A0A087WXB9_HUMAN Loading...

26S proteasome complex subunit SEM1

Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins.

AlphaFold DB , UniProt , Accession A0A087WXB9, Species HUMAN (Homo sapiens, Human), Gene SEM1, Length 61 aa.

						>A0A087WXB9_HUMAN|A0A087WXB9|SEM1
MSEKKQPVDLGLLEEDDEFEEFPAEDWAGLDEDEDAHVWEDNWDDDNVEDDFSNQLRSQNG
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	35.6	Very low	54.7	Low	241 Å²	241	142.9 Å²	142.9	100%	1.187	75%	0.747	S	S	*	*				0	106.5	0	-66.4	-67.6	-170.9	0	0	106.1	E3	M1-E3 PolarHBondContact O-N 3.32Å
2	S	47.8	Very low	55.1	Low	121 Å²	121	140.5 Å²	140.5	85%	0.846	73%	0.734	S	S	*	*			trans	-70.8	112	176.9	-68.6	0	0	0	0	109	K4	S2-K4 PolarHBondContact O-N 3.13Å
3	E	53.6	Low	55.2	Low	186 Å²	186	136.3 Å²	136.3	87%	0.869	71%	0.712	S	S	*	*			trans	-56.7	117.6	167.2	-160.6	90.4	76	0	0	107.6	M1 K5	M1-E3 PolarHBondContact O-N 3.32Å; E3-K5 PolarHBondContact O-N 2.79Å
4	K	49.7	Very low	55.2	Low	186 Å²	186	136 Å²	136	81%	0.809	71%	0.706	S	S	*	*			trans	-73.4	107.9	174	-67.6	-172.6	179.9	75.4	0	106.6	S2 Q6	S2-K4 PolarHBondContact O-N 3.13Å; K4-Q6 PolarHBondContact O-N 2.69Å
5	K	57.2	Low	55.2	Low	206 Å²	206	135.7 Å²	135.7	90%	0.896	70%	0.699	S	S	*	*			trans	-49.4	113.8	167.7	-75.1	174.7	175.1	170.7	0	107.6	E3	E3-K5 PolarHBondContact O-N 2.79Å
6	Q	60.2	Low	55.3	Low	162 Å²	162	135 Å²	135	76%	0.757	70%	0.697	S	S	*	*			trans	-50.1	139.3	168.9	-63.4	-86.8	-65.8	0	0	107.2	K4 V8	K4-Q6 PolarHBondContact O-N 2.69Å; Q6-V8 PolarHBondContact O-N 3.17Å
7	P	57.3	Low	55.8	Low	122 Å²	122	136 Å²	136	79%	0.792	70%	0.704	S	S	*	*			trans	-58.5	110.7	171.9	26.2	-31.3	0	0	0	106.2	D9	P7-D9 PolarHBondContact O-N 3.49Å
8	V	62	Low	56.4	Low	100 Å²	100	137.6 Å²	137.6	61%	0.606	71%	0.708	S	S	*	*			trans	-59.6	123.7	175.5	-175.2	0	0	0	0	105.6	Q6 L10 L13	Q6-V8 PolarHBondContact O-N 3.17Å; V8-L10 PolarHBondContact O-N 3.45Å; V8-L13 HydrophobicContact CB-CD1 4.37Å; V8-L13 HydrophobicContact CG1-CD1 3.5Å; V8-L13 HydrophobicContact CG1-CG 4.1Å
9	D	60.8	Low	56.9	Low	109 Å²	109	138.3 Å²	138.3	58%	0.583	71%	0.705	S	S	*	*			trans	-65.9	105.2	-178.7	-169.2	8.5	0	0	0	107.8	P7 G11 L12	P7-D9 PolarHBondContact O-N 3.49Å; D9-G11 PolarHBondContact O-N 3.28Å; D9-L12 HydrophobicContact CB-CD1 4.33Å; D9-L12 WeakPolarHBondContact O-CB 3.27Å; D9-L12 PolarHBondContact O-N 3.03Å
10	L	58	Low	57.3	Low	111 Å²	111	139.1 Å²	139.1	58%	0.581	71%	0.706	S	S	*	*	H	α-helix	trans	-66.6	-22.4	-172.9	-67.7	166.6	0	0	0	111.4	V8 L12 L13 E14	V8-L10 PolarHBondContact O-N 3.45Å; L10-L12 VanDerWaalsContact C-N 3.35Å; L10-L13 HydrophobicContact CD2-CD1 4.07Å; L10-L13 PolarHBondContact O-N 3.32Å; L10-L13 VanDerWaalsContact O-N 3.13Å; L10-E14 WeakPolarHBondContact O-CB 3.15Å; L10-E14 VanDerWaalsContact O-CG 3.27Å; L10-E14 WeakPolarHBondContact O-CG 3.42Å; L10-E14 PolarHBondContact O-N 2.83Å
11	G	60.1	Low	57.7	Low	28 Å²	28	141.9 Å²	141.9	29%	0.289	72%	0.717	S	S	.	*	H	α-helix	trans	-62.9	-40	173.4	0	0	0	0	0	112.6	D9 L13 E14 E15	D9-G11 PolarHBondContact O-N 3.28Å; G11-L13 PolarHBondContact O-N 3.38Å; G11-E14 PolarHBondContact O-N 3.25Å; G11-E15 VanDerWaalsContact O-CG 3.28Å; G11-E15 WeakPolarHBondContact O-CG 3.28Å; G11-E15 PolarHBondContact O-N 3.2Å
12	L	58.4	Low	59	Low	114 Å²	114	137 Å²	137	60%	0.597	69%	0.689	S	S	*	*	H	α-helix	trans	-67.9	-20.7	174.1	-102.7	150.8	0	0	0	113.5	D9 L10	D9-L12 HydrophobicContact CB-CD1 4.33Å; D9-L12 WeakPolarHBondContact O-CB 3.27Å; D9-L12 PolarHBondContact O-N 3.03Å; L10-L12 VanDerWaalsContact C-N 3.35Å
13	L	56.5	Low	60	Low	86 Å²	86	136.8 Å²	136.8	45%	0.45	68%	0.684	S	S	.	*	H	α-helix	trans	-91.5	-32.2	175.1	-68.7	171	0	0	0	111.9	V8 L10 G11 E15 D16	V8-L13 HydrophobicContact CB-CD1 4.37Å; V8-L13 HydrophobicContact CG1-CD1 3.5Å; V8-L13 HydrophobicContact CG1-CG 4.1Å; L10-L13 HydrophobicContact CD2-CD1 4.07Å; L10-L13 PolarHBondContact O-N 3.32Å; L10-L13 VanDerWaalsContact O-N 3.13Å; G11-L13 PolarHBondContact O-N 3.38Å; L13-E15 VanDerWaalsContact C-N 3.31Å; L13-D16 WeakPolarHBondContact O-CB 3.44Å; L13-D16 PolarHBondContact O-N 3.33Å
14	E	55.8	Low	60.5	Low	132 Å²	132	132.7 Å²	132.7	62%	0.617	68%	0.683	S	S	*	*	H	α-helix	trans	-68.9	-31	173.9	-74	171.1	-163.8	0	0	111.3	L10 G11 D16 D17 E18	L10-E14 WeakPolarHBondContact O-CB 3.15Å; L10-E14 VanDerWaalsContact O-CG 3.27Å; L10-E14 WeakPolarHBondContact O-CG 3.42Å; L10-E14 PolarHBondContact O-N 2.83Å; G11-E14 PolarHBondContact O-N 3.25Å; E14-D16 PolarHBondContact O-N 3.13Å; E14-D17 PolarHBondContact O-N 3.28Å; E14-E18 PolarHBondContact O-N 3.01Å
15	E	55.8	Low	61.2	Low	131 Å²	131	130.2 Å²	130.2	61%	0.612	67%	0.674	S	S	*	*	T	Hydrogen-bonded Turn	trans	-63.1	-26.2	170.6	-73	170.2	-147.3	0	0	113.1	G11 L13 E18	G11-E15 VanDerWaalsContact O-CG 3.28Å; G11-E15 WeakPolarHBondContact O-CG 3.28Å; G11-E15 PolarHBondContact O-N 3.2Å; L13-E15 VanDerWaalsContact C-N 3.31Å; E15-E18 PolarHBondContact O-N 3.26Å
16	D	56.6	Low	61.2	Low	125 Å²	125	127.2 Å²	127.2	67%	0.668	67%	0.668	S	S	*	*	T	Hydrogen-bonded Turn	trans	-79.3	-21	178.8	-146.8	22	0	0	0	112	L13 E14	L13-D16 WeakPolarHBondContact O-CB 3.44Å; L13-D16 PolarHBondContact O-N 3.33Å; E14-D16 PolarHBondContact O-N 3.13Å
17	D	62.5	Low	61.1	Low	152 Å²	152	126.5 Å²	126.5	81%	0.813	66%	0.658	S	S	*	*	S	Bend	trans	-86.5	-9.8	172.6	-82	-23.5	0	0	0	112.7	E14	E14-D17 PolarHBondContact O-N 3.28Å
18	E	67.2	Low	61.1	Low	165 Å²	165	125.2 Å²	125.2	77%	0.771	66%	0.658	S	S	*	*			trans	-96.4	6.2	179	-159.1	159.1	-157.4	0	0	112.8	E14 E15 E20	E14-E18 PolarHBondContact O-N 3.01Å; E15-E18 PolarHBondContact O-N 3.26Å; E18-E20 PolarHBondContact O-N 3.2Å
19	F	65.8	Low	60.7	Low	150 Å²	150	123.7 Å²	123.7	66%	0.658	66%	0.663	S	S	*	*	S	Bend	trans	-66.1	121.9	168	-154.8	-101.6	0	0	0	109.1	E21 F22	F19-E21 PolarHBondContact O-N 2.91Å; F19-F22 HydrophobicContact CD1-CD2 4.07Å; F19-F22 HydrophobicContact CD1-CE2 4.2Å; F19-F22 AromaticContact CE1-CD2 3.47Å; F19-F22 HydrophobicContact CE1-CD2 3.47Å; F19-F22 VanDerWaalsContact CE1-CD2 3.47Å; F19-F22 AromaticContact CE1-CE2 3.54Å; F19-F22 HydrophobicContact CE1-CE2 3.54Å; F19-F22 HydrophobicContact CZ-CD2 4.15Å; F19-F22 AromaticContact CZ-CE2 3.78Å; F19-F22 HydrophobicContact CZ-CE2 3.78Å
20	E	66.1	Low	60.4	Low	155 Å²	155	122.3 Å²	122.3	72%	0.724	66%	0.655	S	S	*	*			trans	-54.1	125.7	175	-69.8	-169.9	-178.7	0	0	108.6	E18 F22	E18-E20 PolarHBondContact O-N 3.2Å; E20-F22 WeakPolarHBondContact O-CD2 3.47Å; E20-F22 PolarHBondContact O-N 2.99Å
21	E	65.1	Low	60.2	Low	198 Å²	198	122.6 Å²	122.6	93%	0.925	66%	0.657	S	S	*	*			trans	-60.3	87.5	171.4	-74.9	-174.3	-176.6	0	0	108	F19	F19-E21 PolarHBondContact O-N 2.91Å
22	F	62.2	Low	60	Low	139 Å²	139	129.9 Å²	129.9	61%	0.61	68%	0.684	S	S	*	*			trans	-57.2	137.5	171	-76.5	-87.8	0	0	0	106.8	F19 E20 A24	F19-F22 HydrophobicContact CD1-CD2 4.07Å; F19-F22 HydrophobicContact CD1-CE2 4.2Å; F19-F22 AromaticContact CE1-CD2 3.47Å; F19-F22 HydrophobicContact CE1-CD2 3.47Å; F19-F22 VanDerWaalsContact CE1-CD2 3.47Å; F19-F22 AromaticContact CE1-CE2 3.54Å; F19-F22 HydrophobicContact CE1-CE2 3.54Å; F19-F22 HydrophobicContact CZ-CD2 4.15Å; F19-F22 AromaticContact CZ-CE2 3.78Å; F19-F22 HydrophobicContact CZ-CE2 3.78Å; E20-F22 WeakPolarHBondContact O-CD2 3.47Å; E20-F22 PolarHBondContact O-N 2.99Å; F22-A24 PolarHBondContact O-N 2.78Å; F22-A24 VanDerWaalsContact O-N 3.13Å
23	P	70.2	Confident	59.9	Low	115 Å²	115	129.7 Å²	129.7	75%	0.747	68%	0.683	S	S	*	*			trans	-50.8	130	172.7	22.1	-31	0	0	0	107.4	E25	P23-E25 PolarHBondContact O-N 2.86Å
24	A	63.1	Low	59.8	Low	101 Å²	101	131.5 Å²	131.5	84%	0.835	69%	0.689	S	S	*	*			trans	-52.7	107.5	176	0	0	0	0	0	107.3	F22 D26	F22-A24 PolarHBondContact O-N 2.78Å; F22-A24 VanDerWaalsContact O-N 3.13Å; A24-D26 PolarHBondContact O-N 3.02Å
25	E	63.6	Low	59.8	Low	133 Å²	133	128.6 Å²	128.6	62%	0.621	68%	0.678	S	S	*	*			trans	-63.5	126	176.4	-159.1	138.7	-160.7	0	0	105.6	P23 W27	P23-E25 PolarHBondContact O-N 2.86Å; E25-W27 HydrophobicContact CB-CZ2 4.36Å; E25-W27 PolarHBondContact O-N 3.17Å
26	D	58.5	Low	59.8	Low	143 Å²	143	124.3 Å²	124.3	77%	0.765	67%	0.665	S	S	*	*			trans	-74	77.3	-178	-152.6	-15.3	0	0	0	106.9	A24 A28	A24-D26 PolarHBondContact O-N 3.02Å; D26-A28 PolarHBondContact O-N 2.82Å; D26-A28 WeakPolarHBondContact OD1-CB 2.98Å
27	W	58.2	Low	59.9	Low	147 Å²	147	122.9 Å²	122.9	56%	0.557	65%	0.654	S	S	*	*	G	3₁₀ helix	trans	-60.7	3.1	179	-66	104.2	0	0	0	113	E25 G29 L30 D35	E25-W27 HydrophobicContact CB-CZ2 4.36Å; E25-W27 PolarHBondContact O-N 3.17Å; W27-G29 PolarHBondContact O-N 2.9Å; W27-L30 HydrophobicContact CE3-CB 4.49Å; W27-L30 HydrophobicContact CE3-CD1 3.91Å; W27-L30 HydrophobicContact CZ3-CD1 3.72Å; W27-D35 WeakPolarHBondContact CZ3-OD2 3.43Å
28	A	56.1	Low	59.8	Low	96 Å²	96	119.4 Å²	119.4	79%	0.793	64%	0.638	S	S	*	*	G	3₁₀ helix	trans	-67	4.6	178.7	0	0	0	0	0	114.6	D26	D26-A28 PolarHBondContact O-N 2.82Å; D26-A28 WeakPolarHBondContact OD1-CB 2.98Å
29	G	55.1	Low	59.6	Low	68 Å²	68	121.4 Å²	121.4	70%	0.701	64%	0.639	S	S	*	*	G	3₁₀ helix	trans	-152.1	6.1	-174.1	0	0	0	0	0	117.6	W27	W27-G29 PolarHBondContact O-N 2.9Å
30	L	54.4	Low	59.3	Low	79 Å²	79	120.2 Å²	120.2	41%	0.414	64%	0.635	S	S	.	*	S	Bend	trans	-91.8	118.4	162.5	-76.3	161.4	0	0	0	105.5	W27 E32	W27-L30 HydrophobicContact CE3-CB 4.49Å; W27-L30 HydrophobicContact CE3-CD1 3.91Å; W27-L30 HydrophobicContact CZ3-CD1 3.72Å; L30-E32 PolarHBondContact O-N 3.17Å; L30-E32 VanDerWaalsContact O-N 3.17Å
31	D	53.4	Low	59	Low	118 Å²	118	117.9 Å²	117.9	63%	0.631	63%	0.628	S	S	*	*			trans	-48.7	125.5	174.5	-80.6	-54.6	0	0	0	107.6	D33 E34	D31-D33 HydrophobicContact CB-CB 4.43Å; D31-D33 PolarHBondContact O-N 3.34Å; D31-E34 PolarHBondContact O-N 3.26Å
32	E	55.9	Low	58.6	Low	181 Å²	181	113.5 Å²	113.5	85%	0.846	61%	0.611	S	S	*	*	H	α-helix	trans	-52.1	-16.2	178.4	-76.9	177	168	0	0	112.4	L30	L30-E32 PolarHBondContact O-N 3.17Å; L30-E32 VanDerWaalsContact O-N 3.17Å
33	D	55.2	Low	58.9	Low	110 Å²	110	116.9 Å²	116.9	59%	0.588	62%	0.62	S	S	*	*	H	α-helix	trans	-71.5	-35.5	176	-57	-34.1	0	0	0	113.3	D31 H37	D31-D33 HydrophobicContact CB-CB 4.43Å; D31-D33 PolarHBondContact O-N 3.34Å; D33-H37 PolarHBondContact O-CD2 2.75Å; D33-H37 PolarHBondContact O-N 3.27Å; D33-H37 PolarHBondContact O-NE2 3.24Å
34	E	55.7	Low	58.4	Low	124 Å²	124	117.6 Å²	117.6	58%	0.579	62%	0.617	S	S	*	*	H	α-helix	trans	-72.2	-38.2	-175.9	-81.5	-163.8	149	0	0	113.4	D31	D31-E34 PolarHBondContact O-N 3.26Å
35	D	55.5	Low	58.2	Low	71 Å²	71	117.3 Å²	117.3	38%	0.38	60%	0.602	S	S	.	*	H	α-helix	trans	-71.8	-36.8	177	-84.5	-37.2	0	0	0	111.7	W27 H37 V38 W39	W27-D35 WeakPolarHBondContact CZ3-OD2 3.43Å; D35-H37 VanDerWaalsContact C-N 3.27Å; D35-H37 PolarHBondContact O-N 3.4Å; D35-V38 PolarHBondContact O-N 3.22Å; D35-W39 VanDerWaalsContact O-CD1 3.26Å
36	A	55.6	Low	58	Low	40 Å²	40	116.1 Å²	116.1	33%	0.331	60%	0.599	S	S	.	*	H	α-helix	trans	-61.8	-36.1	177.3	0	0	0	0	0	112	V38 W39 E40	A36-V38 VanDerWaalsContact C-N 3.3Å; A36-V38 PolarHBondContact O-N 3.34Å; A36-W39 PolarHBondContact O-N 2.88Å; A36-E40 WeakPolarHBondContact O-CG 3.15Å; A36-E40 PolarHBondContact O-N 2.96Å
37	H	58.9	Low	58.1	Low	95 Å²	95	115.3 Å²	115.3	44%	0.44	60%	0.595	S	S	.	*	H	α-helix	trans	-60.7	-35.1	177.7	-68.5	-38.5	0	0	0	113.2	D33 D35 W39 D41	D33-H37 PolarHBondContact O-CD2 2.75Å; D33-H37 PolarHBondContact O-N 3.27Å; D33-H37 PolarHBondContact O-NE2 3.24Å; D35-H37 VanDerWaalsContact C-N 3.27Å; D35-H37 PolarHBondContact O-N 3.4Å; H37-W39 VanDerWaalsContact C-N 3.31Å; H37-W39 PolarHBondContact O-N 3.3Å; H37-D41 WeakPolarHBondContact O-CB 3.49Å; H37-D41 PolarHBondContact O-N 3.37Å
38	V	60.7	Low	58	Low	80 Å²	80	112.8 Å²	112.8	49%	0.485	60%	0.595	S	S	.	*	H	α-helix	trans	-69.5	-30.3	-178.8	-177.3	0	0	0	0	112.2	D35 A36 N42	D35-V38 PolarHBondContact O-N 3.22Å; A36-V38 VanDerWaalsContact C-N 3.3Å; A36-V38 PolarHBondContact O-N 3.34Å; V38-N42 PolarHBondContact O-ND2 3.34Å
39	W	62.7	Low	58.1	Low	206 Å²	206	114.4 Å²	114.4	78%	0.78	59%	0.587	S	S	*	*	H	α-helix	trans	-91.4	-31.5	-179.4	-63.7	90.7	0	0	0	112.8	D35 A36 H37	D35-W39 VanDerWaalsContact O-CD1 3.26Å; A36-W39 PolarHBondContact O-N 2.88Å; H37-W39 VanDerWaalsContact C-N 3.31Å; H37-W39 PolarHBondContact O-N 3.3Å
40	E	58.3	Low	58.4	Low	125 Å²	125	115.4 Å²	115.4	58%	0.584	58%	0.576	S	S	*	*	H	α-helix	trans	-75.1	-43.2	175.1	-69.7	-172.6	169.9	0	0	111.9	A36 N42 W43 D44	A36-E40 WeakPolarHBondContact O-CG 3.15Å; A36-E40 PolarHBondContact O-N 2.96Å; E40-N42 VanDerWaalsContact C-N 3.34Å; E40-N42 PolarHBondContact O-N 3.27Å; E40-W43 PolarHBondContact O-N 3.02Å; E40-D44 PolarHBondContact O-N 3.39Å
41	D	60.8	Low	59.2	Low	106 Å²	106	117.6 Å²	117.6	57%	0.567	59%	0.588	S	S	*	*	H	α-helix	trans	-65.9	-36.4	-178.3	-74.3	-16.8	0	0	0	112.1	H37 D45	H37-D41 WeakPolarHBondContact O-CB 3.49Å; H37-D41 PolarHBondContact O-N 3.37Å; D41-D45 WeakPolarHBondContact O-CB 3.33Å; D41-D45 PolarHBondContact O-N 3.3Å
42	N	57.4	Low	59.8	Low	107 Å²	107	118.7 Å²	118.7	57%	0.572	59%	0.587	S	S	*	*	H	α-helix	trans	-81.1	-12.2	-177.8	-72.3	-39.3	0	0	0	114.1	V38 E40	V38-N42 PolarHBondContact O-ND2 3.34Å; E40-N42 VanDerWaalsContact C-N 3.34Å; E40-N42 PolarHBondContact O-N 3.27Å
43	W	67.7	Low	60.6	Low	210 Å²	210	112.3 Å²	112.3	80%	0.795	56%	0.563	S	S	*	*	H	α-helix	trans	-97.4	-32.3	177.7	-171.4	14.1	0	0	0	112.2	E40	E40-W43 PolarHBondContact O-N 3.02Å
44	D	59.5	Low	61.4	Low	130 Å²	130	110.3 Å²	110.3	70%	0.695	55%	0.552	S	S	*	*	H	α-helix	trans	-79.1	-19.6	172.7	-88.3	-22.2	0	0	0	113.2	E40 D46 N47	E40-D44 PolarHBondContact O-N 3.39Å; D44-D46 VanDerWaalsContact C-N 3.3Å; D44-D46 PolarHBondContact O-N 3.34Å; D44-N47 WeakPolarHBondContact O-CB 3.45Å; D44-N47 PolarHBondContact O-N 3.46Å
45	D	59.5	Low	62.4	Low	95 Å²	95	110 Å²	110	51%	0.508	55%	0.551	S	S	.	*	G	3₁₀ helix	trans	-72.3	-19.3	176.3	-159.9	19.6	0	0	0	113.3	D41 N47 V48	D41-D45 WeakPolarHBondContact O-CB 3.33Å; D41-D45 PolarHBondContact O-N 3.3Å; D45-N47 PolarHBondContact O-N 3.01Å; D45-N47 VanDerWaalsContact O-N 3.13Å; D45-V48 PolarHBondContact O-N 3.13Å
46	D	57.9	Low	63.4	Low	107 Å²	107	111 Å²	111	57%	0.572	56%	0.556	S	S	*	*	G	3₁₀ helix	trans	-62.2	-19.5	170.9	-83.1	-15.5	0	0	0	112.3	D44	D44-D46 VanDerWaalsContact C-N 3.3Å; D44-D46 PolarHBondContact O-N 3.34Å
47	N	60.6	Low	64.5	Low	126 Å²	126	118.5 Å²	118.5	67%	0.674	58%	0.575	S	S	*	*	G	3₁₀ helix	trans	-79	-22.5	175.1	-168.6	27.7	0	0	0	112.7	D44 D45	D44-N47 WeakPolarHBondContact O-CB 3.45Å; D44-N47 PolarHBondContact O-N 3.46Å; D45-N47 PolarHBondContact O-N 3.01Å; D45-N47 VanDerWaalsContact O-N 3.13Å
48	V	57.6	Low	65.3	Low	94 Å²	94	118.6 Å²	118.6	57%	0.57	59%	0.587	S	S	*	*	H	α-helix	trans	-78.4	-26.2	177.6	-175.4	0	0	0	0	111	D45 D50 D51	D45-V48 PolarHBondContact O-N 3.13Å; V48-D50 VanDerWaalsContact C-N 3.28Å; V48-D50 PolarHBondContact O-N 3.28Å; V48-D51 PolarHBondContact O-N 2.99Å
49	E	56.9	Low	65.9	Low	131 Å²	131	121.7 Å²	121.7	61%	0.612	60%	0.596	S	S	*	*	H	α-helix	trans	-69.3	-23.3	177.7	-145.5	-171.3	163.3	0	0	113.2	S53	E49-S53 WeakPolarHBondContact O-CB 3.43Å; E49-S53 PolarHBondContact O-N 2.99Å; E49-S53 PolarHBondContact O-OG 2.97Å
50	D	62.9	Low	66.1	Low	89 Å²	89	118.2 Å²	118.2	48%	0.476	59%	0.593	S	S	.	*	H	α-helix	trans	-71.2	-36.6	178.3	-164.4	42.3	0	0	0	112.1	V48 S53 N54	V48-D50 VanDerWaalsContact C-N 3.28Å; V48-D50 PolarHBondContact O-N 3.28Å; D50-S53 PolarHBondContact O-N 3.49Å; D50-N54 VanDerWaalsContact CG-ND2 3.33Å; D50-N54 VanDerWaalsContact O-CB 3.29Å; D50-N54 WeakPolarHBondContact O-CB 3.4Å; D50-N54 PolarHBondContact O-N 2.99Å; D50-N54 PolarHBondContact O-ND2 3.4Å; D50-N54 PolarHBondContact OD1-ND2 3.42Å; D50-N54 PolarHBondContact OD2-ND2 3.06Å
51	D	69.9	Low	65.9	Low	124 Å²	124	118.1 Å²	118.1	66%	0.663	63%	0.625	S	S	*	*	H	α-helix	trans	-68.5	-39	-179.2	-114.1	-1	0	0	0	112.3	V48 N54 Q55	V48-D51 PolarHBondContact O-N 2.99Å; D51-N54 PolarHBondContact O-N 3.35Å; D51-Q55 WeakPolarHBondContact O-CB 3.39Å; D51-Q55 PolarHBondContact O-N 3.28Å
52	F	66.6	Low	66.2	Low	141 Å²	141	118.7 Å²	118.7	62%	0.618	63%	0.628	S	S	*	*	H	α-helix	trans	-65.5	-42.2	174.2	-171.4	-100.1	0	0	0	111.6	Q55 L56	F52-Q55 PolarHBondContact O-N 3.47Å; F52-L56 WeakPolarHBondContact O-CB 3.45Å; F52-L56 PolarHBondContact O-N 3.38Å
53	S	73.4	Confident	66.6	Low	47 Å²	47	119.3 Å²	119.3	33%	0.329	63%	0.631	S	S	.	*	H	α-helix	trans	-65	-41.8	177.5	-67	0	0	0	0	112.4	E49 D50 L56 R57	E49-S53 WeakPolarHBondContact O-CB 3.43Å; E49-S53 PolarHBondContact O-N 2.99Å; E49-S53 PolarHBondContact O-OG 2.97Å; D50-S53 PolarHBondContact O-N 3.49Å; S53-L56 PolarHBondContact O-N 3.45Å; S53-R57 WeakPolarHBondContact O-CB 3.4Å; S53-R57 WeakPolarHBondContact O-CG 3.29Å; S53-R57 PolarHBondContact O-N 2.85Å
54	N	71.4	Confident	66.6	Low	68 Å²	68	114.3 Å²	114.3	36%	0.364	62%	0.622	S	S	.	*	H	α-helix	trans	-64.9	-41.5	175.8	-73.9	-36.9	0	0	0	111.6	D50 D51 R57 S58	D50-N54 VanDerWaalsContact CG-ND2 3.33Å; D50-N54 VanDerWaalsContact O-CB 3.29Å; D50-N54 WeakPolarHBondContact O-CB 3.4Å; D50-N54 PolarHBondContact O-N 2.99Å; D50-N54 PolarHBondContact O-ND2 3.4Å; D50-N54 PolarHBondContact OD1-ND2 3.42Å; D50-N54 PolarHBondContact OD2-ND2 3.06Å; D51-N54 PolarHBondContact O-N 3.35Å; N54-R57 PolarHBondContact O-N 3.06Å; N54-S58 WeakPolarHBondContact O-CB 3.45Å; N54-S58 PolarHBondContact O-N 3.49Å
55	Q	77.4	Confident	67	Low	118 Å²	118	113.4 Å²	113.4	55%	0.551	62%	0.617	S	S	*	*	H	α-helix	trans	-65.8	-41	176.5	-166.3	177.4	23.8	0	0	112.5	D51 F52 S58 Q59	D51-Q55 WeakPolarHBondContact O-CB 3.39Å; D51-Q55 PolarHBondContact O-N 3.28Å; F52-Q55 PolarHBondContact O-N 3.47Å; Q55-S58 PolarHBondContact O-N 3.09Å; Q55-Q59 PolarHBondContact O-N 3.35Å; Q55-Q59 VanDerWaalsContact O-N 3.09Å
56	L	75.7	Confident	67.5	Low	93 Å²	93	114.5 Å²	114.5	49%	0.487	62%	0.624	S	S	.	*	H	α-helix	trans	-66.6	-40.9	178.3	-169.5	72.2	0	0	0	111.8	F52 S53 Q59 N60	F52-L56 WeakPolarHBondContact O-CB 3.45Å; F52-L56 PolarHBondContact O-N 3.38Å; S53-L56 PolarHBondContact O-N 3.45Å; L56-Q59 PolarHBondContact O-N 2.99Å; L56-N60 WeakPolarHBondContact O-CB 3.36Å; L56-N60 PolarHBondContact O-N 3.49Å; L56-N60 PolarHBondContact O-ND2 3.49Å
57	R	77.8	Confident	68.1	Low	196 Å²	196	115 Å²	115	74%	0.74	63%	0.628	S	S	*	*	H	α-helix	trans	-64.2	-39.5	173.7	-78.1	176.6	160.1	-176.7	-1.7	112.3	S53 N54 Q59 G61	S53-R57 WeakPolarHBondContact O-CB 3.4Å; S53-R57 WeakPolarHBondContact O-CG 3.29Å; S53-R57 PolarHBondContact O-N 2.85Å; N54-R57 PolarHBondContact O-N 3.06Å; R57-Q59 VanDerWaalsContact C-N 3.31Å; R57-Q59 PolarHBondContact O-N 3.47Å; R57-G61 PolarHBondContact O-N 3.02Å
58	S	76.8	Confident	68.6	Low	98 Å²	98	114.2 Å²	114.2	69%	0.685	62%	0.624	S	S	*	*	H	α-helix	trans	-69.6	-24.7	177	-174.3	0	0	0	0	113.6	N54 Q55	N54-S58 WeakPolarHBondContact O-CB 3.45Å; N54-S58 PolarHBondContact O-N 3.49Å; Q55-S58 PolarHBondContact O-N 3.09Å
59	Q	72.3	Confident	69.5	Low	144 Å²	144	115.8 Å²	115.8	67%	0.673	63%	0.629	S	S	*	*	H	α-helix	trans	-89.3	-27.6	177.3	-93.4	179.6	74.3	0	0	113.9	Q55 L56 R57	Q55-Q59 PolarHBondContact O-N 3.35Å; Q55-Q59 VanDerWaalsContact O-N 3.09Å; L56-Q59 PolarHBondContact O-N 2.99Å; R57-Q59 VanDerWaalsContact C-N 3.31Å; R57-Q59 PolarHBondContact O-N 3.47Å
60	N	66.9	Low	70.5	Confident	134 Å²	134	114.5 Å²	114.5	72%	0.717	63%	0.63	S	S	*	*			trans	-94.3	8	-177.9	-77.6	-36.8	0	0	0	114.2	L56	L56-N60 WeakPolarHBondContact O-CB 3.36Å; L56-N60 PolarHBondContact O-N 3.49Å; L56-N60 PolarHBondContact O-ND2 3.49Å
61	G	55.1	Low	71.2	Confident	122 Å²	122	116.8 Å²	116.8	100%	1.258	64%	0.644	S	S	*	*			trans	-109.1	0	170	0	0	0	0	0	111.5	R57	R57-G61 PolarHBondContact O-N 3.02Å

Retrieved 61 of 61 residues in 62.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).