A0A087WXF7_HUMAN Loading...

Inhibitor of growth family member 1

AlphaFold DB , UniProt , Accession A0A087WXF7, Species HUMAN (Homo sapiens, Human), Gene ING1, Length 111 aa.

						>A0A087WXF7_HUMAN|A0A087WXF7|ING1
MSFVECPYHSPAERLVAEADEGGPSAITEILKELDECYERFSRETDGAQKRRMLHCVQRALIRSQELGDEKIQIVSQMVELVENRTRQVDSHVELFEAQQELGDTAGNSGK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	37.6	Very low	43.8	Very low	243 Å²	243	138.5 Å²	138.5	100%	1.197	74%	0.735	S	S	*	*				0	100	0	-101.6	84	173.2	0	0	108.4	F3	M1-F3 PolarHBondContact O-N 3.12Å
2	S	35.6	Very low	43.8	Very low	113 Å²	113	129.4 Å²	129.4	79%	0.79	69%	0.694	S	S	*	*			trans	-75.4	109.8	163.7	41.6	0	0	0	0	107.2	V4	S2-V4 PolarHBondContact O-N 2.83Å
3	F	40.2	Very low	44	Very low	191 Å²	191	127.3 Å²	127.3	84%	0.838	68%	0.677	S	S	*	*			trans	-53.8	118.6	163.3	-167.2	-98.9	0	0	0	106.1	M1 E5	M1-F3 PolarHBondContact O-N 3.12Å; F3-E5 VanDerWaalsContact C-N 3.26Å; F3-E5 PolarHBondContact O-N 3.49Å
4	V	44.8	Very low	44.1	Very low	118 Å²	118	131.1 Å²	131.1	72%	0.715	68%	0.678	S	S	*	*			trans	-64.9	95.3	174.8	174.3	0	0	0	0	105.8	S2 C6	S2-V4 PolarHBondContact O-N 2.83Å; V4-C6 PolarHBondContact O-N 2.89Å
5	E	43.4	Very low	44.4	Very low	168 Å²	168	128 Å²	128	79%	0.785	66%	0.662	S	S	*	*			trans	-61.8	107.7	158.6	-83.7	-169.3	130.6	0	0	106	F3 P7	F3-E5 VanDerWaalsContact C-N 3.26Å; F3-E5 PolarHBondContact O-N 3.49Å; E5-P7 VanDerWaalsContact O-CD 3.25Å; E5-P7 WeakPolarHBondContact O-CD 3.3Å
6	C	38.1	Very low	44.7	Very low	95 Å²	95	125.3 Å²	125.3	64%	0.642	65%	0.653	S	S	*	*			trans	-61	115.2	169.3	-102.9	0	0	0	0	107.9	V4 Y8	V4-C6 PolarHBondContact O-N 2.89Å; C6-Y8 PolarHBondContact O-N 3.04Å
7	P	45.4	Very low	44.8	Very low	111 Å²	111	121.6 Å²	121.6	72%	0.721	65%	0.645	S	S	*	*			trans	-83.6	9.8	-174.9	34.1	-33.1	0	0	0	112.8	E5	E5-P7 VanDerWaalsContact O-CD 3.25Å; E5-P7 WeakPolarHBondContact O-CD 3.3Å
8	Y	46.4	Very low	44.9	Very low	186 Å²	186	121.1 Å²	121.1	73%	0.729	64%	0.638	S	S	*	*			trans	-105.9	93.8	175	-65.1	-80.4	0	0	0	108	C6 S10	C6-Y8 PolarHBondContact O-N 3.04Å; Y8-S10 PolarHBondContact O-N 3.31Å
9	H	50.3	Low	45	Very low	156 Å²	156	118.1 Å²	118.1	72%	0.722	63%	0.632	S	S	*	*			trans	-62.7	83.9	152.5	-157	-6.4	0	0	0	106.1	E13	H9-E13 VanDerWaalsContact CA-OE2 3.28Å; H9-E13 WeakPolarHBondContact CA-OE2 3.39Å; H9-E13 IonicContact CE1-OE2 3.22Å; H9-E13 PolarHBondContact CE1-OE2 3.22Å; H9-E13 IonicContact CG-OE2 3.71Å; H9-E13 IonicContact ND1-OE2 3.85Å; H9-E13 PolarHBondContact ND1-OE2 3.44Å
10	S	48	Very low	44.9	Very low	42 Å²	42	119 Å²	119	29%	0.294	64%	0.637	S	S	.	*			trans	-68.2	150.7	-168.2	176.9	0	0	0	0	109	Y8 A12 E13 R14	Y8-S10 PolarHBondContact O-N 3.31Å; S10-A12 PolarHBondContact O-N 2.87Å; S10-A12 WeakPolarHBondContact OG-CB 3.42Å; S10-A12 PolarHBondContact OG-N 3.35Å; S10-E13 PolarHBondContact O-N 3.42Å; S10-R14 PolarHBondContact O-N 3.22Å
11	P	52.4	Low	44.9	Very low	100 Å²	100	121.7 Å²	121.7	65%	0.649	65%	0.646	S	S	*	*	H	α-helix	trans	-46.9	-29.5	164.2	-26.2	33.9	0	0	0	112.2	R14 L15	P11-R14 CarbonylContact O-C 3.57Å; P11-R14 PolarHBondContact O-N 3.16Å; P11-L15 WeakPolarHBondContact O-CB 3.37Å; P11-L15 WeakPolarHBondContact O-CG 3.21Å; P11-L15 PolarHBondContact O-N 3.39Å
12	A	43.3	Very low	45.3	Very low	30 Å²	30	111.3 Å²	111.3	25%	0.248	60%	0.601	C	S	.	*	H	α-helix	trans	-64	-37.5	173.1	0	0	0	0	0	114.3	S10 R14 L15 V16 L81	S10-A12 PolarHBondContact O-N 2.87Å; S10-A12 WeakPolarHBondContact OG-CB 3.42Å; S10-A12 PolarHBondContact OG-N 3.35Å; A12-R14 VanDerWaalsContact C-N 3.34Å; A12-L15 PolarHBondContact O-N 3.46Å; A12-V16 WeakPolarHBondContact O-CB 3.22Å; A12-V16 WeakPolarHBondContact O-CG2 3.15Å; A12-V16 PolarHBondContact O-N 3.39Å; A12-L81 HydrophobicContact CB-CD1 4.37Å
13	E	46.6	Very low	45.8	Very low	102 Å²	102	106.9 Å²	106.9	48%	0.477	57%	0.573	S	S	.	*	H	α-helix	trans	-71.6	-31.8	173.1	-78.1	-176.3	154.9	0	0	111.6	H9 S10 A17	H9-E13 VanDerWaalsContact CA-OE2 3.28Å; H9-E13 WeakPolarHBondContact CA-OE2 3.39Å; H9-E13 IonicContact CE1-OE2 3.22Å; H9-E13 PolarHBondContact CE1-OE2 3.22Å; H9-E13 IonicContact CG-OE2 3.71Å; H9-E13 IonicContact ND1-OE2 3.85Å; H9-E13 PolarHBondContact ND1-OE2 3.44Å; S10-E13 PolarHBondContact O-N 3.42Å; E13-A17 WeakPolarHBondContact O-CB 3.25Å; E13-A17 PolarHBondContact O-N 2.78Å
14	R	45.5	Very low	46.4	Very low	180 Å²	180	102.9 Å²	102.9	68%	0.679	57%	0.566	S	S	*	*	H	α-helix	trans	-69	-36.3	170.6	-166.8	-179	-88.5	-153.8	-4.7	111.5	S10 P11 A12 E18	S10-R14 PolarHBondContact O-N 3.22Å; P11-R14 CarbonylContact O-C 3.57Å; P11-R14 PolarHBondContact O-N 3.16Å; A12-R14 VanDerWaalsContact C-N 3.34Å; R14-E18 VanDerWaalsContact O-CB 3.23Å; R14-E18 WeakPolarHBondContact O-CB 3.48Å; R14-E18 VanDerWaalsContact O-CG 3.3Å; R14-E18 WeakPolarHBondContact O-CG 3.16Å; R14-E18 PolarHBondContact O-N 2.79Å
15	L	48.7	Very low	47.3	Very low	85 Å²	85	100.5 Å²	100.5	45%	0.445	56%	0.555	S	S	.	*	H	α-helix	trans	-70.7	-35.3	173.8	-72.5	163.9	0	0	0	112.7	P11 A12 A19	P11-L15 WeakPolarHBondContact O-CB 3.37Å; P11-L15 WeakPolarHBondContact O-CG 3.21Å; P11-L15 PolarHBondContact O-N 3.39Å; A12-L15 PolarHBondContact O-N 3.46Å; L15-A19 PolarHBondContact O-N 3.3Å
16	V	49.3	Very low	48.8	Very low	85 Å²	85	94.3 Å²	94.3	52%	0.515	53%	0.532	S	S	.	.	H	α-helix	trans	-75.6	-33.8	174.4	171	0	0	0	0	111.1	A12 A19 M78	A12-V16 WeakPolarHBondContact O-CB 3.22Å; A12-V16 WeakPolarHBondContact O-CG2 3.15Å; A12-V16 PolarHBondContact O-N 3.39Å; V16-A19 WeakPolarHBondContact O-CB 3.4Å; V16-A19 PolarHBondContact O-N 3.2Å; V16-M78 HydrophobicContact CG2-CE 4.32Å
17	A	46.6	Very low	50.8	Low	63 Å²	63	92.9 Å²	92.9	52%	0.521	52%	0.518	S	S	.	.	H	α-helix	trans	-72.3	-36.9	170.8	0	0	0	0	0	112.1	E13 A19 D20	E13-A17 WeakPolarHBondContact O-CB 3.25Å; E13-A17 PolarHBondContact O-N 2.78Å; A17-A19 PolarHBondContact O-N 2.83Å; A17-D20 WeakPolarHBondContact O-CB 3.37Å; A17-D20 PolarHBondContact O-N 3.13Å; A17-D20 VanDerWaalsContact O-N 3.1Å
18	E	45.6	Very low	52.5	Low	112 Å²	112	91.5 Å²	91.5	52%	0.523	51%	0.507	S	S	.	.	H	α-helix	trans	-68.7	-19.7	169.9	-80.9	-179.9	152.6	0	0	112.3	R14 D20 E21 G22	R14-E18 VanDerWaalsContact O-CB 3.23Å; R14-E18 WeakPolarHBondContact O-CB 3.48Å; R14-E18 VanDerWaalsContact O-CG 3.3Å; R14-E18 WeakPolarHBondContact O-CG 3.16Å; R14-E18 PolarHBondContact O-N 2.79Å; E18-D20 PolarHBondContact O-N 2.78Å; E18-E21 CarbonylContact O-C 3.49Å; E18-E21 PolarHBondContact O-N 3.28Å; E18-E21 VanDerWaalsContact O-N 3.12Å; E18-G22 PolarHBondContact O-N 3.49Å
19	A	46.4	Very low	54.5	Low	63 Å²	63	88.3 Å²	88.3	52%	0.521	50%	0.499	S	S	.	.	H	α-helix	trans	-66.9	-15.7	169.9	0	0	0	0	0	112.7	L15 V16 A17 G22	L15-A19 PolarHBondContact O-N 3.3Å; V16-A19 WeakPolarHBondContact O-CB 3.4Å; V16-A19 PolarHBondContact O-N 3.2Å; A17-A19 PolarHBondContact O-N 2.83Å; A19-G22 CarbonylContact O-C 3.5Å
20	D	43.2	Very low	56.3	Low	137 Å²	137	81.7 Å²	81.7	73%	0.733	47%	0.469	S	S	*	.	H	α-helix	trans	-87.1	-28.3	170.2	-160.1	49	0	0	0	112.3	A17 E18 G22 G23	A17-D20 WeakPolarHBondContact O-CB 3.37Å; A17-D20 PolarHBondContact O-N 3.13Å; A17-D20 VanDerWaalsContact O-N 3.1Å; E18-D20 PolarHBondContact O-N 2.78Å; D20-G22 PolarHBondContact O-N 3.3Å; D20-G23 PolarHBondContact O-N 3.29Å
21	E	45.7	Very low	58.3	Low	176 Å²	176	83.7 Å²	83.7	82%	0.822	48%	0.476	S	S	*	.	H	α-helix	trans	-77.4	-8	166.8	-63.7	-69.3	156.4	0	0	112.4	E18	E18-E21 CarbonylContact O-C 3.49Å; E18-E21 PolarHBondContact O-N 3.28Å; E18-E21 VanDerWaalsContact O-N 3.12Å
22	G	46.2	Very low	60.2	Low	24 Å²	24	85.2 Å²	85.2	25%	0.247	47%	0.472	C	S	.	.	T	Hydrogen-bonded Turn	trans	-111.5	29.4	171.4	0	0	0	0	0	113	E18 A19 D20 K71	E18-G22 PolarHBondContact O-N 3.49Å; A19-G22 CarbonylContact O-C 3.5Å; D20-G22 PolarHBondContact O-N 3.3Å; G22-K71 PolarHBondContact O-NZ 2.88Å
23	G	45	Very low	62.5	Low	20 Å²	20	87.3 Å²	87.3	21%	0.206	48%	0.477	C	S	.	.	S	Bend	trans	-54.5	176.6	175.6	0	0	0	0	0	113.3	D20 S25 A26	D20-G23 PolarHBondContact O-N 3.29Å; G23-S25 PolarHBondContact O-N 3.29Å; G23-A26 PolarHBondContact O-N 2.96Å
24	P	54.2	Low	64.8	Low	108 Å²	108	83.6 Å²	83.6	70%	0.701	46%	0.46	S	S	*	.	T	Hydrogen-bonded Turn	trans	-47	-19.3	-177.3	14.7	-29.2	0	0	0	115.1	A26 T28	P24-A26 PolarHBondContact O-N 3.31Å; P24-T28 WeakPolarHBondContact O-CA 3.49Å; P24-T28 WeakPolarHBondContact O-CB 3.46Å; P24-T28 PolarHBondContact O-N 2.83Å; P24-T28 PolarHBondContact O-OG1 2.84Å
25	S	63.5	Low	67.1	Low	67 Å²	67	80.1 Å²	80.1	47%	0.469	46%	0.455	S	S	.	.	H	α-helix	trans	-48.4	-56.2	175.6	142	0	0	0	0	114.5	G23 I27 T28 E29	G23-S25 PolarHBondContact O-N 3.29Å; S25-I27 PolarHBondContact O-N 2.9Å; S25-T28 PolarHBondContact O-N 3.47Å; S25-E29 WeakPolarHBondContact CB-OE1 3.21Å; S25-E29 WeakPolarHBondContact O-CB 3.43Å; S25-E29 WeakPolarHBondContact O-CG 3.18Å; S25-E29 PolarHBondContact O-N 3.42Å; S25-E29 PolarHBondContact OG-OE1 3.49Å
26	A	73.9	Confident	69.3	Low	38 Å²	38	80 Å²	80	31%	0.314	45%	0.452	S	S	.	.	H	α-helix	trans	-67.5	-44.6	-170	0	0	0	0	0	113.1	G23 P24 I30 L67	G23-A26 PolarHBondContact O-N 2.96Å; P24-A26 PolarHBondContact O-N 3.31Å; A26-I30 VanDerWaalsContact O-CG1 3.27Å; A26-I30 WeakPolarHBondContact O-CG1 3.37Å; A26-I30 PolarHBondContact O-N 3.38Å; A26-I30 VanDerWaalsContact O-N 3.12Å; A26-L67 HydrophobicContact CB-CD2 4.21Å
27	I	80.2	Confident	71.5	Confident	66 Å²	66	76.9 Å²	76.9	34%	0.338	43%	0.434	S	S	.	.	H	α-helix	trans	-68.5	-45.1	175.8	-74.2	171.9	0	0	0	110.1	S25 E29 I30 L31 L67 K71	S25-I27 PolarHBondContact O-N 2.9Å; I27-E29 VanDerWaalsContact C-N 3.3Å; I27-E29 PolarHBondContact O-N 3.31Å; I27-I30 PolarHBondContact O-N 2.92Å; I27-L31 HydrophobicContact CG2-CD1 3.68Å; I27-L31 HydrophobicContact CG2-CG 4.17Å; I27-L31 WeakPolarHBondContact O-CB 3.26Å; I27-L31 WeakPolarHBondContact O-CG 3.43Å; I27-L31 PolarHBondContact O-N 2.95Å; I27-L67 HydrophobicContact CG1-CD2 3.53Å; I27-L67 HydrophobicContact CG1-CG 4.26Å; I27-K71 HydrophobicContact CD1-CD 4.05Å
28	T	82.5	Confident	73.9	Confident	82 Å²	82	79.8 Å²	79.8	50%	0.503	43%	0.432	S	S	.	.	H	α-helix	trans	-64	-35.1	179.4	-62.7	0	0	0	0	112	P24 S25 K32	P24-T28 WeakPolarHBondContact O-CA 3.49Å; P24-T28 WeakPolarHBondContact O-CB 3.46Å; P24-T28 PolarHBondContact O-N 2.83Å; P24-T28 PolarHBondContact O-OG1 2.84Å; S25-T28 PolarHBondContact O-N 3.47Å; T28-K32 WeakPolarHBondContact O-CB 3.5Å; T28-K32 PolarHBondContact O-N 3.44Å
29	E	87.4	Confident	76.3	Confident	119 Å²	119	78.5 Å²	78.5	56%	0.556	43%	0.426	S	S	*	.	H	α-helix	trans	-67.9	-46.1	176.2	-78	167.5	-148.5	0	0	111.8	S25 I27 K32 E33	S25-E29 WeakPolarHBondContact CB-OE1 3.21Å; S25-E29 WeakPolarHBondContact O-CB 3.43Å; S25-E29 WeakPolarHBondContact O-CG 3.18Å; S25-E29 PolarHBondContact O-N 3.42Å; S25-E29 PolarHBondContact OG-OE1 3.49Å; I27-E29 VanDerWaalsContact C-N 3.3Å; I27-E29 PolarHBondContact O-N 3.31Å; E29-K32 PolarHBondContact O-N 2.06Å; E29-E33 WeakPolarHBondContact O-CB 3.31Å; E29-E33 PolarHBondContact O-N 3Å
30	I	88.6	Confident	78.6	Confident	17 Å²	17	82.3 Å²	82.3	9%	0.087	43%	0.427	C	S	.	.	H	α-helix	trans	-67.2	-40.4	177.9	-61.4	169.2	0	0	0	110.6	A26 I27 K32 E33 L34 S64 L67	A26-I30 VanDerWaalsContact O-CG1 3.27Å; A26-I30 WeakPolarHBondContact O-CG1 3.37Å; A26-I30 PolarHBondContact O-N 3.38Å; A26-I30 VanDerWaalsContact O-N 3.12Å; I27-I30 PolarHBondContact O-N 2.92Å; I30-K32 VanDerWaalsContact C-N 3.33Å; I30-K32 PolarHBondContact O-N 3.32Å; I30-E33 PolarHBondContact O-N 2.87Å; I30-L34 VanDerWaalsContact O-CB 3.31Å; I30-L34 WeakPolarHBondContact O-CB 3.32Å; I30-L34 PolarHBondContact O-N 3.47Å; I30-S64 WeakPolarHBondContact CG2-OG 3.21Å; I30-L67 HydrophobicContact CD1-CD2 3.72Å
31	L	89.9	Confident	81.1	Confident	83 Å²	83	77.9 Å²	77.9	44%	0.435	40%	0.401	S	S	.	.	H	α-helix	trans	-64.2	-39.5	175.7	-70.3	177.9	0	0	0	111.7	I27 L34 D35	I27-L31 HydrophobicContact CG2-CD1 3.68Å; I27-L31 HydrophobicContact CG2-CG 4.17Å; I27-L31 WeakPolarHBondContact O-CB 3.26Å; I27-L31 WeakPolarHBondContact O-CG 3.43Å; I27-L31 PolarHBondContact O-N 2.95Å; L31-L34 HydrophobicContact CD2-CD2 4.48Å; L31-L34 WeakPolarHBondContact O-CB 3.44Å; L31-L34 PolarHBondContact O-N 3.31Å; L31-D35 PolarHBondContact O-N 3.14Å
32	K	91.7	Very high	83.4	Confident	132 Å²	132	72.6 Å²	72.6	57%	0.574	38%	0.384	S	S	*	.	H	α-helix	trans	-64.6	-44	173.8	-175.5	-177.2	175	-172.3	0	111.8	T28 E29 I30 L34 D35 E36	T28-K32 WeakPolarHBondContact O-CB 3.5Å; T28-K32 PolarHBondContact O-N 3.44Å; E29-K32 PolarHBondContact O-N 2.06Å; I30-K32 VanDerWaalsContact C-N 3.33Å; I30-K32 PolarHBondContact O-N 3.32Å; K32-L34 VanDerWaalsContact C-N 3.29Å; K32-L34 PolarHBondContact O-N 3.34Å; K32-D35 PolarHBondContact O-N 3.05Å; K32-E36 WeakPolarHBondContact CE-OE1 3.49Å; K32-E36 WeakPolarHBondContact O-CG 3.11Å; K32-E36 PolarHBondContact O-N 3.31Å
33	E	92.2	Very high	85.8	Confident	74 Å²	74	80.7 Å²	80.7	35%	0.346	41%	0.407	S	S	.	.	H	α-helix	trans	-59.5	-41.8	174.2	-174.1	-172.3	159.1	0	0	111.1	E29 I30 E36 C37 R63	E29-E33 WeakPolarHBondContact O-CB 3.31Å; E29-E33 PolarHBondContact O-N 3Å; I30-E33 PolarHBondContact O-N 2.87Å; E33-E36 PolarHBondContact O-N 3.44Å; E33-C37 PolarHBondContact O-N 2.79Å; E33-R63 IonicContact OE1-NH1 3.99Å; E33-R63 PolarHBondContact OE1-NH1 3.49Å; E33-R63 IonicContact OE2-CZ 3.5Å; E33-R63 IonicContact OE2-NH1 2.72Å; E33-R63 PolarHBondContact OE2-NH1 3.25Å; E33-R63 IonicContact OE2-NH2 3.2Å
34	L	94.5	Very high	88.2	Confident	25 Å²	25	81.2 Å²	81.2	13%	0.131	40%	0.404	C	S	.	.	H	α-helix	trans	-63.7	-47.4	177.5	177.7	62.4	0	0	0	111.7	I30 L31 K32 E36 C37 Y38 V57 A60 L61	I30-L34 VanDerWaalsContact O-CB 3.31Å; I30-L34 WeakPolarHBondContact O-CB 3.32Å; I30-L34 PolarHBondContact O-N 3.47Å; L31-L34 HydrophobicContact CD2-CD2 4.48Å; L31-L34 WeakPolarHBondContact O-CB 3.44Å; L31-L34 PolarHBondContact O-N 3.31Å; K32-L34 VanDerWaalsContact C-N 3.29Å; K32-L34 PolarHBondContact O-N 3.34Å; L34-E36 VanDerWaalsContact C-N 3.33Å; L34-E36 PolarHBondContact O-N 2.7Å; L34-C37 PolarHBondContact O-N 3.47Å; L34-Y38 VanDerWaalsContact O-CB 3.31Å; L34-Y38 WeakPolarHBondContact O-CB 2.98Å; L34-Y38 PolarHBondContact O-N 3.46Å; L34-V57 HydrophobicContact CD1-CG1 3.95Å; L34-A60 HydrophobicContact CB-CB 4.17Å; L34-A60 HydrophobicContact CD1-CB 3.88Å; L34-L61 HydrophobicContact CD1-CD2 3.92Å; L34-L61 HydrophobicContact CD1-CG 3.74Å; L34-L61 HydrophobicContact CD2-CD2 3.6Å; L34-L61 HydrophobicContact CD2-CG 4.33Å; L34-L61 HydrophobicContact CG-CD2 4.42Å
35	D	94.8	Very high	90.1	Very high	106 Å²	106	82.5 Å²	82.5	57%	0.567	41%	0.41	S	S	*	.	H	α-helix	trans	-59.2	-45.1	175.9	-78.3	-17.7	0	0	0	110.8	L31 K32 Y38 E39	L31-D35 PolarHBondContact O-N 3.14Å; K32-D35 PolarHBondContact O-N 3.05Å; D35-Y38 PolarHBondContact O-N 3.2Å; D35-E39 WeakPolarHBondContact O-CB 3.22Å; D35-E39 WeakPolarHBondContact O-CG 3.35Å; D35-E39 PolarHBondContact O-N 2.87Å
36	E	94.9	Very high	91.7	Very high	84 Å²	84	82.9 Å²	82.9	39%	0.393	41%	0.407	S	S	.	.	H	α-helix	trans	-62.1	-44.8	176.4	-74.3	-176.3	-155	0	0	112.3	K32 E33 L34 R40	K32-E36 WeakPolarHBondContact CE-OE1 3.49Å; K32-E36 WeakPolarHBondContact O-CG 3.11Å; K32-E36 PolarHBondContact O-N 3.31Å; E33-E36 PolarHBondContact O-N 3.44Å; L34-E36 VanDerWaalsContact C-N 3.33Å; L34-E36 PolarHBondContact O-N 2.7Å; E36-R40 WeakPolarHBondContact O-CG 3.29Å; E36-R40 PolarHBondContact O-N 2.9Å; E36-R40 VanDerWaalsContact O-N 3.16Å; E36-R40 IonicContact OE2-NH2 3.12Å; E36-R40 PolarHBondContact OE2-NH2 3.13Å
37	C	94.3	Very high	92.7	Very high	18 Å²	18	83.4 Å²	83.4	12%	0.122	42%	0.416	C	S	.	.	H	α-helix	trans	-68.3	-35.8	178	-96.2	0	0	0	0	112.2	E33 L34 F41 C56 V57	E33-C37 PolarHBondContact O-N 2.79Å; L34-C37 PolarHBondContact O-N 3.47Å; C37-F41 VanDerWaalsContact O-CB 3.32Å; C37-F41 WeakPolarHBondContact O-CB 3.49Å; C37-F41 PolarHBondContact O-N 3.35Å; C37-C56 HydrophobicContact CB-CB 4.03Å; C37-C56 WeakPolarHBondContact CB-SG 3.15Å; C37-C56 WeakPolarHBondContact SG-CB 3.44Å; C37-C56 CovalentContact SG-SG 2.06Å; C37-C56 PolarHBondContact SG-SG 2.74Å; C37-V57 HydrophobicContact CB-CG2 4.03Å
38	Y	96.2	Very high	93.5	Very high	125 Å²	125	82.5 Å²	82.5	49%	0.49	42%	0.418	S	S	.	.	H	α-helix	trans	-67.8	-46.8	176.2	-179.4	-97.6	0	0	0	112.1	L34 D35 R40 F41 S42	L34-Y38 VanDerWaalsContact O-CB 3.31Å; L34-Y38 WeakPolarHBondContact O-CB 2.98Å; L34-Y38 PolarHBondContact O-N 3.46Å; D35-Y38 PolarHBondContact O-N 3.2Å; Y38-R40 VanDerWaalsContact C-N 3.32Å; Y38-R40 PolarHBondContact O-N 2.76Å; Y38-F41 WeakPolarHBondContact O-CB 3.46Å; Y38-F41 PolarHBondContact O-N 3.35Å; Y38-F41 VanDerWaalsContact O-N 3.13Å; Y38-S42 WeakPolarHBondContact O-CB 3.27Å; Y38-S42 PolarHBondContact O-N 3.2Å
39	E	96.4	Very high	94	Very high	85 Å²	85	82.6 Å²	82.6	40%	0.397	41%	0.413	S	S	.	.	H	α-helix	trans	-58	-45.5	177.5	-84	-63.5	131.2	0	0	111.7	D35 S42 R43	D35-E39 WeakPolarHBondContact O-CB 3.22Å; D35-E39 WeakPolarHBondContact O-CG 3.35Å; D35-E39 PolarHBondContact O-N 2.87Å; E39-S42 PolarHBondContact O-N 3.34Å; E39-R43 VanDerWaalsContact O-CG 3.3Å; E39-R43 WeakPolarHBondContact O-CG 3.27Å; E39-R43 PolarHBondContact O-N 2.87Å; E39-R43 IonicContact OE2-CZ 3.43Å; E39-R43 IonicContact OE2-NE 2.76Å; E39-R43 PolarHBondContact OE2-NE 3.4Å; E39-R43 VanDerWaalsContact OE2-NE 3.12Å; E39-R43 IonicContact OE2-NH2 2.83Å; E39-R43 PolarHBondContact OE2-NH2 3.35Å
40	R	94.3	Very high	94.5	Very high	142 Å²	142	80.4 Å²	80.4	54%	0.536	40%	0.402	S	S	.	.	H	α-helix	trans	-62.7	-45	176.3	-66.6	174.8	-167.3	174.9	11.9	110.6	E36 Y38 S42 R43 E44 M53	E36-R40 WeakPolarHBondContact O-CG 3.29Å; E36-R40 PolarHBondContact O-N 2.9Å; E36-R40 VanDerWaalsContact O-N 3.16Å; E36-R40 IonicContact OE2-NH2 3.12Å; E36-R40 PolarHBondContact OE2-NH2 3.13Å; Y38-R40 VanDerWaalsContact C-N 3.32Å; Y38-R40 PolarHBondContact O-N 2.76Å; R40-S42 VanDerWaalsContact C-N 3.34Å; R40-S42 PolarHBondContact O-N 2.9Å; R40-R43 PolarHBondContact O-N 3.37Å; R40-E44 PolarHBondContact O-N 2.97Å; R40-M53 HydrophobicContact CB-CE 3.3Å; R40-M53 WeakPolarHBondContact O-CE 3.31Å
41	F	96.1	Very high	94.8	Very high	44 Å²	44	88 Å²	88	19%	0.193	43%	0.429	C	S	.	.	H	α-helix	trans	-61.9	-40.2	178.5	165.6	-96.3	0	0	0	112.7	C37 Y38 R43 E44 K50 M53 L54 V57	C37-F41 VanDerWaalsContact O-CB 3.32Å; C37-F41 WeakPolarHBondContact O-CB 3.49Å; C37-F41 PolarHBondContact O-N 3.35Å; Y38-F41 WeakPolarHBondContact O-CB 3.46Å; Y38-F41 PolarHBondContact O-N 3.35Å; Y38-F41 VanDerWaalsContact O-N 3.13Å; F41-R43 VanDerWaalsContact C-N 3.34Å; F41-R43 PolarHBondContact O-N 3.16Å; F41-E44 PolarHBondContact O-N 2.94Å; F41-K50 HydrophobicContact CD2-CG 3.79Å; F41-K50 WeakPolarHBondContact CD2-O 3.35Å; F41-K50 HydrophobicContact CE2-CD 4.28Å; F41-K50 HydrophobicContact CE2-CG 3.38Å; F41-K50 WeakPolarHBondContact CE2-O 3.34Å; F41-K50 HydrophobicContact CZ-CG 4.12Å; F41-M53 HydrophobicContact CB-CB 4.12Å; F41-M53 HydrophobicContact CD2-CB 4.15Å; F41-L54 HydrophobicContact CD2-CB 4.14Å; F41-L54 HydrophobicContact CE2-CB 3.79Å; F41-L54 HydrophobicContact CE2-CD1 4.1Å; F41-L54 HydrophobicContact CE2-CG 4.44Å; F41-L54 HydrophobicContact CZ-CD1 4.13Å; F41-V57 HydrophobicContact CB-CG2 4.14Å
42	S	95.1	Very high	95	Very high	66 Å²	66	91.1 Å²	91.1	46%	0.462	44%	0.435	S	S	.	.	H	α-helix	trans	-64.2	-39.9	-178.9	-173.1	0	0	0	0	111.8	Y38 E39 R40 E44	Y38-S42 WeakPolarHBondContact O-CB 3.27Å; Y38-S42 PolarHBondContact O-N 3.2Å; E39-S42 PolarHBondContact O-N 3.34Å; R40-S42 VanDerWaalsContact C-N 3.34Å; R40-S42 PolarHBondContact O-N 2.9Å; S42-E44 VanDerWaalsContact C-N 3.34Å
43	R	95.4	Very high	95.2	Very high	193 Å²	193	86.7 Å²	86.7	73%	0.728	42%	0.417	S	S	*	.	H	α-helix	trans	-79	-14.6	179.5	-63.5	169.5	-169.3	-128.2	2.1	113.7	E39 R40 F41	E39-R43 VanDerWaalsContact O-CG 3.3Å; E39-R43 WeakPolarHBondContact O-CG 3.27Å; E39-R43 PolarHBondContact O-N 2.87Å; E39-R43 IonicContact OE2-CZ 3.43Å; E39-R43 IonicContact OE2-NE 2.76Å; E39-R43 PolarHBondContact OE2-NE 3.4Å; E39-R43 VanDerWaalsContact OE2-NE 3.12Å; E39-R43 IonicContact OE2-NH2 2.83Å; E39-R43 PolarHBondContact OE2-NH2 3.35Å; R40-R43 PolarHBondContact O-N 3.37Å; F41-R43 VanDerWaalsContact C-N 3.34Å; F41-R43 PolarHBondContact O-N 3.16Å
44	E	96.4	Very high	95.4	Very high	32 Å²	32	86.4 Å²	86.4	15%	0.15	42%	0.417	C	S	.	.			trans	-73.9	132.3	-177.8	-174.1	56.8	-100	0	0	112.2	R40 F41 S42 D46 Q49 K50 M53	R40-E44 PolarHBondContact O-N 2.97Å; F41-E44 PolarHBondContact O-N 2.94Å; S42-E44 VanDerWaalsContact C-N 3.34Å; E44-D46 PolarHBondContact OE1-N 3.44Å; E44-Q49 HydrophobicContact CG-CB 3.96Å; E44-Q49 HydrophobicContact CG-CG 4.12Å; E44-Q49 VanDerWaalsContact OE2-CG 3.22Å; E44-Q49 WeakPolarHBondContact OE2-CG 3.04Å; E44-Q49 PolarHBondContact OE2-NE2 3.09Å; E44-K50 HydrophobicContact CB-CB 4.36Å; E44-K50 HydrophobicContact CG-CB 3.92Å; E44-K50 PolarHBondContact O-NZ 3.32Å; E44-M53 HydrophobicContact CB-CE 4.25Å; E44-M53 HydrophobicContact CB-SD 3.64Å; E44-M53 HydrophobicContact CG-SD 3.59Å; E44-M53 VanDerWaalsContact CG-SD 3.59Å
45	T	94.8	Very high	95.4	Very high	134 Å²	134	90.4 Å²	90.4	82%	0.822	44%	0.435	S	S	*	.			trans	-108.4	-26.9	-178.3	56.3	0	0	0	0	112.8	G47	T45-G47 PolarHBondContact O-N 2.91Å
46	D	97.1	Very high	95.4	Very high	76 Å²	76	87.2 Å²	87.2	41%	0.406	42%	0.421	S	S	.	.			trans	-73.9	123.2	176.7	174.8	57.3	0	0	0	110.9	E44 A48 Q49 K50	E44-D46 PolarHBondContact OE1-N 3.44Å; D46-A48 VanDerWaalsContact C-N 3.31Å; D46-A48 PolarHBondContact O-N 3.42Å; D46-A48 WeakPolarHBondContact OD2-CB 3.36Å; D46-A48 PolarHBondContact OD2-N 3.18Å; D46-Q49 HydrophobicContact CB-CB 3.94Å; D46-Q49 PolarHBondContact O-N 3.4Å; D46-Q49 VanDerWaalsContact OD2-CB 3.25Å; D46-Q49 WeakPolarHBondContact OD2-CB 3.47Å; D46-Q49 PolarHBondContact OD2-N 2.73Å; D46-K50 WeakPolarHBondContact O-CB 3.36Å; D46-K50 PolarHBondContact O-N 3.12Å
47	G	94.5	Very high	95.5	Very high	48 Å²	48	83.8 Å²	83.8	50%	0.495	41%	0.406	S	S	.	.	H	α-helix	trans	-64.3	-31.6	-174.5	0	0	0	0	0	114.1	T45 R51	T45-G47 PolarHBondContact O-N 2.91Å; G47-R51 PolarHBondContact O-N 3.25Å
48	A	95.6	Very high	95.6	Very high	48 Å²	48	87 Å²	87	40%	0.397	42%	0.419	S	S	.	.	H	α-helix	trans	-75.4	-42.2	177.8	0	0	0	0	0	111.2	D46 R51 R52	D46-A48 VanDerWaalsContact C-N 3.31Å; D46-A48 PolarHBondContact O-N 3.42Å; D46-A48 WeakPolarHBondContact OD2-CB 3.36Å; D46-A48 PolarHBondContact OD2-N 3.18Å; A48-R51 PolarHBondContact O-N 3.16Å; A48-R52 PolarHBondContact O-N 3.05Å
49	Q	95	Very high	95.6	Very high	84 Å²	84	89.8 Å²	89.8	39%	0.393	43%	0.428	S	S	.	.	H	α-helix	trans	-68.3	-41.8	176.9	-164.2	155.1	-45.8	0	0	111.9	E44 D46 R51 R52 M53	E44-Q49 HydrophobicContact CG-CB 3.96Å; E44-Q49 HydrophobicContact CG-CG 4.12Å; E44-Q49 VanDerWaalsContact OE2-CG 3.22Å; E44-Q49 WeakPolarHBondContact OE2-CG 3.04Å; E44-Q49 PolarHBondContact OE2-NE2 3.09Å; D46-Q49 HydrophobicContact CB-CB 3.94Å; D46-Q49 PolarHBondContact O-N 3.4Å; D46-Q49 VanDerWaalsContact OD2-CB 3.25Å; D46-Q49 WeakPolarHBondContact OD2-CB 3.47Å; D46-Q49 PolarHBondContact OD2-N 2.73Å; Q49-R51 VanDerWaalsContact C-N 3.27Å; Q49-R51 PolarHBondContact O-N 3.43Å; Q49-R52 WeakPolarHBondContact O-CA 3.28Å; Q49-R52 WeakPolarHBondContact O-CB 3.39Å; Q49-R52 PolarHBondContact O-N 3.41Å; Q49-M53 HydrophobicContact CG-SD 3.91Å; Q49-M53 VanDerWaalsContact O-CG 3.26Å; Q49-M53 WeakPolarHBondContact O-CG 3.47Å; Q49-M53 PolarHBondContact O-N 3.49Å
50	K	96.3	Very high	95.5	Very high	72 Å²	72	85.7 Å²	85.7	31%	0.313	41%	0.409	S	S	.	.	H	α-helix	trans	-57.1	-41.6	174.5	-169.1	165.7	-161.7	139.1	0	111.9	F41 E44 D46 M53 L54	F41-K50 HydrophobicContact CD2-CG 3.79Å; F41-K50 WeakPolarHBondContact CD2-O 3.35Å; F41-K50 HydrophobicContact CE2-CD 4.28Å; F41-K50 HydrophobicContact CE2-CG 3.38Å; F41-K50 WeakPolarHBondContact CE2-O 3.34Å; F41-K50 HydrophobicContact CZ-CG 4.12Å; E44-K50 HydrophobicContact CB-CB 4.36Å; E44-K50 HydrophobicContact CG-CB 3.92Å; E44-K50 PolarHBondContact O-NZ 3.32Å; D46-K50 WeakPolarHBondContact O-CB 3.36Å; D46-K50 PolarHBondContact O-N 3.12Å; K50-M53 PolarHBondContact O-N 3.37Å; K50-L54 PolarHBondContact O-N 3.12Å
51	R	96.1	Very high	95.6	Very high	177 Å²	177	83 Å²	83	67%	0.668	41%	0.405	S	S	*	.	H	α-helix	trans	-65.3	-39.9	175.5	-157.8	-174.1	-55.1	-171.6	2.1	112.3	G47 A48 Q49 L54 H55	G47-R51 PolarHBondContact O-N 3.25Å; A48-R51 PolarHBondContact O-N 3.16Å; Q49-R51 VanDerWaalsContact C-N 3.27Å; Q49-R51 PolarHBondContact O-N 3.43Å; R51-L54 PolarHBondContact O-N 3.43Å; R51-H55 PolarHBondContact O-CD2 3Å; R51-H55 PolarHBondContact O-N 3.09Å
52	R	94.2	Very high	95.6	Very high	149 Å²	149	85.2 Å²	85.2	56%	0.562	42%	0.418	S	S	*	.	H	α-helix	trans	-64.3	-40.3	173.9	-70.1	-172	-66.7	-89.8	1.6	111.9	A48 Q49 H55 C56	A48-R52 PolarHBondContact O-N 3.05Å; Q49-R52 WeakPolarHBondContact O-CA 3.28Å; Q49-R52 WeakPolarHBondContact O-CB 3.39Å; Q49-R52 PolarHBondContact O-N 3.41Å; R52-H55 WeakPolarHBondContact O-CB 3.33Å; R52-H55 PolarHBondContact O-N 3.3Å; R52-C56 PolarHBondContact O-N 2.95Å
53	M	95	Very high	95.6	Very high	39 Å²	39	87 Å²	87	19%	0.192	42%	0.415	C	S	.	.	H	α-helix	trans	-71.6	-32.8	-179.8	-65.2	166	86	0	0	112.3	R40 F41 E44 Q49 K50 H55 C56 V57	R40-M53 HydrophobicContact CB-CE 3.3Å; R40-M53 WeakPolarHBondContact O-CE 3.31Å; F41-M53 HydrophobicContact CB-CB 4.12Å; F41-M53 HydrophobicContact CD2-CB 4.15Å; E44-M53 HydrophobicContact CB-CE 4.25Å; E44-M53 HydrophobicContact CB-SD 3.64Å; E44-M53 HydrophobicContact CG-SD 3.59Å; E44-M53 VanDerWaalsContact CG-SD 3.59Å; Q49-M53 HydrophobicContact CG-SD 3.91Å; Q49-M53 VanDerWaalsContact O-CG 3.26Å; Q49-M53 WeakPolarHBondContact O-CG 3.47Å; Q49-M53 PolarHBondContact O-N 3.49Å; K50-M53 PolarHBondContact O-N 3.37Å; M53-H55 PolarHBondContact O-N 3.13Å; M53-C56 WeakPolarHBondContact O-CA 3.4Å; M53-C56 VanDerWaalsContact O-CB 3.29Å; M53-C56 WeakPolarHBondContact O-CB 3.43Å; M53-C56 PolarHBondContact O-N 2.9Å; M53-V57 PolarHBondContact O-N 2.98Å; M53-V57 VanDerWaalsContact O-N 3.14Å
54	L	96.2	Very high	95.4	Very high	67 Å²	67	79.2 Å²	79.2	35%	0.351	39%	0.39	S	S	.	.	H	α-helix	trans	-56.5	-39.1	170.9	-176.3	60.7	0	0	0	111.6	F41 K50 R51 C56 V57 Q58	F41-L54 HydrophobicContact CD2-CB 4.14Å; F41-L54 HydrophobicContact CE2-CB 3.79Å; F41-L54 HydrophobicContact CE2-CD1 4.1Å; F41-L54 HydrophobicContact CE2-CG 4.44Å; F41-L54 HydrophobicContact CZ-CD1 4.13Å; K50-L54 PolarHBondContact O-N 3.12Å; R51-L54 PolarHBondContact O-N 3.43Å; L54-C56 VanDerWaalsContact C-N 3.3Å; L54-C56 PolarHBondContact O-N 3.4Å; L54-V57 PolarHBondContact O-N 3.34Å; L54-Q58 WeakPolarHBondContact O-CG 3.37Å; L54-Q58 PolarHBondContact O-N 3.49Å
55	H	95.9	Very high	95.4	Very high	110 Å²	110	83.8 Å²	83.8	51%	0.509	41%	0.411	S	S	.	.	H	α-helix	trans	-65	-30.9	174.1	-73.2	-61.4	0	0	0	113.1	R51 R52 M53 Q58 R59	R51-H55 PolarHBondContact O-CD2 3Å; R51-H55 PolarHBondContact O-N 3.09Å; R52-H55 WeakPolarHBondContact O-CB 3.33Å; R52-H55 PolarHBondContact O-N 3.3Å; M53-H55 PolarHBondContact O-N 3.13Å; H55-Q58 PolarHBondContact ND1-OE1 3.06Å; H55-R59 VanDerWaalsContact O-CG 3.27Å; H55-R59 WeakPolarHBondContact O-CG 3.34Å; H55-R59 PolarHBondContact O-N 2.95Å; H55-R59 VanDerWaalsContact O-N 3.09Å
56	C	94.2	Very high	95.4	Very high	38 Å²	38	82.5 Å²	82.5	26%	0.257	40%	0.396	S	S	.	.	H	α-helix	trans	-62	-52.1	170.7	-178.5	0	0	0	0	110.5	C37 R52 M53 L54 Q58 R59 A60	C37-C56 HydrophobicContact CB-CB 4.03Å; C37-C56 WeakPolarHBondContact CB-SG 3.15Å; C37-C56 WeakPolarHBondContact SG-CB 3.44Å; C37-C56 CovalentContact SG-SG 2.06Å; C37-C56 PolarHBondContact SG-SG 2.74Å; R52-C56 PolarHBondContact O-N 2.95Å; M53-C56 WeakPolarHBondContact O-CA 3.4Å; M53-C56 VanDerWaalsContact O-CB 3.29Å; M53-C56 WeakPolarHBondContact O-CB 3.43Å; M53-C56 PolarHBondContact O-N 2.9Å; L54-C56 VanDerWaalsContact C-N 3.3Å; L54-C56 PolarHBondContact O-N 3.4Å; C56-Q58 VanDerWaalsContact C-N 3.3Å; C56-Q58 PolarHBondContact O-N 2.95Å; C56-R59 PolarHBondContact O-N 3.26Å; C56-R59 VanDerWaalsContact O-N 3.13Å; C56-A60 PolarHBondContact O-N 2.97Å
57	V	96.1	Very high	94.9	Very high	13 Å²	13	80.4 Å²	80.4	8%	0.079	39%	0.385	C	S	.	.	H	α-helix	trans	-57.5	-45.5	-178.8	178.1	0	0	0	0	110.7	L34 C37 F41 M53 L54 R59 A60 L61	L34-V57 HydrophobicContact CD1-CG1 3.95Å; C37-V57 HydrophobicContact CB-CG2 4.03Å; F41-V57 HydrophobicContact CB-CG2 4.14Å; M53-V57 PolarHBondContact O-N 2.98Å; M53-V57 VanDerWaalsContact O-N 3.14Å; L54-V57 PolarHBondContact O-N 3.34Å; V57-R59 PolarHBondContact O-N 3.49Å; V57-A60 PolarHBondContact O-N 3.28Å; V57-L61 HydrophobicContact CG1-CD1 4.03Å; V57-L61 HydrophobicContact CG1-CG 4.49Å; V57-L61 WeakPolarHBondContact O-CG 3.48Å; V57-L61 PolarHBondContact O-N 3.3Å
58	Q	97.5	Very high	94.7	Very high	85 Å²	85	79.5 Å²	79.5	40%	0.397	38%	0.375	S	S	.	.	H	α-helix	trans	-59.7	-44.3	177	-74	175.1	-23.9	0	0	112.5	L54 H55 C56 L61 I62	L54-Q58 WeakPolarHBondContact O-CG 3.37Å; L54-Q58 PolarHBondContact O-N 3.49Å; H55-Q58 PolarHBondContact ND1-OE1 3.06Å; C56-Q58 VanDerWaalsContact C-N 3.3Å; C56-Q58 PolarHBondContact O-N 2.95Å; Q58-L61 PolarHBondContact O-N 3.07Å; Q58-I62 VanDerWaalsContact O-CG1 3.28Å; Q58-I62 WeakPolarHBondContact O-CG1 3.35Å; Q58-I62 PolarHBondContact O-N 3.47Å
59	R	96	Very high	94.6	Very high	183 Å²	183	81.5 Å²	81.5	69%	0.691	38%	0.379	S	S	*	.	H	α-helix	trans	-65.7	-39.8	178.7	-72.7	180	72	-151.7	-0.4	112.2	H55 C56 V57 R63	H55-R59 VanDerWaalsContact O-CG 3.27Å; H55-R59 WeakPolarHBondContact O-CG 3.34Å; H55-R59 PolarHBondContact O-N 2.95Å; H55-R59 VanDerWaalsContact O-N 3.09Å; C56-R59 PolarHBondContact O-N 3.26Å; C56-R59 VanDerWaalsContact O-N 3.13Å; V57-R59 PolarHBondContact O-N 3.49Å; R59-R63 WeakPolarHBondContact O-CG 3.3Å; R59-R63 PolarHBondContact O-N 2.84Å; R59-R63 VanDerWaalsContact O-N 3.13Å
60	A	93.6	Very high	94.3	Very high	0 Å²	0	82.9 Å²	82.9	0%	0	39%	0.386	C	S	.	.	H	α-helix	trans	-64.2	-42.2	175.1	0	0	0	0	0	111.4	L34 C56 V57 R63 S64	L34-A60 HydrophobicContact CB-CB 4.17Å; L34-A60 HydrophobicContact CD1-CB 3.88Å; C56-A60 PolarHBondContact O-N 2.97Å; V57-A60 PolarHBondContact O-N 3.28Å; A60-R63 PolarHBondContact O-N 3.43Å; A60-S64 PolarHBondContact O-N 3.4Å; A60-S64 PolarHBondContact O-OG 2.82Å
61	L	96.5	Very high	93.8	Very high	85 Å²	85	83.5 Å²	83.5	45%	0.445	39%	0.389	S	S	.	.	H	α-helix	trans	-61.7	-45	175.7	-74.9	169.1	0	0	0	113	L34 V57 Q58 R63 S64 Q65	L34-L61 HydrophobicContact CD1-CD2 3.92Å; L34-L61 HydrophobicContact CD1-CG 3.74Å; L34-L61 HydrophobicContact CD2-CD2 3.6Å; L34-L61 HydrophobicContact CD2-CG 4.33Å; L34-L61 HydrophobicContact CG-CD2 4.42Å; V57-L61 HydrophobicContact CG1-CD1 4.03Å; V57-L61 HydrophobicContact CG1-CG 4.49Å; V57-L61 WeakPolarHBondContact O-CG 3.48Å; V57-L61 PolarHBondContact O-N 3.3Å; Q58-L61 PolarHBondContact O-N 3.07Å; L61-R63 VanDerWaalsContact C-N 3.34Å; L61-R63 PolarHBondContact O-N 2.99Å; L61-S64 WeakPolarHBondContact O-CB 3.23Å; L61-S64 PolarHBondContact O-N 3.1Å; L61-Q65 PolarHBondContact O-N 2.98Å
62	I	96.4	Very high	93.6	Very high	91 Å²	91	80.1 Å²	80.1	47%	0.467	38%	0.383	S	S	.	.	H	α-helix	trans	-59.2	-48.2	177.5	-69.4	163.1	0	0	0	109.9	Q58 S64 Q65 E66	Q58-I62 VanDerWaalsContact O-CG1 3.28Å; Q58-I62 WeakPolarHBondContact O-CG1 3.35Å; Q58-I62 PolarHBondContact O-N 3.47Å; I62-S64 PolarHBondContact O-N 2.81Å; I62-Q65 PolarHBondContact O-N 2.77Å; I62-Q65 VanDerWaalsContact O-N 3.09Å; I62-E66 HydrophobicContact CG2-CG 4.28Å; I62-E66 WeakPolarHBondContact CG2-OE1 3.37Å; I62-E66 WeakPolarHBondContact O-CG 3.14Å; I62-E66 PolarHBondContact O-N 3.28Å
63	R	94.1	Very high	93.6	Very high	103 Å²	103	78.6 Å²	78.6	39%	0.389	38%	0.382	S	S	.	.	H	α-helix	trans	-60.5	-41.6	177.7	-72.4	172.8	63.2	-148.2	-5	112.8	E33 R59 A60 L61 Q65 L67	E33-R63 IonicContact OE1-NH1 3.99Å; E33-R63 PolarHBondContact OE1-NH1 3.49Å; E33-R63 IonicContact OE2-CZ 3.5Å; E33-R63 IonicContact OE2-NH1 2.72Å; E33-R63 PolarHBondContact OE2-NH1 3.25Å; E33-R63 IonicContact OE2-NH2 3.2Å; R59-R63 WeakPolarHBondContact O-CG 3.3Å; R59-R63 PolarHBondContact O-N 2.84Å; R59-R63 VanDerWaalsContact O-N 3.13Å; A60-R63 PolarHBondContact O-N 3.43Å; L61-R63 VanDerWaalsContact C-N 3.34Å; L61-R63 PolarHBondContact O-N 2.99Å; R63-Q65 VanDerWaalsContact C-N 3.27Å; R63-Q65 PolarHBondContact O-N 3.34Å; R63-L67 PolarHBondContact O-N 3Å; R63-L67 VanDerWaalsContact O-N 3.16Å
64	S	92.6	Very high	93.1	Very high	30 Å²	30	80.3 Å²	80.3	21%	0.21	39%	0.391	C	S	.	.	H	α-helix	trans	-59.3	-41.4	174.4	-66.1	0	0	0	0	111.8	I30 A60 L61 I62 G68	I30-S64 WeakPolarHBondContact CG2-OG 3.21Å; A60-S64 PolarHBondContact O-N 3.4Å; A60-S64 PolarHBondContact O-OG 2.82Å; L61-S64 WeakPolarHBondContact O-CB 3.23Å; L61-S64 PolarHBondContact O-N 3.1Å; I62-S64 PolarHBondContact O-N 2.81Å; S64-G68 PolarHBondContact O-N 3.35Å
65	Q	96.4	Very high	92.9	Very high	128 Å²	128	81.2 Å²	81.2	60%	0.598	40%	0.399	S	S	*	.	H	α-helix	trans	-72.6	-45	-177.2	-175.5	154.2	11.8	0	0	111.9	L61 I62 R63 L67 G68 D69	L61-Q65 PolarHBondContact O-N 2.98Å; I62-Q65 PolarHBondContact O-N 2.77Å; I62-Q65 VanDerWaalsContact O-N 3.09Å; R63-Q65 VanDerWaalsContact C-N 3.27Å; R63-Q65 PolarHBondContact O-N 3.34Å; Q65-L67 VanDerWaalsContact C-N 3.28Å; Q65-L67 PolarHBondContact O-N 3.21Å; Q65-G68 CarbonylContact O-C 3.57Å; Q65-G68 WeakPolarHBondContact O-CA 3.48Å; Q65-G68 PolarHBondContact O-N 3.47Å; Q65-D69 PolarHBondContact O-N 3.28Å
66	E	94.1	Very high	92.8	Very high	106 Å²	106	79.2 Å²	79.2	50%	0.495	40%	0.397	S	S	.	.	H	α-helix	trans	-53.9	-46.7	174.4	-71.2	168.8	161.4	0	0	111.1	I62 G68 D69 E70	I62-E66 HydrophobicContact CG2-CG 4.28Å; I62-E66 WeakPolarHBondContact CG2-OE1 3.37Å; I62-E66 WeakPolarHBondContact O-CG 3.14Å; I62-E66 PolarHBondContact O-N 3.28Å; E66-G68 VanDerWaalsContact C-N 3.33Å; E66-G68 PolarHBondContact O-N 3.32Å; E66-D69 PolarHBondContact O-N 2.88Å; E66-E70 WeakPolarHBondContact O-CG 3.34Å; E66-E70 PolarHBondContact O-N 2.95Å
67	L	87.4	Confident	92.8	Very high	33 Å²	33	81.9 Å²	81.9	17%	0.173	41%	0.406	C	S	.	.	H	α-helix	trans	-63.9	-37.7	175.8	-175.8	63.4	0	0	0	112.5	A26 I27 I30 R63 Q65 K71	A26-L67 HydrophobicContact CB-CD2 4.21Å; I27-L67 HydrophobicContact CG1-CD2 3.53Å; I27-L67 HydrophobicContact CG1-CG 4.26Å; I30-L67 HydrophobicContact CD1-CD2 3.72Å; R63-L67 PolarHBondContact O-N 3Å; R63-L67 VanDerWaalsContact O-N 3.16Å; Q65-L67 VanDerWaalsContact C-N 3.28Å; Q65-L67 PolarHBondContact O-N 3.21Å; L67-K71 WeakPolarHBondContact O-CG 3.48Å; L67-K71 PolarHBondContact O-N 3.38Å; L67-K71 VanDerWaalsContact O-N 3.07Å
68	G	89	Confident	92.6	Very high	29 Å²	29	85.8 Å²	85.8	30%	0.299	43%	0.425	S	S	.	.	H	α-helix	trans	-62.5	-44.4	174.7	0	0	0	0	0	112.4	S64 Q65 E66 K71 I72	S64-G68 PolarHBondContact O-N 3.35Å; Q65-G68 CarbonylContact O-C 3.57Å; Q65-G68 WeakPolarHBondContact O-CA 3.48Å; Q65-G68 PolarHBondContact O-N 3.47Å; E66-G68 VanDerWaalsContact C-N 3.33Å; E66-G68 PolarHBondContact O-N 3.32Å; G68-K71 PolarHBondContact O-N 3.15Å; G68-I72 WeakPolarHBondContact O-CG1 3.39Å; G68-I72 PolarHBondContact O-N 2.74Å
69	D	93.8	Very high	92.5	Very high	90 Å²	90	85.1 Å²	85.1	48%	0.481	43%	0.426	S	S	.	.	H	α-helix	trans	-64.7	-42.7	178.6	-68.1	-20.1	0	0	0	111.1	Q65 E66 K71 I72 Q73	Q65-D69 PolarHBondContact O-N 3.28Å; E66-D69 PolarHBondContact O-N 2.88Å; D69-K71 PolarHBondContact O-N 2.94Å; D69-I72 PolarHBondContact O-N 3.28Å; D69-Q73 WeakPolarHBondContact O-CB 3.47Å; D69-Q73 PolarHBondContact O-N 2.72Å
70	E	89.5	Confident	92.5	Very high	113 Å²	113	82.6 Å²	82.6	53%	0.528	42%	0.422	S	S	.	.	H	α-helix	trans	-58.3	-46.1	173.3	-74	176.2	-171.5	0	0	111.8	E66 I72 Q73 I74	E66-E70 WeakPolarHBondContact O-CG 3.34Å; E66-E70 PolarHBondContact O-N 2.95Å; E70-I72 PolarHBondContact O-N 2.92Å; E70-Q73 WeakPolarHBondContact O-CB 3.39Å; E70-Q73 PolarHBondContact O-N 3.25Å; E70-I74 WeakPolarHBondContact O-CG1 3.2Å; E70-I74 PolarHBondContact O-N 2.83Å
71	K	84.9	Confident	92.5	Very high	85 Å²	85	87.2 Å²	87.2	37%	0.37	45%	0.446	S	S	.	.	H	α-helix	trans	-64.6	-40.4	177.3	-71.6	-143.5	179.2	-163.8	0	112.3	G22 I27 L67 G68 D69 Q73 I74 V75	G22-K71 PolarHBondContact O-NZ 2.88Å; I27-K71 HydrophobicContact CD1-CD 4.05Å; L67-K71 WeakPolarHBondContact O-CG 3.48Å; L67-K71 PolarHBondContact O-N 3.38Å; L67-K71 VanDerWaalsContact O-N 3.07Å; G68-K71 PolarHBondContact O-N 3.15Å; D69-K71 PolarHBondContact O-N 2.94Å; K71-Q73 VanDerWaalsContact C-N 3.32Å; K71-Q73 PolarHBondContact O-N 3.49Å; K71-I74 PolarHBondContact O-N 3.01Å; K71-V75 WeakPolarHBondContact O-CG2 3.37Å; K71-V75 PolarHBondContact O-N 3.02Å
72	I	91.6	Very high	92.5	Very high	106 Å²	106	87.3 Å²	87.3	54%	0.544	45%	0.45	S	S	.	.	H	α-helix	trans	-61.7	-42.8	175.5	-71.3	167.4	0	0	0	110.5	G68 D69 E70 I74 V75 S76	G68-I72 WeakPolarHBondContact O-CG1 3.39Å; G68-I72 PolarHBondContact O-N 2.74Å; D69-I72 PolarHBondContact O-N 3.28Å; E70-I72 PolarHBondContact O-N 2.92Å; I72-I74 PolarHBondContact O-N 3.35Å; I72-V75 PolarHBondContact O-N 2.81Å; I72-S76 WeakPolarHBondContact O-CB 3.4Å; I72-S76 PolarHBondContact O-N 3Å; I72-S76 PolarHBondContact O-OG 3.5Å
73	Q	94.1	Very high	92.5	Very high	116 Å²	116	87.4 Å²	87.4	54%	0.542	45%	0.449	S	S	.	.	H	α-helix	trans	-61.1	-44.9	177.5	-175	179.9	-0	0	0	111.4	D69 E70 K71 S76 Q77	D69-Q73 WeakPolarHBondContact O-CB 3.47Å; D69-Q73 PolarHBondContact O-N 2.72Å; E70-Q73 WeakPolarHBondContact O-CB 3.39Å; E70-Q73 PolarHBondContact O-N 3.25Å; K71-Q73 VanDerWaalsContact C-N 3.32Å; K71-Q73 PolarHBondContact O-N 3.49Å; Q73-S76 WeakPolarHBondContact O-CB 3.49Å; Q73-S76 PolarHBondContact O-N 3.21Å; Q73-Q77 WeakPolarHBondContact O-CG 3.48Å; Q73-Q77 PolarHBondContact O-N 3.26Å
74	I	85.9	Confident	92.6	Very high	76 Å²	76	86 Å²	86	39%	0.39	45%	0.449	S	S	.	.	H	α-helix	trans	-60.9	-49.6	176.9	-67.9	164.6	0	0	0	110.6	E70 K71 I72 S76 Q77 M78	E70-I74 WeakPolarHBondContact O-CG1 3.2Å; E70-I74 PolarHBondContact O-N 2.83Å; K71-I74 PolarHBondContact O-N 3.01Å; I72-I74 PolarHBondContact O-N 3.35Å; I74-S76 VanDerWaalsContact C-N 3.25Å; I74-S76 PolarHBondContact O-N 3.01Å; I74-Q77 WeakPolarHBondContact O-CB 3.18Å; I74-Q77 PolarHBondContact O-N 3.23Å; I74-Q77 VanDerWaalsContact O-N 3.15Å; I74-M78 HydrophobicContact CG2-CG 4.47Å; I74-M78 HydrophobicContact CG2-SD 4.15Å; I74-M78 WeakPolarHBondContact O-CG 3.36Å; I74-M78 PolarHBondContact O-N 2.97Å
75	V	91.1	Very high	92.7	Very high	85 Å²	85	91.4 Å²	91.4	52%	0.515	47%	0.465	S	S	.	.	H	α-helix	trans	-59.1	-40	177.9	171	0	0	0	0	111.1	K71 I72 Q77 M78 V79	K71-V75 WeakPolarHBondContact O-CG2 3.37Å; K71-V75 PolarHBondContact O-N 3.02Å; I72-V75 PolarHBondContact O-N 2.81Å; V75-Q77 PolarHBondContact O-N 3.14Å; V75-M78 WeakPolarHBondContact O-CB 3.45Å; V75-M78 PolarHBondContact O-N 3.38Å; V75-V79 WeakPolarHBondContact O-CG2 3.43Å; V75-V79 PolarHBondContact O-N 2.86Å
76	S	94.9	Very high	92.7	Very high	68 Å²	68	88.7 Å²	88.7	48%	0.476	46%	0.457	S	S	.	.	H	α-helix	trans	-61.8	-43.2	177.5	-57.2	0	0	0	0	111.7	I72 Q73 I74 M78 V79 E80	I72-S76 WeakPolarHBondContact O-CB 3.4Å; I72-S76 PolarHBondContact O-N 3Å; I72-S76 PolarHBondContact O-OG 3.5Å; Q73-S76 WeakPolarHBondContact O-CB 3.49Å; Q73-S76 PolarHBondContact O-N 3.21Å; I74-S76 VanDerWaalsContact C-N 3.25Å; I74-S76 PolarHBondContact O-N 3.01Å; S76-M78 VanDerWaalsContact C-N 3.35Å; S76-V79 PolarHBondContact O-N 3.02Å; S76-E80 PolarHBondContact O-N 3.32Å; S76-E80 VanDerWaalsContact O-N 3.1Å
77	Q	92.7	Very high	92.9	Very high	95 Å²	95	90.3 Å²	90.3	44%	0.444	46%	0.459	S	S	.	.	H	α-helix	trans	-64.2	-39	174.8	-69.1	172.6	11.6	0	0	112.1	Q73 I74 V75 E80 L81	Q73-Q77 WeakPolarHBondContact O-CG 3.48Å; Q73-Q77 PolarHBondContact O-N 3.26Å; I74-Q77 WeakPolarHBondContact O-CB 3.18Å; I74-Q77 PolarHBondContact O-N 3.23Å; I74-Q77 VanDerWaalsContact O-N 3.15Å; V75-Q77 PolarHBondContact O-N 3.14Å; Q77-E80 PolarHBondContact O-N 3.37Å; Q77-L81 WeakPolarHBondContact O-CB 3.28Å; Q77-L81 PolarHBondContact O-N 3.36Å
78	M	92.5	Very high	93.3	Very high	94 Å²	94	92 Å²	92	46%	0.463	47%	0.466	S	S	.	.	H	α-helix	trans	-63.5	-42.2	176.6	-69.7	177.4	69	0	0	111.8	V16 I74 V75 S76 L81 V82	V16-M78 HydrophobicContact CG2-CE 4.32Å; I74-M78 HydrophobicContact CG2-CG 4.47Å; I74-M78 HydrophobicContact CG2-SD 4.15Å; I74-M78 WeakPolarHBondContact O-CG 3.36Å; I74-M78 PolarHBondContact O-N 2.97Å; V75-M78 WeakPolarHBondContact O-CB 3.45Å; V75-M78 PolarHBondContact O-N 3.38Å; S76-M78 VanDerWaalsContact C-N 3.35Å; M78-L81 PolarHBondContact O-N 3.42Å; M78-V82 WeakPolarHBondContact O-CG2 3.48Å; M78-V82 PolarHBondContact O-N 3.1Å
79	V	94.9	Very high	93.7	Very high	72 Å²	72	94.1 Å²	94.1	44%	0.436	47%	0.473	S	S	.	.	H	α-helix	trans	-60.7	-49.1	176.2	170.7	0	0	0	0	110.5	V75 S76 L81 V82 E83	V75-V79 WeakPolarHBondContact O-CG2 3.43Å; V75-V79 PolarHBondContact O-N 2.86Å; S76-V79 PolarHBondContact O-N 3.02Å; V79-L81 VanDerWaalsContact C-N 3.29Å; V79-L81 PolarHBondContact O-N 2.9Å; V79-V82 PolarHBondContact O-N 3.38Å; V79-E83 HydrophobicContact CG1-CG 4.28Å; V79-E83 WeakPolarHBondContact O-CG 3.39Å; V79-E83 PolarHBondContact O-N 2.76Å
80	E	95.6	Very high	93.8	Very high	129 Å²	129	93.8 Å²	93.8	60%	0.603	47%	0.471	S	S	*	.	H	α-helix	trans	-58.3	-41.8	178.7	-175.9	179.5	-178.1	0	0	112.1	S76 Q77 E83 N84	S76-E80 PolarHBondContact O-N 3.32Å; S76-E80 VanDerWaalsContact O-N 3.1Å; Q77-E80 PolarHBondContact O-N 3.37Å; E80-E83 PolarHBondContact O-N 2.93Å; E80-N84 VanDerWaalsContact O-CB 3.26Å; E80-N84 WeakPolarHBondContact O-CB 3.48Å; E80-N84 PolarHBondContact O-N 3.13Å
81	L	93.6	Very high	94.1	Very high	97 Å²	97	91.5 Å²	91.5	51%	0.508	47%	0.468	S	S	.	.	H	α-helix	trans	-63.7	-45.8	178.1	-175.5	149.5	0	0	0	111.8	A12 Q77 M78 V79 N84 R85	A12-L81 HydrophobicContact CB-CD1 4.37Å; Q77-L81 WeakPolarHBondContact O-CB 3.28Å; Q77-L81 PolarHBondContact O-N 3.36Å; M78-L81 PolarHBondContact O-N 3.42Å; V79-L81 VanDerWaalsContact C-N 3.29Å; V79-L81 PolarHBondContact O-N 2.9Å; L81-N84 PolarHBondContact O-N 3.47Å; L81-R85 PolarHBondContact O-N 3.42Å
82	V	96.6	Very high	94.6	Very high	87 Å²	87	92.8 Å²	92.8	53%	0.527	48%	0.475	S	S	.	.	H	α-helix	trans	-62.8	-47.9	177.7	170.7	0	0	0	0	110.2	M78 V79 N84 R85 T86	M78-V82 WeakPolarHBondContact O-CG2 3.48Å; M78-V82 PolarHBondContact O-N 3.1Å; V79-V82 PolarHBondContact O-N 3.38Å; V82-N84 VanDerWaalsContact C-N 3.32Å; V82-N84 PolarHBondContact O-N 2.84Å; V82-R85 PolarHBondContact O-N 3.22Å; V82-R85 VanDerWaalsContact O-N 3.14Å; V82-T86 PolarHBondContact O-N 3.17Å; V82-T86 PolarHBondContact O-OG1 3.06Å
83	E	97.1	Very high	94.7	Very high	93 Å²	93	91.1 Å²	91.1	44%	0.435	47%	0.469	S	S	.	.	H	α-helix	trans	-59.8	-41.8	177.3	-72.6	-178.9	176.1	0	0	112.5	V79 E80 R85 T86 R87	V79-E83 HydrophobicContact CG1-CG 4.28Å; V79-E83 WeakPolarHBondContact O-CG 3.39Å; V79-E83 PolarHBondContact O-N 2.76Å; E80-E83 PolarHBondContact O-N 2.93Å; E83-R85 VanDerWaalsContact C-N 3.33Å; E83-R85 PolarHBondContact O-N 3.02Å; E83-T86 PolarHBondContact O-N 3.44Å; E83-R87 WeakPolarHBondContact O-CG 3.26Å; E83-R87 PolarHBondContact O-N 3.21Å; E83-R87 IonicContact OE2-NH1 3.51Å
84	N	96.5	Very high	94.6	Very high	74 Å²	74	91.9 Å²	91.9	40%	0.396	47%	0.473	S	S	.	.	H	α-helix	trans	-60.8	-44.5	176	-172.4	-81.6	0	0	0	111	E80 L81 V82 R87 Q88	E80-N84 VanDerWaalsContact O-CB 3.26Å; E80-N84 WeakPolarHBondContact O-CB 3.48Å; E80-N84 PolarHBondContact O-N 3.13Å; L81-N84 PolarHBondContact O-N 3.47Å; V82-N84 VanDerWaalsContact C-N 3.32Å; V82-N84 PolarHBondContact O-N 2.84Å; N84-R87 PolarHBondContact O-N 2.98Å; N84-Q88 WeakPolarHBondContact O-CG 3.5Å; N84-Q88 PolarHBondContact O-N 3.49Å; N84-Q88 VanDerWaalsContact O-N 3.14Å; N84-Q88 PolarHBondContact OD1-NE2 3.14Å
85	R	94.9	Very high	94.9	Very high	143 Å²	143	93 Å²	93	54%	0.54	48%	0.479	S	S	.	.	H	α-helix	trans	-69.6	-38	-179.8	-167.9	58.3	172.5	-171	-3.1	112.4	L81 V82 E83 Q88 V89	L81-R85 PolarHBondContact O-N 3.42Å; V82-R85 PolarHBondContact O-N 3.22Å; V82-R85 VanDerWaalsContact O-N 3.14Å; E83-R85 VanDerWaalsContact C-N 3.33Å; E83-R85 PolarHBondContact O-N 3.02Å; R85-Q88 WeakPolarHBondContact O-CB 3.47Å; R85-Q88 PolarHBondContact O-N 3.08Å; R85-V89 WeakPolarHBondContact O-CG2 3.48Å; R85-V89 PolarHBondContact O-N 3.42Å
86	T	96.8	Very high	94.7	Very high	72 Å²	72	95.7 Å²	95.7	44%	0.442	48%	0.484	S	S	.	.	H	α-helix	trans	-57.6	-49.6	173.5	-59.5	0	0	0	0	110.5	V82 E83 Q88 V89 D90	V82-T86 PolarHBondContact O-N 3.17Å; V82-T86 PolarHBondContact O-OG1 3.06Å; E83-T86 PolarHBondContact O-N 3.44Å; T86-Q88 VanDerWaalsContact C-N 3.28Å; T86-Q88 PolarHBondContact O-N 3.39Å; T86-V89 PolarHBondContact O-N 3.06Å; T86-V89 VanDerWaalsContact O-N 3.08Å; T86-D90 PolarHBondContact O-N 3.12Å
87	R	97.7	Very high	94.5	Very high	139 Å²	139	97.8 Å²	97.8	53%	0.525	49%	0.486	S	S	.	.	H	α-helix	trans	-58.3	-37.1	176.1	-73	-173.1	-72.1	-102.1	0	113.4	E83 N84 S91	E83-R87 WeakPolarHBondContact O-CG 3.26Å; E83-R87 PolarHBondContact O-N 3.21Å; E83-R87 IonicContact OE2-NH1 3.51Å; N84-R87 PolarHBondContact O-N 2.98Å; R87-S91 WeakPolarHBondContact O-CB 3.26Å; R87-S91 PolarHBondContact O-N 2.96Å
88	Q	96.3	Very high	94.3	Very high	69 Å²	69	95.4 Å²	95.4	32%	0.322	48%	0.483	S	S	.	.	H	α-helix	trans	-65.8	-43	175.8	-70.2	176.9	23.7	0	0	111.9	N84 R85 T86 S91 H92	N84-Q88 WeakPolarHBondContact O-CG 3.5Å; N84-Q88 PolarHBondContact O-N 3.49Å; N84-Q88 VanDerWaalsContact O-N 3.14Å; N84-Q88 PolarHBondContact OD1-NE2 3.14Å; R85-Q88 WeakPolarHBondContact O-CB 3.47Å; R85-Q88 PolarHBondContact O-N 3.08Å; T86-Q88 VanDerWaalsContact C-N 3.28Å; T86-Q88 PolarHBondContact O-N 3.39Å; Q88-S91 PolarHBondContact O-N 2.95Å; Q88-H92 WeakPolarHBondContact O-CB 3.5Å; Q88-H92 PolarHBondContact O-CD2 2.99Å; Q88-H92 VanDerWaalsContact O-CG 3.3Å; Q88-H92 PolarHBondContact O-N 3.26Å
89	V	97.1	Very high	93.8	Very high	74 Å²	74	96.2 Å²	96.2	45%	0.448	49%	0.486	S	S	.	.	H	α-helix	trans	-63.2	-46.8	177.8	171.3	0	0	0	0	110.3	R85 T86 S91 H92 V93	R85-V89 WeakPolarHBondContact O-CG2 3.48Å; R85-V89 PolarHBondContact O-N 3.42Å; T86-V89 PolarHBondContact O-N 3.06Å; T86-V89 VanDerWaalsContact O-N 3.08Å; V89-S91 VanDerWaalsContact C-N 3.34Å; V89-S91 PolarHBondContact O-N 2.87Å; V89-H92 PolarHBondContact O-N 3.03Å; V89-H92 VanDerWaalsContact O-N 3.13Å; V89-V93 HydrophobicContact CG1-CG2 4.46Å; V89-V93 WeakPolarHBondContact O-CG2 3.44Å; V89-V93 PolarHBondContact O-N 3.37Å
90	D	96.2	Very high	92.9	Very high	83 Å²	83	99.2 Å²	99.2	44%	0.444	50%	0.495	S	S	.	.	H	α-helix	trans	-58.7	-46.5	178.4	-63	-23.1	0	0	0	111	T86 H92 V93 E94	T86-D90 PolarHBondContact O-N 3.12Å; D90-H92 VanDerWaalsContact C-N 3.32Å; D90-H92 PolarHBondContact O-N 2.78Å; D90-V93 WeakPolarHBondContact O-CB 3.44Å; D90-V93 PolarHBondContact O-N 2.99Å; D90-V93 VanDerWaalsContact O-N 3.17Å; D90-E94 WeakPolarHBondContact O-CG 3.25Å; D90-E94 PolarHBondContact O-N 3.17Å
91	S	95.4	Very high	91.7	Very high	65 Å²	65	99.8 Å²	99.8	46%	0.455	50%	0.498	S	S	.	.	H	α-helix	trans	-62	-37.1	176.3	177.5	0	0	0	0	113.1	R87 Q88 V89 L95	R87-S91 WeakPolarHBondContact O-CB 3.26Å; R87-S91 PolarHBondContact O-N 2.96Å; Q88-S91 PolarHBondContact O-N 2.95Å; V89-S91 VanDerWaalsContact C-N 3.34Å; V89-S91 PolarHBondContact O-N 2.87Å; S91-L95 PolarHBondContact O-N 3.46Å; S91-L95 VanDerWaalsContact O-N 3.11Å
92	H	94.6	Very high	90.5	Very high	112 Å²	112	101.1 Å²	101.1	52%	0.519	51%	0.505	S	S	.	.	H	α-helix	trans	-67.8	-39.9	175.9	-75.4	-159.6	0	0	0	111.4	Q88 V89 D90 L95 F96	Q88-H92 WeakPolarHBondContact O-CB 3.5Å; Q88-H92 PolarHBondContact O-CD2 2.99Å; Q88-H92 VanDerWaalsContact O-CG 3.3Å; Q88-H92 PolarHBondContact O-N 3.26Å; V89-H92 PolarHBondContact O-N 3.03Å; V89-H92 VanDerWaalsContact O-N 3.13Å; D90-H92 VanDerWaalsContact C-N 3.32Å; D90-H92 PolarHBondContact O-N 2.78Å; H92-L95 PolarHBondContact O-N 3.49Å; H92-F96 VanDerWaalsContact O-CD2 3.26Å; H92-F96 WeakPolarHBondContact O-CD2 3.46Å; H92-F96 PolarHBondContact O-N 2.92Å
93	V	94.1	Very high	88.8	Confident	70 Å²	70	99.2 Å²	99.2	42%	0.424	50%	0.502	S	S	.	.	H	α-helix	trans	-60.8	-49.8	175.9	170.9	0	0	0	0	110.3	V89 D90 L95 F96 E97	V89-V93 HydrophobicContact CG1-CG2 4.46Å; V89-V93 WeakPolarHBondContact O-CG2 3.44Å; V89-V93 PolarHBondContact O-N 3.37Å; D90-V93 WeakPolarHBondContact O-CB 3.44Å; D90-V93 PolarHBondContact O-N 2.99Å; D90-V93 VanDerWaalsContact O-N 3.17Å; V93-L95 VanDerWaalsContact C-N 3.28Å; V93-L95 PolarHBondContact O-N 3.09Å; V93-F96 PolarHBondContact O-N 3.3Å; V93-F96 VanDerWaalsContact O-N 3.09Å; V93-E97 HydrophobicContact CG1-CG 4.35Å; V93-E97 WeakPolarHBondContact O-CG 3.38Å; V93-E97 PolarHBondContact O-N 3.11Å
94	E	92.4	Very high	86.9	Confident	132 Å²	132	100.3 Å²	100.3	62%	0.617	51%	0.511	S	S	*	.	H	α-helix	trans	-56.4	-42	177.4	-71	176.7	177.2	0	0	112.2	D90 E97 A98	D90-E94 WeakPolarHBondContact O-CG 3.25Å; D90-E94 PolarHBondContact O-N 3.17Å; E94-E97 PolarHBondContact O-N 3.05Å; E94-A98 WeakPolarHBondContact O-CB 3.38Å; E94-A98 PolarHBondContact O-N 3.36Å
95	L	92	Very high	85.1	Confident	100 Å²	100	101.4 Å²	101.4	52%	0.524	52%	0.521	S	S	.	.	H	α-helix	trans	-64.1	-42.8	176.8	180	63.5	0	0	0	112.1	S91 H92 V93 A98 Q99	S91-L95 PolarHBondContact O-N 3.46Å; S91-L95 VanDerWaalsContact O-N 3.11Å; H92-L95 PolarHBondContact O-N 3.49Å; V93-L95 VanDerWaalsContact C-N 3.28Å; V93-L95 PolarHBondContact O-N 3.09Å; L95-A98 PolarHBondContact O-N 3.06Å; L95-Q99 VanDerWaalsContact O-CG 3.31Å; L95-Q99 WeakPolarHBondContact O-CG 3.39Å; L95-Q99 PolarHBondContact O-N 3.02Å
96	F	87.9	Confident	83.2	Confident	142 Å²	142	98.3 Å²	98.3	62%	0.623	53%	0.526	S	S	*	.	H	α-helix	trans	-65.7	-41.7	178.2	-92.1	-70.1	0	0	0	112.1	H92 V93 Q99 Q100	H92-F96 VanDerWaalsContact O-CD2 3.26Å; H92-F96 WeakPolarHBondContact O-CD2 3.46Å; H92-F96 PolarHBondContact O-N 2.92Å; V93-F96 PolarHBondContact O-N 3.3Å; V93-F96 VanDerWaalsContact O-N 3.09Å; F96-Q99 PolarHBondContact O-N 3.07Å; F96-Q100 PolarHBondContact O-N 3.08Å
97	E	90.7	Very high	81.1	Confident	111 Å²	111	98.2 Å²	98.2	52%	0.519	54%	0.539	S	S	.	.	H	α-helix	trans	-62.7	-45.8	176	-70.6	178	165.9	0	0	111	V93 E94 Q99 Q100 E101	V93-E97 HydrophobicContact CG1-CG 4.35Å; V93-E97 WeakPolarHBondContact O-CG 3.38Å; V93-E97 PolarHBondContact O-N 3.11Å; E94-E97 PolarHBondContact O-N 3.05Å; E97-Q99 VanDerWaalsContact C-N 3.29Å; E97-Q99 PolarHBondContact O-N 3.01Å; E97-Q100 WeakPolarHBondContact O-CB 3.37Å; E97-Q100 PolarHBondContact O-N 3.05Å; E97-Q100 VanDerWaalsContact O-N 3.08Å; E97-E101 PolarHBondContact O-N 3.31Å
98	A	87.6	Confident	78.9	Confident	46 Å²	46	98.4 Å²	98.4	38%	0.38	55%	0.55	S	S	.	*	H	α-helix	trans	-60.5	-37.2	175.8	0	0	0	0	0	112.8	E94 L95 L102	E94-A98 WeakPolarHBondContact O-CB 3.38Å; E94-A98 PolarHBondContact O-N 3.36Å; L95-A98 PolarHBondContact O-N 3.06Å; A98-L102 WeakPolarHBondContact O-CG 3.46Å; A98-L102 PolarHBondContact O-N 3.32Å
99	Q	82.4	Confident	76.8	Confident	111 Å²	111	100.4 Å²	100.4	52%	0.519	57%	0.572	S	S	.	*	H	α-helix	trans	-67.9	-34.4	175	-75	178.1	-29.8	0	0	112.7	L95 F96 E97 G103	L95-Q99 VanDerWaalsContact O-CG 3.31Å; L95-Q99 WeakPolarHBondContact O-CG 3.39Å; L95-Q99 PolarHBondContact O-N 3.02Å; F96-Q99 PolarHBondContact O-N 3.07Å; E97-Q99 VanDerWaalsContact C-N 3.29Å; E97-Q99 PolarHBondContact O-N 3.01Å; Q99-G103 PolarHBondContact O-N 3.29Å
100	Q	75.9	Confident	74.7	Confident	134 Å²	134	100.3 Å²	100.3	63%	0.626	59%	0.586	S	S	*	*	H	α-helix	trans	-68.3	-44.7	177	-174.9	166.1	45.2	0	0	111.7	F96 E97 L102 G103 D104	F96-Q100 PolarHBondContact O-N 3.08Å; E97-Q100 WeakPolarHBondContact O-CB 3.37Å; E97-Q100 PolarHBondContact O-N 3.05Å; E97-Q100 VanDerWaalsContact O-N 3.08Å; Q100-L102 VanDerWaalsContact C-N 3.25Å; Q100-L102 PolarHBondContact O-N 3.2Å; Q100-G103 PolarHBondContact O-N 3.33Å; Q100-D104 PolarHBondContact O-N 3.36Å
101	E	70.9	Confident	72.1	Confident	141 Å²	141	109.6 Å²	109.6	66%	0.659	62%	0.622	S	S	*	*	H	α-helix	trans	-61	-33.3	177.2	-68	-173.6	160.7	0	0	112.8	E97 T105	E97-E101 PolarHBondContact O-N 3.31Å; E101-T105 WeakPolarHBondContact O-CG2 3.31Å; E101-T105 PolarHBondContact O-N 3.04Å; E101-T105 PolarHBondContact O-OG1 3.33Å
102	L	67.1	Low	70.9	Confident	126 Å²	126	111.8 Å²	111.8	66%	0.66	63%	0.631	S	S	*	*	H	α-helix	trans	-72.1	-31.7	173.5	-69.6	171.9	0	0	0	113	A98 Q100 T105 A106	A98-L102 WeakPolarHBondContact O-CG 3.46Å; A98-L102 PolarHBondContact O-N 3.32Å; Q100-L102 VanDerWaalsContact C-N 3.25Å; Q100-L102 PolarHBondContact O-N 3.2Å; L102-T105 PolarHBondContact O-OG1 3.49Å; L102-T105 VanDerWaalsContact O-OG1 3.11Å; L102-A106 PolarHBondContact O-N 3.48Å
103	G	60.5	Low	69.7	Low	46 Å²	46	111.8 Å²	111.8	47%	0.474	64%	0.637	S	S	.	*	H	α-helix	trans	-69.8	-40.1	175.8	0	0	0	0	0	112.7	Q99 Q100 A106 G107	Q99-G103 PolarHBondContact O-N 3.29Å; Q100-G103 PolarHBondContact O-N 3.33Å; G103-A106 PolarHBondContact O-N 3.45Å; G103-G107 PolarHBondContact O-N 3.11Å
104	D	58.7	Low	68.3	Low	117 Å²	117	114.1 Å²	114.1	63%	0.626	65%	0.648	S	S	*	*	H	α-helix	trans	-73.9	-29.6	-178.1	-69.9	-24.2	0	0	0	112.8	Q100	Q100-D104 PolarHBondContact O-N 3.36Å
105	T	59	Low	66.9	Low	97 Å²	97	113.1 Å²	113.1	60%	0.595	65%	0.65	S	S	*	*	H	α-helix	trans	-74.9	-30.4	175.5	49	0	0	0	0	113.1	E101 L102	E101-T105 WeakPolarHBondContact O-CG2 3.31Å; E101-T105 PolarHBondContact O-N 3.04Å; E101-T105 PolarHBondContact O-OG1 3.33Å; L102-T105 PolarHBondContact O-OG1 3.49Å; L102-T105 VanDerWaalsContact O-OG1 3.11Å
106	A	54.8	Low	65.3	Low	78 Å²	78	113.9 Å²	113.9	65%	0.645	66%	0.658	S	S	*	*	H	α-helix	trans	-73.6	-27.5	174.1	0	0	0	0	0	113.2	L102 G103	L102-A106 PolarHBondContact O-N 3.48Å; G103-A106 PolarHBondContact O-N 3.45Å
107	G	51.6	Low	63.8	Low	69 Å²	69	112 Å²	112	71%	0.711	66%	0.661	S	S	*	*	T	Hydrogen-bonded Turn	trans	-76.2	-15	-179.1	0	0	0	0	0	115.9	G103	G103-G107 PolarHBondContact O-N 3.11Å
108	N	50.9	Low	61.9	Low	143 Å²	143	112.1 Å²	112.1	77%	0.765	67%	0.671	S	S	*	*	T	Hydrogen-bonded Turn	trans	-102.1	3.8	-174.8	-164.5	38.7	0	0	0	114.6
109	S	53.5	Low	59.9	Low	112 Å²	112	117.2 Å²	117.2	78%	0.783	69%	0.693	S	S	*	*	S	Bend	trans	-92.1	8.8	179.7	-64.4	0	0	0	0	114.4
110	G	52.7	Low	58.1	Low	72 Å²	72	117.7 Å²	117.7	74%	0.742	71%	0.708	S	S	*	*			trans	-117.7	74.6	179.3	0	0	0	0	0	112.1
111	K	41.1	Very low	56.4	Low	277 Å²	277	116.2 Å²	116.2	100%	1.204	72%	0.715	S	S	*	*			trans	-149.2	0	163.9	-140.7	179.1	174.2	-176.3	0	111.7

Retrieved 111 of 111 residues in 103.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).