A0A087WXR5_HUMAN Loading...

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

AlphaFold DB , UniProt , Accession A0A087WXR5, Species HUMAN (Homo sapiens, Human), Gene NDUFA5, Length 77 aa.

						>A0A087WXR5_HUMAN|A0A087WXR5|NDUFA5
MAGVLKKTTGLVGLAVCNTPHEEPDVKKLEDQLQGGQLEEVILQAEHELNLARKMREWKLWEPLVEEPPADQWKWPI
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	45.2	Very low	46.5	Very low	191 Å²	191	89.9 Å²	89.9	94%	0.941	52%	0.516	S	S	*	.				0	-31.7	0	-61.4	-61.7	-97.2	0	0	113.8	G3 V4	M1-G3 PolarHBondContact O-N 3.35Å; M1-G3 VanDerWaalsContact O-N 3.14Å; M1-V4 PolarHBondContact O-N 3Å; M1-V4 HydrophobicContact SD-CG2 4.45Å
2	A	43.6	Very low	46.8	Very low	82 Å²	82	90.9 Å²	90.9	68%	0.678	53%	0.525	S	S	*	.	H	α-helix	trans	-54.4	-30	170.7	0	0	0	0	0	114.2	V4 K6	A2-V4 VanDerWaalsContact C-N 3.33Å; A2-V4 PolarHBondContact O-N 3.02Å; A2-K6 PolarHBondContact O-N 2.64Å
3	G	44.9	Very low	46.9	Very low	41 Å²	41	86.8 Å²	86.8	42%	0.423	52%	0.515	S	S	.	.	H	α-helix	trans	-71.9	-19	174.7	0	0	0	0	0	115.2	M1 K7	M1-G3 PolarHBondContact O-N 3.35Å; M1-G3 VanDerWaalsContact O-N 3.14Å; G3-K7 VanDerWaalsContact O-CG 3.28Å; G3-K7 WeakPolarHBondContact O-CG 3.26Å; G3-K7 PolarHBondContact O-N 2.94Å
4	V	48.4	Very low	46.7	Very low	81 Å²	81	88.7 Å²	88.7	49%	0.491	52%	0.52	S	S	.	.	H	α-helix	trans	-78.1	-45	175.5	178.5	0	0	0	0	109.3	M1 A2 K6 K7 T8	M1-V4 PolarHBondContact O-N 3Å; M1-V4 HydrophobicContact SD-CG2 4.45Å; A2-V4 VanDerWaalsContact C-N 3.33Å; A2-V4 PolarHBondContact O-N 3.02Å; V4-K6 PolarHBondContact O-N 3.19Å; V4-K7 CarbonylContact O-C 3.58Å; V4-K7 WeakPolarHBondContact O-CA 3.48Å; V4-K7 WeakPolarHBondContact O-CB 3.23Å; V4-K7 PolarHBondContact O-N 3.4Å; V4-T8 HydrophobicContact CG1-CG2 4.14Å; V4-T8 WeakPolarHBondContact O-CG2 3.42Å; V4-T8 PolarHBondContact O-N 3.14Å; V4-T8 PolarHBondContact O-OG1 3.36Å
5	L	46.8	Very low	46.7	Very low	41 Å²	41	85.5 Å²	85.5	22%	0.215	51%	0.508	C	S	.	.	H	α-helix	trans	-57.3	-45.4	172.8	-90	165.7	0	0	0	112.5	K7 T8 T9 W61	L5-K7 PolarHBondContact O-N 3.35Å; L5-T8 PolarHBondContact O-N 2.99Å; L5-T8 VanDerWaalsContact O-N 3.16Å; L5-T8 PolarHBondContact O-OG1 3.02Å; L5-T9 HydrophobicContact CD2-CG2 4.22Å; L5-T9 PolarHBondContact O-N 3.16Å; L5-T9 PolarHBondContact O-OG1 2.92Å; L5-W61 HydrophobicContact CD1-CB 3.54Å; L5-W61 HydrophobicContact CD1-CD2 4.19Å; L5-W61 HydrophobicContact CD1-CE3 3.6Å; L5-W61 HydrophobicContact CD1-CG 4.23Å
6	K	47.2	Very low	47.1	Very low	145 Å²	145	85.1 Å²	85.1	63%	0.63	51%	0.506	S	S	*	.	H	α-helix	trans	-57.1	-33.2	173.6	-82.4	-168.3	172.7	-167.9	0	113.4	A2 V4	A2-K6 PolarHBondContact O-N 2.64Å; V4-K6 PolarHBondContact O-N 3.19Å
7	K	50.6	Low	47.5	Very low	177 Å²	177	81.7 Å²	81.7	77%	0.77	49%	0.487	S	S	*	.	H	α-helix	trans	-80.4	-30.4	178.2	-73.5	176.2	179.9	-170.2	0	112.8	G3 V4 L5	G3-K7 VanDerWaalsContact O-CG 3.28Å; G3-K7 WeakPolarHBondContact O-CG 3.26Å; G3-K7 PolarHBondContact O-N 2.94Å; V4-K7 CarbonylContact O-C 3.58Å; V4-K7 WeakPolarHBondContact O-CA 3.48Å; V4-K7 WeakPolarHBondContact O-CB 3.23Å; V4-K7 PolarHBondContact O-N 3.4Å; L5-K7 PolarHBondContact O-N 3.35Å
8	T	42.5	Very low	48.2	Very low	102 Å²	102	86.6 Å²	86.6	63%	0.626	51%	0.511	S	S	*	.	H	α-helix	trans	-95.5	-25.6	-174.4	59	0	0	0	0	114.2	V4 L5 G10	V4-T8 HydrophobicContact CG1-CG2 4.14Å; V4-T8 WeakPolarHBondContact O-CG2 3.42Å; V4-T8 PolarHBondContact O-N 3.14Å; V4-T8 PolarHBondContact O-OG1 3.36Å; L5-T8 PolarHBondContact O-N 2.99Å; L5-T8 VanDerWaalsContact O-N 3.16Å; L5-T8 PolarHBondContact O-OG1 3.02Å; T8-G10 PolarHBondContact O-N 3.48Å
9	T	48.1	Very low	48.8	Very low	48 Å²	48	84.9 Å²	84.9	29%	0.294	50%	0.501	S	S	.	.	S	Bend	trans	-81.6	-2.9	174.8	51.9	0	0	0	0	113.2	L5 L11 M55	L5-T9 HydrophobicContact CD2-CG2 4.22Å; L5-T9 PolarHBondContact O-N 3.16Å; L5-T9 PolarHBondContact O-OG1 2.92Å; T9-L11 PolarHBondContact O-N 3.37Å; T9-L11 VanDerWaalsContact O-N 3.09Å; T9-M55 HydrophobicContact CG2-CE 3.32Å; T9-M55 HydrophobicContact CG2-SD 3.99Å
10	G	46.7	Very low	49.6	Very low	37 Å²	37	83.4 Å²	83.4	38%	0.381	49%	0.494	S	S	.	.			trans	63.4	11.4	-173.3	0	0	0	0	0	113.4	T8 V12	T8-G10 PolarHBondContact O-N 3.48Å; G10-V12 PolarHBondContact O-N 3.03Å; G10-V12 VanDerWaalsContact O-O 3.13Å
11	L	47.1	Very low	50.4	Low	44 Å²	44	88.2 Å²	88.2	23%	0.23	51%	0.511	C	S	.	.			trans	-71.9	43.5	168.7	-69.4	172.2	0	0	0	110.7	T9 E48 M55	T9-L11 PolarHBondContact O-N 3.37Å; T9-L11 VanDerWaalsContact O-N 3.09Å; L11-E48 HydrophobicContact CD2-CB 3.78Å; L11-E48 HydrophobicContact CD2-CG 3.63Å; L11-M55 HydrophobicContact CD1-SD 4.23Å
12	V	50.7	Low	51.6	Low	102 Å²	102	85.8 Å²	85.8	62%	0.618	50%	0.497	S	S	*	.	S	Bend	trans	-79	106.4	143.7	-175.9	0	0	0	0	101.2	G10 L14	G10-V12 PolarHBondContact O-N 3.03Å; G10-V12 VanDerWaalsContact O-O 3.13Å; V12-L14 VanDerWaalsContact C-N 3.31Å; V12-L14 WeakPolarHBondContact O-CA 3.49Å; V12-L14 PolarHBondContact O-N 3.49Å
13	G	47.7	Very low	52.9	Low	38 Å²	38	85 Å²	85	39%	0.392	48%	0.48	S	S	.	.			trans	-42.5	106.1	173.3	0	0	0	0	0	107.1	A15	G13-A15 PolarHBondContact O-N 3.29Å
14	L	44	Very low	54.3	Low	113 Å²	113	89.1 Å²	89.1	59%	0.592	50%	0.499	S	S	*	.	T	Hydrogen-bonded Turn	trans	-79.1	85.7	-154.1	-137	150	0	0	0	104.5	V12	V12-L14 VanDerWaalsContact C-N 3.31Å; V12-L14 WeakPolarHBondContact O-CA 3.49Å; V12-L14 PolarHBondContact O-N 3.49Å
15	A	47.7	Very low	56	Low	41 Å²	41	88.4 Å²	88.4	34%	0.339	49%	0.492	S	S	.	.	T	Hydrogen-bonded Turn	trans	53	84.8	-164.9	0	0	0	0	0	112.8	G13 L33	G13-A15 PolarHBondContact O-N 3.29Å; A15-L33 HydrophobicContact CB-CB 4.32Å; A15-L33 HydrophobicContact CB-CG 4.1Å; A15-L33 WeakPolarHBondContact CB-O 3.02Å; A15-L33 WeakPolarHBondContact O-CD2 3.35Å; A15-L33 WeakPolarHBondContact O-CG 3.44Å
16	V	52.1	Low	57.5	Low	79 Å²	79	90.5 Å²	90.5	48%	0.479	51%	0.506	S	S	.	.			trans	-102.5	125.9	146	-179.8	0	0	0	0	104	N18	V16-N18 PolarHBondContact O-N 3.16Å
17	C	54.5	Low	59.1	Low	27 Å²	27	90.7 Å²	90.7	18%	0.182	51%	0.507	C	S	.	.			trans	-43.2	128.2	167.7	171.6	0	0	0	0	107.8	T19 P20 L29 L33	C17-T19 PolarHBondContact O-N 3.35Å; C17-T19 PolarHBondContact SG-N 3.32Å; C17-T19 VanDerWaalsContact SG-N 3.35Å; C17-T19 PolarHBondContact SG-O 3.26Å; C17-P20 HydrophobicContact CB-CB 4.35Å; C17-P20 VanDerWaalsContact O-CD 3.31Å; C17-P20 WeakPolarHBondContact O-CD 3.41Å; C17-L29 HydrophobicContact CB-CD1 3.75Å; C17-L33 HydrophobicContact CB-CD1 3.98Å
18	N	60.2	Low	60.6	Low	170 Å²	170	87.6 Å²	87.6	91%	0.909	49%	0.494	S	S	*	.	S	Bend	trans	-57.3	-19.9	-179.8	-71.8	-40.6	0	0	0	111.5	V16	V16-N18 PolarHBondContact O-N 3.16Å
19	T	60	Low	62.2	Low	54 Å²	54	83.5 Å²	83.5	33%	0.331	47%	0.468	S	S	.	.			trans	-140.8	69.9	-176.7	45.1	0	0	0	0	111	C17 H21 E22	C17-T19 PolarHBondContact O-N 3.35Å; C17-T19 PolarHBondContact SG-N 3.32Å; C17-T19 VanDerWaalsContact SG-N 3.35Å; C17-T19 PolarHBondContact SG-O 3.26Å; T19-H21 PolarHBondContact O-N 3.18Å; T19-E22 VanDerWaalsContact CB-OE2 3.23Å; T19-E22 WeakPolarHBondContact CB-OE2 3.31Å; T19-E22 HydrophobicContact CG2-CG 4.41Å; T19-E22 WeakPolarHBondContact CG2-OE1 3.48Å; T19-E22 WeakPolarHBondContact O-CB 3.41Å; T19-E22 PolarHBondContact O-N 2.92Å; T19-E22 PolarHBondContact OG1-OE2 3.37Å
20	P	64.6	Low	63.6	Low	54 Å²	54	83.5 Å²	83.5	35%	0.351	47%	0.465	S	S	.	.	T	Hydrogen-bonded Turn	trans	-66.2	-13	-175	30.2	-34.1	0	0	0	113.1	C17	C17-P20 HydrophobicContact CB-CB 4.35Å; C17-P20 VanDerWaalsContact O-CD 3.31Å; C17-P20 WeakPolarHBondContact O-CD 3.41Å
21	H	66.7	Low	65.1	Low	185 Å²	185	88 Å²	88	86%	0.856	48%	0.48	S	S	*	.	T	Hydrogen-bonded Turn	trans	-84.2	-8.4	176.4	-56.3	108.6	0	0	0	113.9	T19	T19-H21 PolarHBondContact O-N 3.18Å
22	E	69.5	Low	66.5	Low	140 Å²	140	90.9 Å²	90.9	65%	0.654	49%	0.492	S	S	*	.	S	Bend	trans	-82.9	-26.7	-178.5	-75.4	176.6	176.4	0	0	112.9	T19 P24	T19-E22 VanDerWaalsContact CB-OE2 3.23Å; T19-E22 WeakPolarHBondContact CB-OE2 3.31Å; T19-E22 HydrophobicContact CG2-CG 4.41Å; T19-E22 WeakPolarHBondContact CG2-OE1 3.48Å; T19-E22 WeakPolarHBondContact O-CB 3.41Å; T19-E22 PolarHBondContact O-N 2.92Å; T19-E22 PolarHBondContact OG1-OE2 3.37Å; E22-P24 WeakPolarHBondContact O-CD 3.39Å
23	E	71.1	Confident	67.5	Low	67 Å²	67	86.5 Å²	86.5	31%	0.313	47%	0.466	S	S	.	.			trans	-105.3	108.1	178.4	-74.6	-69.4	176.1	0	0	110.5	D25	E23-D25 PolarHBondContact O-N 2.8Å
24	P	74.6	Confident	68.4	Low	127 Å²	127	93.5 Å²	93.5	83%	0.825	49%	0.488	S	S	*	.			trans	-76.1	-10.7	178.3	30.9	-34.9	0	0	0	113.1	E22	E22-P24 WeakPolarHBondContact O-CD 3.39Å
25	D	83.5	Confident	69.4	Low	66 Å²	66	89.6 Å²	89.6	35%	0.353	48%	0.475	S	S	.	.			trans	-96.6	114.1	-178.4	-171.4	0.2	0	0	0	111.4	E23 K27 K28 L29	E23-D25 PolarHBondContact O-N 2.8Å; D25-K27 VanDerWaalsContact C-N 3.3Å; D25-K27 PolarHBondContact O-N 2.74Å; D25-K27 PolarHBondContact OD1-N 2.72Å; D25-K28 HydrophobicContact CB-CB 4.35Å; D25-K28 HydrophobicContact CB-CD 4.13Å; D25-K28 HydrophobicContact CB-CG 4.22Å; D25-K28 PolarHBondContact O-N 3.05Å; D25-K28 WeakPolarHBondContact OD2-CE 3.46Å; D25-L29 PolarHBondContact O-N 3.49Å; D25-L29 VanDerWaalsContact O-N 3.16Å
26	V	79.4	Confident	70.7	Confident	84 Å²	84	89.9 Å²	89.9	51%	0.509	48%	0.482	S	S	.	.	H	α-helix	trans	-54.9	-43	-179.2	178.6	0	0	0	0	111.6	L29 E30 L38	V26-L29 WeakPolarHBondContact O-CB 2.84Å; V26-L29 PolarHBondContact O-N 2.95Å; V26-E30 WeakPolarHBondContact O-CG 3.28Å; V26-E30 PolarHBondContact O-N 3.41Å; V26-L38 HydrophobicContact CB-CD1 4.32Å; V26-L38 HydrophobicContact CG1-CD1 3.45Å; V26-L38 VanDerWaalsContact CG1-CD1 3.45Å
27	K	80.8	Confident	72	Confident	149 Å²	149	91.7 Å²	91.7	65%	0.648	49%	0.485	S	S	*	.	H	α-helix	trans	-69.4	-40.1	-175	-69.6	-174.8	176.2	-174.7	0	112.8	D25 L29 E30 D31	D25-K27 VanDerWaalsContact C-N 3.3Å; D25-K27 PolarHBondContact O-N 2.74Å; D25-K27 PolarHBondContact OD1-N 2.72Å; K27-L29 VanDerWaalsContact C-N 3.28Å; K27-L29 PolarHBondContact O-N 3.14Å; K27-E30 PolarHBondContact O-N 3.17Å; K27-D31 PolarHBondContact O-N 3Å
28	K	80.5	Confident	73.1	Confident	112 Å²	112	92 Å²	92	49%	0.487	49%	0.485	S	S	.	.	H	α-helix	trans	-67.1	-35.6	176.7	-67.1	-177.8	-172.6	175	0	111.4	D25 D31 Q32	D25-K28 HydrophobicContact CB-CB 4.35Å; D25-K28 HydrophobicContact CB-CD 4.13Å; D25-K28 HydrophobicContact CB-CG 4.22Å; D25-K28 PolarHBondContact O-N 3.05Å; D25-K28 WeakPolarHBondContact OD2-CE 3.46Å; K28-D31 PolarHBondContact O-N 2.83Å; K28-Q32 WeakPolarHBondContact O-CB 3.17Å; K28-Q32 VanDerWaalsContact O-CG 3.26Å; K28-Q32 WeakPolarHBondContact O-CG 2.94Å; K28-Q32 PolarHBondContact O-N 2.91Å
29	L	77.4	Confident	74.1	Confident	17 Å²	17	90.1 Å²	90.1	9%	0.089	47%	0.471	C	S	.	.	H	α-helix	trans	-65.7	-41.8	176.6	-171.6	65.7	0	0	0	111.1	C17 D25 V26 K27 Q32 L33 L38	C17-L29 HydrophobicContact CB-CD1 3.75Å; D25-L29 PolarHBondContact O-N 3.49Å; D25-L29 VanDerWaalsContact O-N 3.16Å; V26-L29 WeakPolarHBondContact O-CB 2.84Å; V26-L29 PolarHBondContact O-N 2.95Å; K27-L29 VanDerWaalsContact C-N 3.28Å; K27-L29 PolarHBondContact O-N 3.14Å; L29-Q32 PolarHBondContact O-N 3.34Å; L29-L33 HydrophobicContact CD1-CD1 3.91Å; L29-L33 HydrophobicContact CG-CD1 4.05Å; L29-L33 WeakPolarHBondContact O-CB 3.47Å; L29-L33 WeakPolarHBondContact O-CD1 3.4Å; L29-L33 PolarHBondContact O-N 3.16Å; L29-L38 HydrophobicContact CD2-CD1 4.1Å; L29-L38 HydrophobicContact CD2-CD2 4.02Å
30	E	76.9	Confident	75	Confident	48 Å²	48	93 Å²	93	22%	0.224	48%	0.481	C	S	.	.	H	α-helix	trans	-62.4	-46.2	174	-70.5	175.2	155.7	0	0	112.3	V26 K27 Q32 L33 Q34 L38	V26-E30 WeakPolarHBondContact O-CG 3.28Å; V26-E30 PolarHBondContact O-N 3.41Å; K27-E30 PolarHBondContact O-N 3.17Å; E30-Q32 VanDerWaalsContact C-N 3.27Å; E30-Q32 PolarHBondContact O-N 3.48Å; E30-L33 PolarHBondContact O-N 2.91Å; E30-L33 VanDerWaalsContact O-N 3.16Å; E30-Q34 PolarHBondContact O-N 3.09Å; E30-Q34 VanDerWaalsContact O-N 3.14Å; E30-L38 HydrophobicContact CG-CB 4.34Å; E30-L38 HydrophobicContact CG-CD1 3.67Å; E30-L38 HydrophobicContact CG-CG 3.81Å; E30-L38 PolarHBondContact OE1-N 3.26Å
31	D	78.4	Confident	75.8	Confident	131 Å²	131	91.4 Å²	91.4	70%	0.701	47%	0.47	S	S	*	.	H	α-helix	trans	-60.5	-37.6	176.5	-73.6	-24.7	0	0	0	112	K27 K28	K27-D31 PolarHBondContact O-N 3Å; K28-D31 PolarHBondContact O-N 2.83Å
32	Q	75.4	Confident	76.5	Confident	105 Å²	105	87.3 Å²	87.3	49%	0.491	45%	0.453	S	S	.	.	H	α-helix	trans	-71.4	-36.3	175.8	-77.7	177.5	-2.8	0	0	112.7	K28 L29 E30 Q34	K28-Q32 WeakPolarHBondContact O-CB 3.17Å; K28-Q32 VanDerWaalsContact O-CG 3.26Å; K28-Q32 WeakPolarHBondContact O-CG 2.94Å; K28-Q32 PolarHBondContact O-N 2.91Å; L29-Q32 PolarHBondContact O-N 3.34Å; E30-Q32 VanDerWaalsContact C-N 3.27Å; E30-Q32 PolarHBondContact O-N 3.48Å; Q32-Q34 VanDerWaalsContact C-N 3.33Å
33	L	72.4	Confident	77.2	Confident	10 Å²	10	85 Å²	85	5%	0.052	45%	0.445	C	S	.	.	H	α-helix	trans	-72.8	-24.9	-178.7	-106.5	82.8	0	0	0	112.7	A15 C17 L29 E30 G35 V41	A15-L33 HydrophobicContact CB-CB 4.32Å; A15-L33 HydrophobicContact CB-CG 4.1Å; A15-L33 WeakPolarHBondContact CB-O 3.02Å; A15-L33 WeakPolarHBondContact O-CD2 3.35Å; A15-L33 WeakPolarHBondContact O-CG 3.44Å; C17-L33 HydrophobicContact CB-CD1 3.98Å; L29-L33 HydrophobicContact CD1-CD1 3.91Å; L29-L33 HydrophobicContact CG-CD1 4.05Å; L29-L33 WeakPolarHBondContact O-CB 3.47Å; L29-L33 WeakPolarHBondContact O-CD1 3.4Å; L29-L33 PolarHBondContact O-N 3.16Å; E30-L33 PolarHBondContact O-N 2.91Å; E30-L33 VanDerWaalsContact O-N 3.16Å; L33-G35 PolarHBondContact O-N 3.24Å; L33-V41 HydrophobicContact CD2-CB 4.11Å; L33-V41 HydrophobicContact CD2-CG1 3.43Å; L33-V41 VanDerWaalsContact CD2-CG1 3.43Å; L33-V41 HydrophobicContact CD2-CG2 3.67Å
34	Q	67.4	Low	77.7	Confident	185 Å²	185	85.7 Å²	85.7	86%	0.864	45%	0.448	S	S	*	.	T	Hydrogen-bonded Turn	trans	50	25.5	-175	-57.8	-172.6	-24.3	0	0	113.1	E30 Q32	E30-Q34 PolarHBondContact O-N 3.09Å; E30-Q34 VanDerWaalsContact O-N 3.14Å; Q32-Q34 VanDerWaalsContact C-N 3.33Å
35	G	65.3	Low	78	Confident	31 Å²	31	81.9 Å²	81.9	32%	0.32	43%	0.427	S	S	.	.	S	Bend	trans	-114.7	13.2	-167.6	0	0	0	0	0	114	L33	L33-G35 PolarHBondContact O-N 3.24Å
36	G	74.8	Confident	78.2	Confident	47 Å²	47	84 Å²	84	49%	0.485	44%	0.435	S	S	.	.	S	Bend	trans	84.9	-146.2	-173	0	0	0	0	0	112.2
37	Q	78.6	Confident	78.5	Confident	116 Å²	116	85.5 Å²	85.5	54%	0.542	44%	0.436	S	S	.	.			trans	-77.7	149.9	177.7	-66.7	-177.8	-7.7	0	0	111.2	E39 E40 V41	Q37-E39 PolarHBondContact O-N 2.99Å; Q37-E40 PolarHBondContact O-N 3.32Å; Q37-E40 VanDerWaalsContact O-N 3.11Å; Q37-V41 PolarHBondContact O-N 3.11Å
38	L	77.1	Confident	78.6	Confident	35 Å²	35	80.5 Å²	80.5	18%	0.183	42%	0.415	C	S	.	.	H	α-helix	trans	-58.8	-31.6	179.4	-98	152.7	0	0	0	113.7	V26 L29 E30 V41 I42	V26-L38 HydrophobicContact CB-CD1 4.32Å; V26-L38 HydrophobicContact CG1-CD1 3.45Å; V26-L38 VanDerWaalsContact CG1-CD1 3.45Å; L29-L38 HydrophobicContact CD2-CD1 4.1Å; L29-L38 HydrophobicContact CD2-CD2 4.02Å; E30-L38 HydrophobicContact CG-CB 4.34Å; E30-L38 HydrophobicContact CG-CD1 3.67Å; E30-L38 HydrophobicContact CG-CG 3.81Å; E30-L38 PolarHBondContact OE1-N 3.26Å; L38-V41 WeakPolarHBondContact O-CB 3.5Å; L38-V41 PolarHBondContact O-N 3.22Å; L38-I42 VanDerWaalsContact O-CG1 3.3Å; L38-I42 WeakPolarHBondContact O-CG1 3.42Å; L38-I42 PolarHBondContact O-N 3.36Å
39	E	82	Confident	78.8	Confident	129 Å²	129	79.6 Å²	79.6	60%	0.603	42%	0.415	S	S	*	.	H	α-helix	trans	-62.5	-41.7	176.3	-67.4	83.2	173	0	0	112.1	Q37 V41 I42 L43	Q37-E39 PolarHBondContact O-N 2.99Å; E39-V41 VanDerWaalsContact C-N 3.33Å; E39-I42 PolarHBondContact O-N 3.3Å; E39-L43 WeakPolarHBondContact O-CB 3.39Å; E39-L43 PolarHBondContact O-N 2.9Å
40	E	79.7	Confident	79.3	Confident	116 Å²	116	82.2 Å²	82.2	54%	0.542	43%	0.429	S	S	.	.	H	α-helix	trans	-67	-38.7	177.7	-64.2	-177.3	173.5	0	0	110.7	Q37 L43 Q44	Q37-E40 PolarHBondContact O-N 3.32Å; Q37-E40 VanDerWaalsContact O-N 3.11Å; E40-L43 PolarHBondContact O-N 3.38Å; E40-Q44 WeakPolarHBondContact O-CB 3.44Å; E40-Q44 PolarHBondContact O-N 2.87Å
41	V	80.1	Confident	79.7	Confident	20 Å²	20	83 Å²	83	12%	0.121	43%	0.434	C	S	.	.	H	α-helix	trans	-63.4	-44.9	176.1	174.9	0	0	0	0	111.3	L33 Q37 L38 E39 L43 Q44 A45	L33-V41 HydrophobicContact CD2-CB 4.11Å; L33-V41 HydrophobicContact CD2-CG1 3.43Å; L33-V41 VanDerWaalsContact CD2-CG1 3.43Å; L33-V41 HydrophobicContact CD2-CG2 3.67Å; Q37-V41 PolarHBondContact O-N 3.11Å; L38-V41 WeakPolarHBondContact O-CB 3.5Å; L38-V41 PolarHBondContact O-N 3.22Å; E39-V41 VanDerWaalsContact C-N 3.33Å; V41-L43 VanDerWaalsContact C-N 3.34Å; V41-Q44 PolarHBondContact O-N 3.24Å; V41-A45 WeakPolarHBondContact O-CB 3.47Å; V41-A45 PolarHBondContact O-N 3.14Å
42	I	82.4	Confident	79.9	Confident	99 Å²	99	79.1 Å²	79.1	51%	0.508	42%	0.421	S	S	.	.	H	α-helix	trans	-62.3	-45.7	178	-68.8	164.4	0	0	0	109.9	L38 E39 Q44 A45 E46	L38-I42 VanDerWaalsContact O-CG1 3.3Å; L38-I42 WeakPolarHBondContact O-CG1 3.42Å; L38-I42 PolarHBondContact O-N 3.36Å; E39-I42 PolarHBondContact O-N 3.3Å; I42-Q44 VanDerWaalsContact C-N 3.34Å; I42-Q44 PolarHBondContact O-N 3.04Å; I42-A45 WeakPolarHBondContact O-CB 3.3Å; I42-A45 PolarHBondContact O-N 2.84Å; I42-E46 PolarHBondContact O-N 3.45Å
43	L	84.1	Confident	80.4	Confident	91 Å²	91	81.2 Å²	81.2	48%	0.476	42%	0.424	S	S	.	.	H	α-helix	trans	-62	-42.3	178.3	-176.1	64.9	0	0	0	111.7	E39 E40 V41 A45 E46 H47	E39-L43 WeakPolarHBondContact O-CB 3.39Å; E39-L43 PolarHBondContact O-N 2.9Å; E40-L43 PolarHBondContact O-N 3.38Å; V41-L43 VanDerWaalsContact C-N 3.34Å; L43-A45 PolarHBondContact O-N 3.35Å; L43-E46 PolarHBondContact O-N 3.43Å; L43-H47 PolarHBondContact O-CD2 2.84Å; L43-H47 PolarHBondContact O-N 2.94Å
44	Q	80.6	Confident	81	Confident	81 Å²	81	85.9 Å²	85.9	38%	0.379	44%	0.444	S	S	.	.	H	α-helix	trans	-61.9	-43.2	174.9	-178.7	173.9	-21.4	0	0	111.5	E40 V41 I42 E46 H47 E48	E40-Q44 WeakPolarHBondContact O-CB 3.44Å; E40-Q44 PolarHBondContact O-N 2.87Å; V41-Q44 PolarHBondContact O-N 3.24Å; I42-Q44 VanDerWaalsContact C-N 3.34Å; I42-Q44 PolarHBondContact O-N 3.04Å; Q44-E46 VanDerWaalsContact C-N 3.29Å; Q44-E46 PolarHBondContact O-N 2.95Å; Q44-H47 PolarHBondContact O-N 3.5Å; Q44-H47 VanDerWaalsContact O-N 3.14Å; Q44-E48 HydrophobicContact CG-CG 4.37Å; Q44-E48 PolarHBondContact NE2-OE1 3.36Å; Q44-E48 WeakPolarHBondContact O-CG 3.48Å; Q44-E48 PolarHBondContact O-N 3.2Å
45	A	82.2	Confident	81.7	Confident	48 Å²	48	78.4 Å²	78.4	40%	0.397	41%	0.409	S	S	.	.	H	α-helix	trans	-60.4	-38.2	177.5	0	0	0	0	0	112.1	V41 I42 L43 L49	V41-A45 WeakPolarHBondContact O-CB 3.47Å; V41-A45 PolarHBondContact O-N 3.14Å; I42-A45 WeakPolarHBondContact O-CB 3.3Å; I42-A45 PolarHBondContact O-N 2.84Å; L43-A45 PolarHBondContact O-N 3.35Å; A45-L49 WeakPolarHBondContact O-CB 3.39Å; A45-L49 PolarHBondContact O-N 3.06Å
46	E	85.9	Confident	82.3	Confident	110 Å²	110	86.5 Å²	86.5	51%	0.514	43%	0.43	S	S	.	.	H	α-helix	trans	-66.5	-42.1	173.6	-70	-172.6	166.4	0	0	112.5	I42 L43 Q44 L49 N50	I42-E46 PolarHBondContact O-N 3.45Å; L43-E46 PolarHBondContact O-N 3.43Å; Q44-E46 VanDerWaalsContact C-N 3.29Å; Q44-E46 PolarHBondContact O-N 2.95Å; E46-L49 PolarHBondContact O-N 3.18Å; E46-N50 WeakPolarHBondContact O-CB 3.32Å; E46-N50 PolarHBondContact O-N 3.03Å; E46-N50 PolarHBondContact O-ND2 3.31Å
47	H	85.7	Confident	82.7	Confident	116 Å²	116	91.5 Å²	91.5	54%	0.537	44%	0.441	S	S	.	.	H	α-helix	trans	-63	-42.8	175.4	-72.6	-46.5	0	0	0	111.8	L43 Q44 N50 L51	L43-H47 PolarHBondContact O-CD2 2.84Å; L43-H47 PolarHBondContact O-N 2.94Å; Q44-H47 PolarHBondContact O-N 3.5Å; Q44-H47 VanDerWaalsContact O-N 3.14Å; H47-N50 PolarHBondContact O-N 2.89Å; H47-L51 WeakPolarHBondContact O-CB 3.33Å; H47-L51 PolarHBondContact O-N 2.86Å
48	E	83.6	Confident	82.8	Confident	44 Å²	44	93 Å²	93	21%	0.206	44%	0.442	C	S	.	.	H	α-helix	trans	-63.6	-43	175.8	-74.8	-174.8	-164.8	0	0	112.1	L11 Q44 N50 L51 A52	L11-E48 HydrophobicContact CD2-CB 3.78Å; L11-E48 HydrophobicContact CD2-CG 3.63Å; Q44-E48 HydrophobicContact CG-CG 4.37Å; Q44-E48 PolarHBondContact NE2-OE1 3.36Å; Q44-E48 WeakPolarHBondContact O-CG 3.48Å; Q44-E48 PolarHBondContact O-N 3.2Å; E48-N50 VanDerWaalsContact C-N 3.33Å; E48-N50 PolarHBondContact O-N 3.2Å; E48-L51 PolarHBondContact O-N 3.12Å; E48-A52 WeakPolarHBondContact O-CB 3.42Å; E48-A52 PolarHBondContact O-N 3.29Å
49	L	84.4	Confident	82.9	Confident	92 Å²	92	96 Å²	96	48%	0.482	45%	0.454	S	S	.	.	H	α-helix	trans	-59.6	-46	175.7	-173.6	87.1	0	0	0	111.1	A45 E46 L51 A52 R53	A45-L49 WeakPolarHBondContact O-CB 3.39Å; A45-L49 PolarHBondContact O-N 3.06Å; E46-L49 PolarHBondContact O-N 3.18Å; L49-L51 VanDerWaalsContact C-N 3.35Å; L49-A52 PolarHBondContact O-N 3.43Å; L49-R53 WeakPolarHBondContact O-CG 3.29Å; L49-R53 PolarHBondContact O-N 3.13Å; L49-R53 VanDerWaalsContact O-N 3.13Å
50	N	88.1	Confident	82.3	Confident	73 Å²	73	94.3 Å²	94.3	39%	0.39	45%	0.448	S	S	.	.	H	α-helix	trans	-66.3	-38.2	178.2	-76.4	-40.1	0	0	0	111.9	E46 H47 E48 R53 K54	E46-N50 WeakPolarHBondContact O-CB 3.32Å; E46-N50 PolarHBondContact O-N 3.03Å; E46-N50 PolarHBondContact O-ND2 3.31Å; H47-N50 PolarHBondContact O-N 2.89Å; E48-N50 VanDerWaalsContact C-N 3.33Å; E48-N50 PolarHBondContact O-N 3.2Å; N50-R53 PolarHBondContact O-N 3.42Å; N50-K54 WeakPolarHBondContact O-CG 3.26Å; N50-K54 PolarHBondContact O-N 3.23Å; N50-K54 VanDerWaalsContact O-N 3.13Å
51	L	84.7	Confident	82.2	Confident	63 Å²	63	95.5 Å²	95.5	33%	0.33	45%	0.448	S	S	.	.	H	α-helix	trans	-63.1	-47.8	174.7	-177.3	65.2	0	0	0	110.9	H47 E48 L49 R53 K54 M55 W58	H47-L51 WeakPolarHBondContact O-CB 3.33Å; H47-L51 PolarHBondContact O-N 2.86Å; E48-L51 PolarHBondContact O-N 3.12Å; L49-L51 VanDerWaalsContact C-N 3.35Å; L51-R53 VanDerWaalsContact C-N 3.26Å; L51-R53 PolarHBondContact O-N 2.84Å; L51-K54 PolarHBondContact O-N 2.8Å; L51-K54 VanDerWaalsContact O-N 3.09Å; L51-M55 HydrophobicContact CD1-CE 3.88Å; L51-M55 HydrophobicContact CD1-CG 4.38Å; L51-M55 HydrophobicContact CD2-CE 3.66Å; L51-M55 HydrophobicContact CG-CE 3.62Å; L51-M55 HydrophobicContact CG-CG 4.26Å; L51-M55 HydrophobicContact CG-SD 4.25Å; L51-M55 VanDerWaalsContact O-CG 3.29Å; L51-M55 WeakPolarHBondContact O-CG 3.39Å; L51-M55 PolarHBondContact O-N 3.09Å; L51-W58 HydrophobicContact CD1-CZ3 4.43Å
52	A	83.4	Confident	82	Confident	50 Å²	50	99.6 Å²	99.6	41%	0.413	47%	0.466	S	S	.	.	H	α-helix	trans	-58.9	-37.8	179	0	0	0	0	0	112.3	E48 L49 R56	E48-A52 WeakPolarHBondContact O-CB 3.42Å; E48-A52 PolarHBondContact O-N 3.29Å; L49-A52 PolarHBondContact O-N 3.43Å; A52-R56 PolarHBondContact O-N 3.13Å
53	R	86.2	Confident	81.9	Confident	150 Å²	150	100.4 Å²	100.4	57%	0.566	48%	0.477	S	S	*	.	H	α-helix	trans	-62.4	-48.5	173.2	-72	172.1	177.1	174.1	-2.1	111.6	L49 N50 L51 R56	L49-R53 WeakPolarHBondContact O-CG 3.29Å; L49-R53 PolarHBondContact O-N 3.13Å; L49-R53 VanDerWaalsContact O-N 3.13Å; N50-R53 PolarHBondContact O-N 3.42Å; L51-R53 VanDerWaalsContact C-N 3.26Å; L51-R53 PolarHBondContact O-N 2.84Å; R53-R56 WeakPolarHBondContact O-CB 3.44Å; R53-R56 PolarHBondContact O-N 3.45Å
54	K	85.1	Confident	81.6	Confident	108 Å²	108	103.2 Å²	103.2	47%	0.47	49%	0.492	S	S	.	.	H	α-helix	trans	-65.4	-38.7	178.2	-69.8	177.8	-179.8	-179.2	0	112.7	N50 L51 R56 E57 W58	N50-K54 WeakPolarHBondContact O-CG 3.26Å; N50-K54 PolarHBondContact O-N 3.23Å; N50-K54 VanDerWaalsContact O-N 3.13Å; L51-K54 PolarHBondContact O-N 2.8Å; L51-K54 VanDerWaalsContact O-N 3.09Å; K54-R56 PolarHBondContact O-N 3.01Å; K54-E57 WeakPolarHBondContact O-CB 3.43Å; K54-E57 PolarHBondContact O-N 3.42Å; K54-W58 HydrophobicContact CB-CD2 4.28Å; K54-W58 HydrophobicContact CB-CE3 4.29Å; K54-W58 HydrophobicContact CB-CH2 4.11Å; K54-W58 HydrophobicContact CB-CZ2 4.06Å; K54-W58 HydrophobicContact CB-CZ3 4.21Å; K54-W58 HydrophobicContact CD-CH2 4.1Å; K54-W58 HydrophobicContact CD-CZ2 4.09Å; K54-W58 HydrophobicContact CG-CZ2 4.48Å; K54-W58 PolarHBondContact O-N 3.07Å
55	M	81.1	Confident	81.3	Confident	27 Å²	27	106.2 Å²	106.2	13%	0.133	52%	0.515	C	S	.	.	H	α-helix	trans	-59.4	-30.7	176.3	-73.1	-171.1	170.5	0	0	112.3	T9 L11 L51 E57 K59 L60 W61	T9-M55 HydrophobicContact CG2-CE 3.32Å; T9-M55 HydrophobicContact CG2-SD 3.99Å; L11-M55 HydrophobicContact CD1-SD 4.23Å; L51-M55 HydrophobicContact CD1-CE 3.88Å; L51-M55 HydrophobicContact CD1-CG 4.38Å; L51-M55 HydrophobicContact CD2-CE 3.66Å; L51-M55 HydrophobicContact CG-CE 3.62Å; L51-M55 HydrophobicContact CG-CG 4.26Å; L51-M55 HydrophobicContact CG-SD 4.25Å; L51-M55 VanDerWaalsContact O-CG 3.29Å; L51-M55 WeakPolarHBondContact O-CG 3.39Å; L51-M55 PolarHBondContact O-N 3.09Å; M55-E57 VanDerWaalsContact C-N 3.32Å; M55-K59 PolarHBondContact O-N 3.25Å; M55-K59 VanDerWaalsContact O-N 3.12Å; M55-L60 HydrophobicContact CB-CD1 4.41Å; M55-L60 HydrophobicContact CE-CD1 4.28Å; M55-L60 HydrophobicContact CG-CD1 3.82Å; M55-L60 HydrophobicContact SD-CD1 4.47Å; M55-W61 VanDerWaalsContact O-CZ3 3.26Å; M55-W61 WeakPolarHBondContact O-CZ3 3.07Å
56	R	77.8	Confident	81.1	Confident	202 Å²	202	111.7 Å²	111.7	76%	0.762	53%	0.533	S	S	*	.	H	α-helix	trans	-64.1	-39	174.5	-171.5	179.7	175.9	-176.7	-1.3	112.4	A52 R53 K54	A52-R56 PolarHBondContact O-N 3.13Å; R53-R56 WeakPolarHBondContact O-CB 3.44Å; R53-R56 PolarHBondContact O-N 3.45Å; K54-R56 PolarHBondContact O-N 3.01Å
57	E	83.4	Confident	80.6	Confident	152 Å²	152	115 Å²	115	71%	0.71	55%	0.548	S	S	*	.	H	α-helix	trans	-75.2	-41.7	179.1	-64.3	172.9	179.6	0	0	111.2	K54 M55 K59	K54-E57 WeakPolarHBondContact O-CB 3.43Å; K54-E57 PolarHBondContact O-N 3.42Å; M55-E57 VanDerWaalsContact C-N 3.32Å; E57-K59 VanDerWaalsContact C-N 3.31Å; E57-K59 PolarHBondContact O-N 3.22Å
58	W	82	Confident	80.4	Confident	147 Å²	147	112.7 Å²	112.7	56%	0.557	54%	0.544	S	S	*	.	H	α-helix	trans	-74	-18.3	-177.2	-63.2	-19.3	0	0	0	114.4	L51 K54 L60	L51-W58 HydrophobicContact CD1-CZ3 4.43Å; K54-W58 HydrophobicContact CB-CD2 4.28Å; K54-W58 HydrophobicContact CB-CE3 4.29Å; K54-W58 HydrophobicContact CB-CH2 4.11Å; K54-W58 HydrophobicContact CB-CZ2 4.06Å; K54-W58 HydrophobicContact CB-CZ3 4.21Å; K54-W58 HydrophobicContact CD-CH2 4.1Å; K54-W58 HydrophobicContact CD-CZ2 4.09Å; K54-W58 HydrophobicContact CG-CZ2 4.48Å; K54-W58 PolarHBondContact O-N 3.07Å; W58-L60 HydrophobicContact CB-CD1 4.48Å; W58-L60 HydrophobicContact CB-CD2 4.26Å; W58-L60 HydrophobicContact CB-CG 3.91Å; W58-L60 HydrophobicContact CE3-CD1 4.09Å; W58-L60 PolarHBondContact O-N 3.13Å; W58-L60 VanDerWaalsContact O-N 3.13Å
59	K	78.4	Confident	80.4	Confident	99 Å²	99	114.9 Å²	114.9	43%	0.43	56%	0.562	S	S	.	*	T	Hydrogen-bonded Turn	trans	44.3	46.8	-179.5	-56.4	-174.2	-170.3	169.1	0	113.4	M55 E57 W61 E62	M55-K59 PolarHBondContact O-N 3.25Å; M55-K59 VanDerWaalsContact O-N 3.12Å; E57-K59 VanDerWaalsContact C-N 3.31Å; E57-K59 PolarHBondContact O-N 3.22Å; K59-W61 HydrophobicContact CB-CZ2 4.03Å; K59-W61 HydrophobicContact CG-CZ2 3.96Å; K59-W61 PolarHBondContact O-N 3.42Å; K59-E62 HydrophobicContact CB-CG 4.1Å; K59-E62 WeakPolarHBondContact CD-OE1 3.47Å; K59-E62 IonicContact NZ-OE1 3.74Å; K59-E62 WeakPolarHBondContact O-CB 3.43Å; K59-E62 PolarHBondContact O-N 2.95Å
60	L	68.8	Low	80	Confident	93 Å²	93	115.3 Å²	115.3	49%	0.487	58%	0.578	S	S	.	*	T	Hydrogen-bonded Turn	trans	-58.3	-11.4	-175.1	-66.3	162.2	0	0	0	115	M55 W58 E62	M55-L60 HydrophobicContact CB-CD1 4.41Å; M55-L60 HydrophobicContact CE-CD1 4.28Å; M55-L60 HydrophobicContact CG-CD1 3.82Å; M55-L60 HydrophobicContact SD-CD1 4.47Å; W58-L60 HydrophobicContact CB-CD1 4.48Å; W58-L60 HydrophobicContact CB-CD2 4.26Å; W58-L60 HydrophobicContact CB-CG 3.91Å; W58-L60 HydrophobicContact CE3-CD1 4.09Å; W58-L60 PolarHBondContact O-N 3.13Å; W58-L60 VanDerWaalsContact O-N 3.13Å; L60-E62 VanDerWaalsContact C-N 3.29Å
61	W	77.3	Confident	79.5	Confident	141 Å²	141	118 Å²	118	53%	0.534	59%	0.592	S	S	.	*	T	Hydrogen-bonded Turn	trans	-79.5	-8.1	173.2	47.5	87.4	0	0	0	113.9	L5 M55 K59	L5-W61 HydrophobicContact CD1-CB 3.54Å; L5-W61 HydrophobicContact CD1-CD2 4.19Å; L5-W61 HydrophobicContact CD1-CE3 3.6Å; L5-W61 HydrophobicContact CD1-CG 4.23Å; M55-W61 VanDerWaalsContact O-CZ3 3.26Å; M55-W61 WeakPolarHBondContact O-CZ3 3.07Å; K59-W61 HydrophobicContact CB-CZ2 4.03Å; K59-W61 HydrophobicContact CG-CZ2 3.96Å; K59-W61 PolarHBondContact O-N 3.42Å
62	E	77.3	Confident	79.4	Confident	106 Å²	106	120.7 Å²	120.7	50%	0.495	60%	0.603	S	S	.	*	S	Bend	trans	-71.2	146.1	174.1	-69.1	179.3	173.8	0	0	109.6	K59 L60	K59-E62 HydrophobicContact CB-CG 4.1Å; K59-E62 WeakPolarHBondContact CD-OE1 3.47Å; K59-E62 IonicContact NZ-OE1 3.74Å; K59-E62 WeakPolarHBondContact O-CB 3.43Å; K59-E62 PolarHBondContact O-N 2.95Å; L60-E62 VanDerWaalsContact C-N 3.29Å
63	P	79.4	Confident	79.3	Confident	116 Å²	116	128 Å²	128	75%	0.753	62%	0.621	S	S	*	*	P	Polyproline II helix	trans	-54.4	155.9	174.3	-23.7	33.8	0	0	0	111.6	V65	P63-V65 PolarHBondContact O-N 3.01Å
64	L	77.4	Confident	78.9	Confident	149 Å²	149	128.1 Å²	128.1	78%	0.78	63%	0.625	S	S	*	*	P	Polyproline II helix	trans	-48.2	127.5	174.3	-74.3	156.8	0	0	0	109.9	E66	L64-E66 PolarHBondContact O-N 3.22Å
65	V	75.8	Confident	78.4	Confident	144 Å²	144	133.7 Å²	133.7	87%	0.873	64%	0.643	S	S	*	*	S	Bend	trans	-64	-35.7	-179.8	-178.7	0	0	0	0	110.3	P63	P63-V65 PolarHBondContact O-N 3.01Å
66	E	76.4	Confident	78.5	Confident	164 Å²	164	137.1 Å²	137.1	77%	0.766	67%	0.668	S	S	*	*	S	Bend	trans	-142	141.6	174.9	-64.5	-174.8	165.2	0	0	110.8	L64	L64-E66 PolarHBondContact O-N 3.22Å
67	E	76.2	Confident	77.9	Confident	178 Å²	178	138 Å²	138	83%	0.832	69%	0.685	S	S	*	*	P	Polyproline II helix	trans	-72.2	138.2	171.5	-67.2	-173.7	173.3	0	0	109.9
68	P	81.6	Confident	77.7	Confident	69 Å²	69	137.3 Å²	137.3	45%	0.448	68%	0.684	S	S	.	*	P	Polyproline II helix	trans	-65.1	145.5	-179.9	27.1	-33.8	0	0	0	111.1
69	P	83.6	Confident	77.4	Confident	90 Å²	90	136.7 Å²	136.7	58%	0.584	69%	0.69	S	S	*	*	P	Polyproline II helix	trans	-55.7	143.7	171.8	-23.3	32.6	0	0	0	111.7	D71 Q72	P69-D71 PolarHBondContact O-N 3Å; P69-Q72 HydrophobicContact CB-CB 4.44Å; P69-Q72 VanDerWaalsContact O-CB 3.25Å; P69-Q72 WeakPolarHBondContact O-CB 3.25Å; P69-Q72 PolarHBondContact O-N 3.41Å
70	A	75.9	Confident	77.4	Confident	100 Å²	100	138.8 Å²	138.8	83%	0.826	71%	0.705	S	S	*	*	T	Hydrogen-bonded Turn	trans	-57.3	-24.7	-170.8	0	0	0	0	0	115
71	D	76.9	Confident	77.9	Confident	129 Å²	129	141.5 Å²	141.5	69%	0.69	72%	0.718	S	S	*	*	T	Hydrogen-bonded Turn	trans	-100.1	-4	-178.7	-64.2	-41.2	0	0	0	113.9	P69 W73	P69-D71 PolarHBondContact O-N 3Å; D71-W73 VanDerWaalsContact C-N 3.28Å; D71-W73 PolarHBondContact O-N 3Å
72	Q	82.9	Confident	77.9	Confident	120 Å²	120	141.6 Å²	141.6	56%	0.561	73%	0.729	S	S	*	*	T	Hydrogen-bonded Turn	trans	-62.7	-29.6	-171.9	-173.5	69	28	0	0	113.8	P69	P69-Q72 HydrophobicContact CB-CB 4.44Å; P69-Q72 VanDerWaalsContact O-CB 3.25Å; P69-Q72 WeakPolarHBondContact O-CB 3.25Å; P69-Q72 PolarHBondContact O-N 3.41Å
73	W	81.9	Confident	78	Confident	204 Å²	204	143.9 Å²	143.9	77%	0.773	75%	0.745	S	S	*	*	T	Hydrogen-bonded Turn	trans	-120.8	19.1	-171.6	-58	112.4	0	0	0	114	D71	D71-W73 VanDerWaalsContact C-N 3.28Å; D71-W73 PolarHBondContact O-N 3Å
74	K	77.9	Confident	77.9	Confident	152 Å²	152	145.9 Å²	145.9	66%	0.661	74%	0.744	S	S	*	*			trans	-86.2	119.2	-178.6	-150.8	-179.3	-176.2	-175.8	0	111
75	W	73.6	Confident	77.9	Confident	225 Å²	225	145.7 Å²	145.7	85%	0.852	74%	0.741	S	S	*	*			trans	-148.8	139.2	176.9	-171.5	-96.2	0	0	0	111.9
76	P	84.2	Confident	78.1	Confident	99 Å²	99	145.8 Å²	145.8	64%	0.643	73%	0.73	S	S	*	*			cis	-72	167.9	-14.5	-2.4	19.8	0	0	0	112
77	I	66.1	Low	78.3	Confident	220 Å²	220	144.2 Å²	144.2	100%	1.128	73%	0.727	S	S	*	*			trans	-70.7	0	173.3	-57.9	168	0	0	0	110.2

Retrieved 77 of 77 residues in 22.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).