-CD1 4.18Å; Y55-L58 PolarHBondContact O-N 2.94Å; Y55-L59 PolarHBondContact O-N 3.05Å
56	H	59.2	Low	60.5	Low	102 Å²	102	106.3 Å²	106.3	47%	0.472	59%	0.591	S	S	.	*	H	α-helix	trans	-60.8	-32.7	173	-77.5	-116.4	0	0	0	112	C51 L58 L59 A60	C51-H56 WeakPolarHBondContact CB-NE2 3.25Å; C51-H56 PolarHBondContact O-NE2 3.48Å; H56-L58 VanDerWaalsContact C-N 3.32Å; H56-L58 PolarHBondContact O-N 3.33Å; H56-L59 PolarHBondContact O-N 3.04Å; H56-A60 WeakPolarHBondContact O-CB 3.33Å; H56-A60 PolarHBondContact O-N 3.17Å
57	L	58.3	Low	60	Low	132 Å²	132	109.9 Å²	109.9	69%	0.691	61%	0.608	S	S	*	*	H	α-helix	trans	-64.2	-36.8	178.6	-68.9	169.8	0	0	0	111.9	Y55 S61	Y55-L57 PolarHBondContact O-N 2.96Å; L57-S61 PolarHBondContact O-N 2.68Å; L57-S61 PolarHBondContact O-OG 3.04Å
58	L	60.2	Low	59.4	Low	121 Å²	121	114.2 Å²	114.2	63%	0.634	62%	0.622	S	S	*	*	H	α-helix	trans	-74.6	-37.6	178.5	-64.9	173.5	0	0	0	112.2	Y55 H56 A62	Y55-L58 HydrophobicContact CD1-CD1 4.18Å; Y55-L58 PolarHBondContact O-N 2.94Å; H56-L58 VanDerWaalsContact C-N 3.32Å; H56-L58 PolarHBondContact O-N 3.33Å; L58-A62 PolarHBondContact O-N 3.08Å
59	L	57.1	Low	58.4	Low	108 Å²	108	119.9 Å²	119.9	57%	0.565	64%	0.639	S	S	*	*	H	α-helix	trans	-69.5	-40.4	177.3	-171.7	62.5	0	0	0	111.8	Y55 H56 S61 A62 T63	Y55-L59 PolarHBondContact O-N 3.05Å; H56-L59 PolarHBondContact O-N 3.04Å; L59-S61 VanDerWaalsContact C-N 3.3Å; L59-S61 PolarHBondContact O-N 3.45Å; L59-A62 PolarHBondContact O-N 3.25Å; L59-T63 PolarHBondContact O-N 3.32Å; L59-T63 PolarHBondContact O-OG1 2.74Å
60	A	57.5	Low	57.8	Low	52 Å²	52	117.3 Å²	117.3	43%	0.43	63%	0.631	S	S	.	*	H	α-helix	trans	-62.8	-36.7	177.4	0	0	0	0	0	112.3	H56 A62 T63 L64	H56-A60 WeakPolarHBondContact O-CB 3.33Å; H56-A60 PolarHBondContact O-N 3.17Å; A60-A62 VanDerWaalsContact C-N 3.34Å; A60-A62 PolarHBondContact O-N 2.87Å; A60-T63 WeakPolarHBondContact CA-OG1 3.44Å; A60-T63 PolarHBondContact O-N 2.79Å; A60-T63 PolarHBondContact O-OG1 3.07Å; A60-L64 PolarHBondContact O-N 3.23Å
61	S	57.4	Low	57.4	Low	84 Å²	84	121.2 Å²	121.2	59%	0.587	64%	0.641	S	S	*	*	H	α-helix	trans	-68.7	-28.5	175.5	-67.3	0	0	0	0	113.6	L57 L59	L57-S61 PolarHBondContact O-N 2.68Å; L57-S61 PolarHBondContact O-OG 3.04Å; L59-S61 VanDerWaalsContact C-N 3.3Å; L59-S61 PolarHBondContact O-N 3.45Å
62	A	54.3	Low	57.1	Low	83 Å²	83	125.1 Å²	125.1	69%	0.686	66%	0.657	S	S	*	*	H	α-helix	trans	-78.1	-22.3	175.7	0	0	0	0	0	113.1	L58 L59 A60	L58-A62 PolarHBondContact O-N 3.08Å; L59-A62 PolarHBondContact O-N 3.25Å; A60-A62 VanDerWaalsContact C-N 3.34Å; A60-A62 PolarHBondContact O-N 2.87Å
63	T	53.7	Low	56.8	Low	103 Å²	103	129.1 Å²	129.1	63%	0.632	67%	0.673	S	S	*	*	H	α-helix	trans	-89.9	-7.9	176.3	50.6	0	0	0	0	114.3	L59 A60 Q65	L59-T63 PolarHBondContact O-N 3.32Å; L59-T63 PolarHBondContact O-OG1 2.74Å; A60-T63 WeakPolarHBondContact CA-OG1 3.44Å; A60-T63 PolarHBondContact O-N 2.79Å; A60-T63 PolarHBondContact O-OG1 3.07Å; T63-Q65 VanDerWaalsContact C-N 3.29Å; T63-Q65 PolarHBondContact O-N 3.17Å
64	L	53.5	Low	56.5	Low	139 Å²	139	124.9 Å²	124.9	73%	0.728	66%	0.662	S	S	*	*			trans	-73.8	89.5	168.8	-89.5	160.9	0	0	0	108.4	A60	A60-L64 PolarHBondContact O-N 3.23Å
65	Q	62.5	Low	56.1	Low	162 Å²	162	129.5 Å²	129.5	76%	0.757	67%	0.669	S	S	*	*			trans	-45	134.5	165.2	-75.1	-75.9	-4.8	0	0	109.3	T63 D67	T63-Q65 VanDerWaalsContact C-N 3.29Å; T63-Q65 PolarHBondContact O-N 3.17Å; Q65-D67 PolarHBondContact O-N 3.05Å
66	P	53.5	Low	55.9	Low	101 Å²	101	129.1 Å²	129.1	66%	0.656	68%	0.679	S	S	*	*			trans	-60.5	111.8	166.4	25.4	-29.9	0	0	0	106.9	K68	P66-K68 PolarHBondContact O-N 3.15Å
67	D	55.3	Low	55.6	Low	130 Å²	130	131.2 Å²	131.2	70%	0.695	69%	0.694	S	S	*	*			trans	-57.2	103.9	169.8	-172.6	36.1	0	0	0	106.7	Q65 R69	Q65-D67 PolarHBondContact O-N 3.05Å; D67-R69 VanDerWaalsContact C-N 3.3Å; D67-R69 PolarHBondContact O-N 3.04Å; D67-R69 VanDerWaalsContact O-N 3.07Å
68	K	53.3	Low	55.4	Low	199 Å²	199	131.2 Å²	131.2	87%	0.865	70%	0.695	S	S	*	*			trans	-75.7	90.9	170.4	-75.1	-175.2	177	179.5	0	106.5	P66	P66-K68 PolarHBondContact O-N 3.15Å
69	R	46.7	Very low	55	Low	292 Å²	292	132.1 Å²	132.1	100%	1.102	70%	0.7	S	S	*	*			trans	-105.5	0	155.2	-86	-171.2	-176.8	-174.2	1.8	110.2	D67	D67-R69 VanDerWaalsContact C-N 3.3Å; D67-R69 PolarHBondContact O-N 3.04Å; D67-R69 VanDerWaalsContact O-N 3.07Å

Retrieved 69 of 69 residues in 151.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).