A0A087WXU5_HUMAN Loading...

Zinc finger CCHC domain-containing protein 17

AlphaFold DB , UniProt , Accession A0A087WXU5, Species HUMAN (Homo sapiens, Human), Gene ZCCHC17, Length 146 aa.

						>A0A087WXU5_HUMAN|A0A087WXU5|ZCCHC17
MNSGRPETMENLPALYTIFQGEVAMVTDYGAFIKIPGCRKQGLVHRTHMSSCRVDKPSEIVDVGDKVWVKLIGREMKNDRIKVSLSMKVVNQGTGKDLDPNNVIIEQEERRRRSFQDYTGQKITLEAVLNTTCKKCGCKGEEEKET
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	43.2	Very low	52.1	Low	234 Å²	234	138 Å²	138	100%	1.153	74%	0.738	S	S	*	*				0	119.9	0	-62.1	81.3	166.9	0	0	107.2	S3	M1-S3 PolarHBondContact O-N 3.23Å
2	N	42.6	Very low	54.4	Low	174 Å²	174	129.3 Å²	129.3	93%	0.93	69%	0.692	S	S	*	*			trans	-66.6	110.1	-175.6	-93	-15.7	0	0	0	110.6
3	S	45.9	Very low	56.7	Low	99 Å²	99	121.4 Å²	121.4	69%	0.692	65%	0.651	S	S	*	*			trans	-32.1	132.4	165.3	29.5	0	0	0	0	114.1	M1 R5	M1-S3 PolarHBondContact O-N 3.23Å; S3-R5 PolarHBondContact O-N 3.25Å
4	G	52.8	Low	59	Low	75 Å²	75	117.1 Å²	117.1	77%	0.773	64%	0.641	S	S	*	*	P	Polyproline II helix	trans	-51.4	120.6	165.9	0	0	0	0	0	109.6
5	R	59.1	Low	61.1	Low	220 Å²	220	114.4 Å²	114.4	83%	0.83	63%	0.625	S	S	*	*	P	Polyproline II helix	trans	-62.9	130.9	173.1	-79.6	-178.6	-178.4	164.3	1.3	107.9	S3 E7	S3-R5 PolarHBondContact O-N 3.25Å; R5-E7 PolarHBondContact O-N 3.33Å
6	P	47.8	Very low	63	Low	99 Å²	99	112.8 Å²	112.8	64%	0.643	61%	0.608	S	S	*	*	P	Polyproline II helix	trans	-57	139.6	171.8	24.7	-32.3	0	0	0	108.9	T8	P6-T8 PolarHBondContact O-N 3.33Å
7	E	49	Very low	64.8	Low	192 Å²	192	109.2 Å²	109.2	90%	0.897	59%	0.591	S	S	*	*			trans	-66.4	73.5	177.3	-64	-178.2	98.9	0	0	109.9	R5	R5-E7 PolarHBondContact O-N 3.33Å
8	T	47.5	Very low	66.4	Low	88 Å²	88	105.6 Å²	105.6	54%	0.54	57%	0.571	S	S	.	*			trans	-68.1	145.6	171	47.1	0	0	0	0	109.1	P6 E10 N11	P6-T8 PolarHBondContact O-N 3.33Å; T8-E10 PolarHBondContact O-N 3.34Å; T8-N11 PolarHBondContact O-N 3.14Å; T8-N11 PolarHBondContact O-ND2 3.39Å
9	M	52.8	Low	67.9	Low	168 Å²	168	101.2 Å²	101.2	83%	0.828	55%	0.546	S	S	*	.	T	Hydrogen-bonded Turn	trans	-58.9	-1	-166.6	-150.2	152.7	156.1	0	0	115.3
10	E	61.2	Low	69.2	Low	103 Å²	103	100.4 Å²	100.4	48%	0.481	54%	0.538	S	S	.	.	T	Hydrogen-bonded Turn	trans	-148.4	47.6	-169.5	-53.8	-167.9	105.9	0	0	112.9	T8 L12 M76	T8-E10 PolarHBondContact O-N 3.34Å; E10-L12 PolarHBondContact O-N 2.86Å; E10-M76 WeakPolarHBondContact OE1-CE 3.25Å
11	N	71.4	Confident	70.5	Confident	66 Å²	66	95.9 Å²	95.9	35%	0.353	52%	0.515	S	S	.	.			trans	-71.8	59.2	175.5	-81.7	-42.6	0	0	0	112.9	T8 C38	T8-N11 PolarHBondContact O-N 3.14Å; T8-N11 PolarHBondContact O-ND2 3.39Å; N11-C38 PolarHBondContact O-SG 3.21Å
12	L	80	Confident	73	Confident	34 Å²	34	88.2 Å²	88.2	18%	0.178	48%	0.477	C	S	.	.	P	Polyproline II helix	trans	-73.1	140.4	169.7	-76.1	164.3	0	0	0	110.2	E10 I35 I81 V83	E10-L12 PolarHBondContact O-N 2.86Å; L12-I35 HydrophobicContact CD2-CD1 4.47Å; L12-I81 HydrophobicContact CD1-CG2 3.82Å; L12-V83 HydrophobicContact CD1-CG2 4.41Å; L12-V83 HydrophobicContact CD2-CG1 4.48Å; L12-V83 HydrophobicContact CD2-CG2 3.65Å
13	P	84.4	Confident	75.5	Confident	26 Å²	26	79.9 Å²	79.9	17%	0.169	43%	0.432	C	S	.	.	P	Polyproline II helix	trans	-60.5	157.9	174.2	21.7	-28.2	0	0	0	111.2	T17 F19 I35 L71	P13-T17 HydrophobicContact CB-CG2 4.26Å; P13-F19 HydrophobicContact CB-CD1 4.32Å; P13-F19 HydrophobicContact CB-CE1 4.32Å; P13-F19 HydrophobicContact CG-CD1 4.03Å; P13-F19 HydrophobicContact CG-CE1 3.6Å; P13-F19 HydrophobicContact CG-CZ 4.26Å; P13-I35 HydrophobicContact CG-CG2 3.96Å; P13-L71 HydrophobicContact CG-CD2 4.2Å; P13-L71 WeakPolarHBondContact O-CD2 3.47Å
14	A	88.6	Confident	77.9	Confident	62 Å²	62	76.3 Å²	76.3	51%	0.512	41%	0.409	S	S	.	.	P	Polyproline II helix	trans	-64.1	151.1	174.7	0	0	0	0	0	110.5	Y16 T17 L71	A14-Y16 PolarHBondContact O-N 3.02Å; A14-T17 WeakPolarHBondContact O-CB 3.49Å; A14-T17 PolarHBondContact O-N 3.07Å; A14-T17 VanDerWaalsContact O-N 3.1Å; A14-T17 PolarHBondContact O-OG1 2.82Å; A14-L71 WeakPolarHBondContact O-CD2 3.36Å
15	L	90.5	Very high	79.9	Confident	76 Å²	76	77.9 Å²	77.9	40%	0.398	40%	0.397	S	S	.	.	T	Hydrogen-bonded Turn	trans	-54.8	141.7	177.1	-164.6	69.1	0	0	0	110.5	T17 L71	L15-T17 PolarHBondContact O-N 3.34Å; L15-L71 HydrophobicContact CD1-CG 4.43Å
16	Y	91.8	Very high	81.6	Confident	88 Å²	88	68.8 Å²	68.8	35%	0.345	37%	0.366	S	S	.	.	T	Hydrogen-bonded Turn	trans	64.7	9.4	-176.6	-48.7	-54.9	0	0	0	116	A14 L71 N102	A14-Y16 PolarHBondContact O-N 3.02Å; Y16-L71 WeakPolarHBondContact CA-O 3.39Å; Y16-L71 PolarHBondContact N-O 2.85Å; Y16-N102 HydrophobicContact CE1-CB 4.32Å
17	T	92.5	Very high	83.7	Confident	53 Å²	53	65.2 Å²	65.2	33%	0.325	34%	0.342	S	S	.	.			trans	-70	137.1	172.6	-56.5	0	0	0	0	110.4	P13 A14 L15 K70 L71	P13-T17 HydrophobicContact CB-CG2 4.26Å; A14-T17 WeakPolarHBondContact O-CB 3.49Å; A14-T17 PolarHBondContact O-N 3.07Å; A14-T17 VanDerWaalsContact O-N 3.1Å; A14-T17 PolarHBondContact O-OG1 2.82Å; L15-T17 PolarHBondContact O-N 3.34Å; T17-K70 WeakPolarHBondContact O-CA 3.43Å; T17-L71 PolarHBondContact O-N 3.19Å
18	I	94.3	Very high	85.7	Confident	44 Å²	44	62.4 Å²	62.4	23%	0.226	33%	0.334	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-97.3	134.4	171.7	-63.6	172.1	0	0	0	109.1	W68 V69 K70 V90 D97	I18-W68 HydrophobicContact CG2-CE3 3.87Å; I18-W68 HydrophobicContact CG2-CZ3 4.4Å; I18-V69 WeakPolarHBondContact CA-O 3.46Å; I18-K70 HydrophobicContact CD1-CD 4.47Å; I18-K70 HydrophobicContact CG1-CB 3.98Å; I18-K70 HydrophobicContact CG1-CD 4.19Å; I18-K70 HydrophobicContact CG1-CG 4.02Å; I18-V90 HydrophobicContact CD1-CG1 4.25Å; I18-V90 HydrophobicContact CD1-CG2 4.01Å; I18-V90 HydrophobicContact CG1-CG2 3.99Å; I18-V90 HydrophobicContact CG2-CG1 3.71Å; I18-V90 HydrophobicContact CG2-CG2 4.29Å; I18-D97 HydrophobicContact CD1-CB 3.43Å; I18-D97 VanDerWaalsContact CD1-CB 3.43Å
19	F	94.3	Very high	87.7	Confident	21 Å²	21	63.5 Å²	63.5	9%	0.092	33%	0.329	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-149.3	162	175.9	56.6	-91.3	0	0	0	110.4	P13 I35 P36 V69 L71 L85	P13-F19 HydrophobicContact CB-CD1 4.32Å; P13-F19 HydrophobicContact CB-CE1 4.32Å; P13-F19 HydrophobicContact CG-CD1 4.03Å; P13-F19 HydrophobicContact CG-CE1 3.6Å; P13-F19 HydrophobicContact CG-CZ 4.26Å; F19-I35 HydrophobicContact CD2-CG2 4.08Å; F19-I35 HydrophobicContact CE1-CG2 4.29Å; F19-I35 HydrophobicContact CE2-CB 3.98Å; F19-I35 HydrophobicContact CE2-CD1 4.44Å; F19-I35 HydrophobicContact CE2-CG1 3.71Å; F19-I35 HydrophobicContact CE2-CG2 3.61Å; F19-I35 HydrophobicContact CZ-CB 4.23Å; F19-I35 HydrophobicContact CZ-CD1 3.92Å; F19-I35 HydrophobicContact CZ-CG1 3.7Å; F19-I35 HydrophobicContact CZ-CG2 3.72Å; F19-P36 HydrophobicContact CD2-CG 4.42Å; F19-V69 HydrophobicContact CD2-CG2 3.75Å; F19-V69 HydrophobicContact CE1-CG2 4.34Å; F19-V69 HydrophobicContact CE2-CG2 3.29Å; F19-V69 HydrophobicContact CG-CG2 4.43Å; F19-V69 HydrophobicContact CZ-CG2 3.64Å; F19-V69 PolarHBondContact N-O 3.36Å; F19-V69 PolarHBondContact O-N 2.55Å; F19-L71 HydrophobicContact CE1-CB 4.33Å; F19-L85 HydrophobicContact CE1-CD2 4.29Å; F19-L85 HydrophobicContact CZ-CD1 4.33Å; F19-L85 HydrophobicContact CZ-CD2 3.76Å
20	Q	95.1	Very high	89.6	Confident	86 Å²	86	55.5 Å²	55.5	40%	0.402	29%	0.289	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.4	129.6	171.7	-166.8	175.3	54	0	0	109.2	P36 K66 V67 W68	Q20-P36 WeakPolarHBondContact O-CD 2.94Å; Q20-P36 WeakPolarHBondContact O-CG 3.49Å; Q20-K66 HydrophobicContact CG-CB 4.32Å; Q20-V67 WeakPolarHBondContact CA-O 3.34Å; Q20-W68 HydrophobicContact CB-CD2 4.12Å; Q20-W68 HydrophobicContact CB-CE3 4.04Å; Q20-W68 HydrophobicContact CB-CH2 4.15Å; Q20-W68 HydrophobicContact CB-CZ2 4.21Å; Q20-W68 HydrophobicContact CB-CZ3 4.06Å; Q20-W68 HydrophobicContact CG-CD2 4.46Å
21	G	94.8	Very high	91.2	Very high	5 Å²	5	50.6 Å²	50.6	5%	0.052	27%	0.266	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.9	165.4	177.9	0	0	0	0	0	111.8	K34 K66 V67	G21-K34 VanDerWaalsContact CA-O 3.25Å; G21-K34 WeakPolarHBondContact CA-O 3.32Å; G21-K66 WeakPolarHBondContact O-CA 3.4Å; G21-V67 PolarHBondContact N-O 2.84Å; G21-V67 PolarHBondContact O-N 2.75Å
22	E	95.9	Very high	92.4	Very high	73 Å²	73	49.7 Å²	49.7	34%	0.341	26%	0.259	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.1	133.5	178.6	-175.9	-166.3	117.1	0	0	110.2	A24 I33 K34 D65	E22-A24 PolarHBondContact O-N 3.24Å; E22-I33 CarbonylContact O-C 3.53Å; E22-I33 WeakPolarHBondContact O-CA 3.38Å; E22-K34 HydrophobicContact CB-CD 4.48Å; E22-K34 PolarHBondContact N-O 2.81Å; E22-K34 PolarHBondContact O-N 3.4Å; E22-K34 IonicContact OE1-NZ 2.84Å; E22-K34 PolarHBondContact OE1-NZ 3.41Å; E22-D65 CarbonylContact C-O 3.49Å; E22-D65 VanDerWaalsContact CA-O 3.31Å; E22-D65 WeakPolarHBondContact CA-O 3.42Å
23	V	96.5	Very high	93.1	Very high	0 Å²	0	48 Å²	48	0%	0	25%	0.251	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-67.3	116.8	174.6	-178.1	0	0	0	0	109.4	V26 I33 V61 D62 G64 D65 V67	V23-V26 HydrophobicContact CG1-CG2 3.69Å; V23-I33 HydrophobicContact CB-CD1 4.09Å; V23-I33 HydrophobicContact CG1-CD1 4.39Å; V23-I33 HydrophobicContact CG2-CD1 3.51Å; V23-V61 HydrophobicContact CG1-CG2 4.45Å; V23-V61 HydrophobicContact CG2-CB 4.1Å; V23-V61 HydrophobicContact CG2-CG2 4.41Å; V23-D62 VanDerWaalsContact CB-O 3.24Å; V23-D62 WeakPolarHBondContact CB-O 3.43Å; V23-D62 WeakPolarHBondContact CG1-O 3.43Å; V23-G64 PolarHBondContact O-N 2.86Å; V23-D65 HydrophobicContact CG2-CB 3.99Å; V23-D65 WeakPolarHBondContact CG2-O 3.24Å; V23-D65 PolarHBondContact N-O 3.45Å; V23-V67 HydrophobicContact CG2-CG1 4.39Å; V23-V67 HydrophobicContact CG2-CG2 4.16Å
24	A	95.2	Very high	93.6	Very high	24 Å²	24	51.2 Å²	51.2	20%	0.198	26%	0.262	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.3	-37.1	178	0	0	0	0	0	112.9	E22 F32 K34 V63	E22-A24 PolarHBondContact O-N 3.24Å; A24-F32 PolarHBondContact N-O 2.79Å; A24-K34 HydrophobicContact CB-CD 4.13Å; A24-K34 HydrophobicContact CB-CG 3.97Å; A24-V63 WeakPolarHBondContact O-CG1 3.46Å
25	M	94.6	Very high	93.8	Very high	108 Å²	108	48.6 Å²	48.6	53%	0.532	24%	0.239	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-156.1	143.5	-176.4	-172.2	177.7	-166.4	0	0	109.7	T27 A31 F32	M25-T27 HydrophobicContact CE-CG2 4.45Å; M25-T27 HydrophobicContact CG-CG2 4.39Å; M25-T27 HydrophobicContact SD-CG2 4.4Å; M25-A31 WeakPolarHBondContact O-CA 3.25Å; M25-F32 HydrophobicContact CB-CB 4.29Å; M25-F32 HydrophobicContact CB-CD2 4.29Å; M25-F32 PolarHBondContact N-O 3.36Å; M25-F32 PolarHBondContact O-N 3.42Å
26	V	94.7	Very high	93.8	Very high	29 Å²	29	49.1 Å²	49.1	18%	0.176	25%	0.247	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-114.7	139	173.1	-172.1	0	0	0	0	108.6	V23 P57 V61 V63	V23-V26 HydrophobicContact CG1-CG2 3.69Å; V26-P57 HydrophobicContact CG1-CB 4.19Å; V26-P57 HydrophobicContact CG1-CG 4.3Å; V26-V61 HydrophobicContact CG2-CG2 3.98Å; V26-V63 HydrophobicContact CG2-CG2 4.22Å
27	T	93.3	Very high	93.4	Very high	24 Å²	24	48.4 Å²	48.4	15%	0.147	27%	0.267	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-135.7	161.1	-179.7	64.7	0	0	0	0	109.1	M25 Y29 G30 F32 P57	M25-T27 HydrophobicContact CE-CG2 4.45Å; M25-T27 HydrophobicContact CG-CG2 4.39Å; M25-T27 HydrophobicContact SD-CG2 4.4Å; T27-Y29 HydrophobicContact CG2-CE1 4.28Å; T27-Y29 PolarHBondContact O-N 3.02Å; T27-Y29 VanDerWaalsContact O-N 3.07Å; T27-Y29 WeakPolarHBondContact OG1-CE1 3.38Å; T27-G30 CarbonylContact C-O 3.46Å; T27-G30 WeakPolarHBondContact CA-O 3.43Å; T27-G30 PolarHBondContact N-O 2.84Å; T27-G30 PolarHBondContact O-N 2.88Å; T27-G30 PolarHBondContact OG1-N 3.46Å; T27-G30 PolarHBondContact OG1-O 3.18Å; T27-F32 HydrophobicContact CG2-CD2 4.31Å; T27-F32 HydrophobicContact CG2-CE2 4.01Å; T27-P57 WeakPolarHBondContact O-CG 3.41Å
28	D	90.3	Very high	93.1	Very high	133 Å²	133	47.2 Å²	47.2	71%	0.711	26%	0.26	S	S	*	.	T	Hydrogen-bonded Turn	trans	-60.4	-25.4	-176.7	-57.5	-54.4	0	0	0	114.4
29	Y	89.5	Confident	92.6	Very high	111 Å²	111	54.8 Å²	54.8	44%	0.435	29%	0.286	S	S	.	.	T	Hydrogen-bonded Turn	trans	-94.3	-8.8	179.2	63.1	-95.9	0	0	0	113.7	T27 L43 H45 R46	T27-Y29 HydrophobicContact CG2-CE1 4.28Å; T27-Y29 PolarHBondContact O-N 3.02Å; T27-Y29 VanDerWaalsContact O-N 3.07Å; T27-Y29 WeakPolarHBondContact OG1-CE1 3.38Å; Y29-L43 HydrophobicContact CD2-CD1 4.29Å; Y29-L43 HydrophobicContact CD2-CD2 4.4Å; Y29-L43 HydrophobicContact CE2-CD1 3.74Å; Y29-L43 HydrophobicContact CE2-CD2 3.9Å; Y29-L43 HydrophobicContact CE2-CG 4.47Å; Y29-H45 PolarHBondContact O-CD2 3.44Å; Y29-H45 VanDerWaalsContact O-CD2 3.3Å; Y29-R46 PolarHBondContact O-N 2.79Å
30	G	93	Very high	92.3	Very high	0 Å²	0	57.6 Å²	57.6	0%	0	30%	0.298	C	S	.	.	E	Extended strand (participates in β ladder)	trans	162	-171.4	-176	0	0	0	0	0	115.4	T27 V44	T27-G30 CarbonylContact C-O 3.46Å; T27-G30 WeakPolarHBondContact CA-O 3.43Å; T27-G30 PolarHBondContact N-O 2.84Å; T27-G30 PolarHBondContact O-N 2.88Å; T27-G30 PolarHBondContact OG1-N 3.46Å; T27-G30 PolarHBondContact OG1-O 3.18Å; G30-V44 CarbonylContact C-O 3.57Å; G30-V44 WeakPolarHBondContact CA-O 3.43Å
31	A	95.4	Very high	92.2	Very high	0 Å²	0	58 Å²	58	0%	0	30%	0.3	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.6	140.6	-178.8	0	0	0	0	0	112.2	M25 I33 V44 M49 V61	M25-A31 WeakPolarHBondContact O-CA 3.25Å; A31-I33 HydrophobicContact CB-CD1 4.32Å; A31-V44 PolarHBondContact N-O 3.3Å; A31-V44 PolarHBondContact O-N 3.46Å; A31-M49 HydrophobicContact CB-CE 3.99Å; A31-V61 HydrophobicContact CB-CG2 3.99Å
32	F	95.9	Very high	92.1	Very high	46 Å²	46	57.8 Å²	57.8	20%	0.202	30%	0.298	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-93.2	123	173.7	-71.5	-86.3	0	0	0	110	A24 M25 T27 Q41 G42 L43	A24-F32 PolarHBondContact N-O 2.79Å; M25-F32 HydrophobicContact CB-CB 4.29Å; M25-F32 HydrophobicContact CB-CD2 4.29Å; M25-F32 PolarHBondContact N-O 3.36Å; M25-F32 PolarHBondContact O-N 3.42Å; T27-F32 HydrophobicContact CG2-CD2 4.31Å; T27-F32 HydrophobicContact CG2-CE2 4.01Å; F32-Q41 HydrophobicContact CD1-CB 4.45Å; F32-G42 CarbonylContact C-O 3.56Å; F32-G42 WeakPolarHBondContact CA-O 3.38Å; F32-L43 HydrophobicContact CD1-CB 4.37Å; F32-L43 HydrophobicContact CD1-CD1 4.26Å; F32-L43 HydrophobicContact CD2-CD1 4.27Å; F32-L43 HydrophobicContact CE1-CB 4.14Å; F32-L43 HydrophobicContact CE1-CD1 3.98Å; F32-L43 HydrophobicContact CE2-CD1 3.99Å; F32-L43 HydrophobicContact CG-CD1 4.4Å; F32-L43 HydrophobicContact CZ-CD1 3.84Å
33	I	95.6	Very high	92.1	Very high	0 Å²	0	56.3 Å²	56.3	0%	0	29%	0.292	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.4	128.1	-178.4	-48.8	-57.7	0	0	0	109	E22 V23 A31 G42 V44 V67 V69 L85	E22-I33 CarbonylContact O-C 3.53Å; E22-I33 WeakPolarHBondContact O-CA 3.38Å; V23-I33 HydrophobicContact CB-CD1 4.09Å; V23-I33 HydrophobicContact CG1-CD1 4.39Å; V23-I33 HydrophobicContact CG2-CD1 3.51Å; A31-I33 HydrophobicContact CB-CD1 4.32Å; I33-G42 PolarHBondContact N-O 3.36Å; I33-G42 PolarHBondContact O-N 2.9Å; I33-V44 HydrophobicContact CG1-CG2 3.75Å; I33-V67 HydrophobicContact CD1-CG2 3.8Å; I33-V67 HydrophobicContact CG1-CG2 4.39Å; I33-V67 HydrophobicContact CG2-CG2 4.33Å; I33-V69 HydrophobicContact CG1-CG1 4.41Å; I33-V69 HydrophobicContact CG2-CG2 4.45Å; I33-L85 HydrophobicContact CB-CD1 3.92Å; I33-L85 HydrophobicContact CG1-CD1 4.34Å
34	K	94.5	Very high	92	Very high	92 Å²	92	56.3 Å²	56.3	40%	0.4	29%	0.292	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-71	126.1	168.7	-75.1	158.5	-173.1	173.6	0	109	G21 E22 A24 Q41	G21-K34 VanDerWaalsContact CA-O 3.25Å; G21-K34 WeakPolarHBondContact CA-O 3.32Å; E22-K34 HydrophobicContact CB-CD 4.48Å; E22-K34 PolarHBondContact N-O 2.81Å; E22-K34 PolarHBondContact O-N 3.4Å; E22-K34 IonicContact OE1-NZ 2.84Å; E22-K34 PolarHBondContact OE1-NZ 3.41Å; A24-K34 HydrophobicContact CB-CD 4.13Å; A24-K34 HydrophobicContact CB-CG 3.97Å; K34-Q41 HydrophobicContact CG-CG 4.43Å
35	I	91.9	Very high	91.9	Very high	7 Å²	7	58 Å²	58	4%	0.036	30%	0.296	C	S	.	.	P	Polyproline II helix	trans	-91.8	126.8	175.9	-53.2	176.4	0	0	0	107.5	L12 P13 F19 G37 C38 V83 L85	L12-I35 HydrophobicContact CD2-CD1 4.47Å; P13-I35 HydrophobicContact CG-CG2 3.96Å; F19-I35 HydrophobicContact CD2-CG2 4.08Å; F19-I35 HydrophobicContact CE1-CG2 4.29Å; F19-I35 HydrophobicContact CE2-CB 3.98Å; F19-I35 HydrophobicContact CE2-CD1 4.44Å; F19-I35 HydrophobicContact CE2-CG1 3.71Å; F19-I35 HydrophobicContact CE2-CG2 3.61Å; F19-I35 HydrophobicContact CZ-CB 4.23Å; F19-I35 HydrophobicContact CZ-CD1 3.92Å; F19-I35 HydrophobicContact CZ-CG1 3.7Å; F19-I35 HydrophobicContact CZ-CG2 3.72Å; I35-G37 PolarHBondContact O-N 3.02Å; I35-C38 HydrophobicContact CB-CB 3.9Å; I35-C38 HydrophobicContact CG2-CB 4.2Å; I35-C38 WeakPolarHBondContact CG2-SG 3.45Å; I35-C38 PolarHBondContact O-N 2.87Å; I35-C38 VanDerWaalsContact O-N 3.13Å; I35-V83 HydrophobicContact CD1-CG1 3.85Å; I35-L85 HydrophobicContact CG1-CD1 4.48Å
36	P	89.8	Confident	91.7	Very high	87 Å²	87	58.9 Å²	58.9	57%	0.565	29%	0.293	S	S	*	.	T	Hydrogen-bonded Turn	trans	-62.3	128.9	-179.2	26.3	-34.7	0	0	0	110.5	F19 Q20 C38	F19-P36 HydrophobicContact CD2-CG 4.42Å; Q20-P36 WeakPolarHBondContact O-CD 2.94Å; Q20-P36 WeakPolarHBondContact O-CG 3.49Å; P36-C38 VanDerWaalsContact C-N 3.3Å; P36-C38 PolarHBondContact O-N 3.37Å
37	G	85.3	Confident	91.5	Very high	74 Å²	74	60.1 Å²	60.1	76%	0.763	30%	0.301	S	S	*	.	T	Hydrogen-bonded Turn	trans	79.1	5.9	-178.4	0	0	0	0	0	115.2	I35	I35-G37 PolarHBondContact O-N 3.02Å
38	C	84.8	Confident	91.5	Very high	27 Å²	27	59.3 Å²	59.3	18%	0.182	30%	0.295	C	S	.	.			trans	-113.2	142.9	173.5	-52.8	0	0	0	0	111.8	N11 I35 P36 K40	N11-C38 PolarHBondContact O-SG 3.21Å; I35-C38 HydrophobicContact CB-CB 3.9Å; I35-C38 HydrophobicContact CG2-CB 4.2Å; I35-C38 WeakPolarHBondContact CG2-SG 3.45Å; I35-C38 PolarHBondContact O-N 2.87Å; I35-C38 VanDerWaalsContact O-N 3.13Å; P36-C38 VanDerWaalsContact C-N 3.3Å; P36-C38 PolarHBondContact O-N 3.37Å; C38-K40 VanDerWaalsContact C-N 3.34Å
39	R	84.1	Confident	91.5	Very high	204 Å²	204	53.3 Å²	53.3	77%	0.77	26%	0.263	S	S	*	.	S	Bend	trans	-76.3	-22.4	169.2	-164.1	174.2	74.3	166	2.3	113.1
40	K	88.1	Confident	91.5	Very high	80 Å²	80	50 Å²	50	35%	0.348	26%	0.256	S	S	.	.	S	Bend	trans	-94.6	146.2	-178.7	-63.6	-68.5	-172.7	174.6	0	110.6	C38 I81	C38-K40 VanDerWaalsContact C-N 3.34Å; K40-I81 HydrophobicContact CG-CD1 4.29Å
41	Q	92.2	Very high	91.2	Very high	95 Å²	95	55.4 Å²	55.4	44%	0.444	29%	0.294	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-93.6	149.6	174.9	-63.7	169.3	-6.9	0	0	109.8	F32 K34	F32-Q41 HydrophobicContact CD1-CB 4.45Å; K34-Q41 HydrophobicContact CG-CG 4.43Å
42	G	93.7	Very high	90.7	Very high	0 Å²	0	60.1 Å²	60.1	0%	0	33%	0.325	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.8	146.9	170.8	0	0	0	0	0	112	F32 I33	F32-G42 CarbonylContact C-O 3.56Å; F32-G42 WeakPolarHBondContact CA-O 3.38Å; I33-G42 PolarHBondContact N-O 3.36Å; I33-G42 PolarHBondContact O-N 2.9Å
43	L	95.1	Very high	90	Very high	42 Å²	42	68.4 Å²	68.4	22%	0.22	36%	0.355	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.7	126.1	177.1	176.8	67.2	0	0	0	109.7	Y29 F32 V83 L85	Y29-L43 HydrophobicContact CD2-CD1 4.29Å; Y29-L43 HydrophobicContact CD2-CD2 4.4Å; Y29-L43 HydrophobicContact CE2-CD1 3.74Å; Y29-L43 HydrophobicContact CE2-CD2 3.9Å; Y29-L43 HydrophobicContact CE2-CG 4.47Å; F32-L43 HydrophobicContact CD1-CB 4.37Å; F32-L43 HydrophobicContact CD1-CD1 4.26Å; F32-L43 HydrophobicContact CD2-CD1 4.27Å; F32-L43 HydrophobicContact CE1-CB 4.14Å; F32-L43 HydrophobicContact CE1-CD1 3.98Å; F32-L43 HydrophobicContact CE2-CD1 3.99Å; F32-L43 HydrophobicContact CG-CD1 4.4Å; F32-L43 HydrophobicContact CZ-CD1 3.84Å; L43-V83 PolarHBondContact N-O 3.41Å; L43-L85 PolarHBondContact O-N 3.01Å
44	V	95.2	Very high	89.3	Confident	0 Å²	0	69.3 Å²	69.3	0%	0	36%	0.361	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-97.6	114.2	164.7	-174	0	0	0	0	107.7	G30 A31 I33 H48 M49 V69 L85 M87	G30-V44 CarbonylContact C-O 3.57Å; G30-V44 WeakPolarHBondContact CA-O 3.43Å; A31-V44 PolarHBondContact N-O 3.3Å; A31-V44 PolarHBondContact O-N 3.46Å; I33-V44 HydrophobicContact CG1-CG2 3.75Å; V44-H48 HydrophobicContact CG1-CB 4.18Å; V44-M49 HydrophobicContact CB-CG 4.33Å; V44-M49 HydrophobicContact CG1-CB 4.4Å; V44-M49 HydrophobicContact CG1-CG 3.53Å; V44-V69 HydrophobicContact CG2-CG1 4.19Å; V44-L85 HydrophobicContact CG2-CB 3.57Å; V44-L85 HydrophobicContact CG2-CD1 4.45Å; V44-M87 HydrophobicContact CG1-CG 4.04Å; V44-M87 HydrophobicContact CG1-SD 4.13Å; V44-M87 HydrophobicContact CG2-CG 4.14Å; V44-M87 HydrophobicContact CG2-SD 4.3Å
45	H	92.9	Very high	88.9	Confident	60 Å²	60	70.8 Å²	70.8	28%	0.278	37%	0.373	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-72.6	150.5	174.7	-175	-113.3	0	0	0	110.7	Y29 T47 H48 M49	Y29-H45 PolarHBondContact O-CD2 3.44Å; Y29-H45 VanDerWaalsContact O-CD2 3.3Å; H45-T47 PolarHBondContact ND1-OG1 2.76Å; H45-T47 PolarHBondContact O-N 2.8Å; H45-H48 CarbonylContact O-C 3.56Å; H45-H48 WeakPolarHBondContact O-CA 3.48Å; H45-H48 PolarHBondContact O-N 2.86Å; H45-M49 PolarHBondContact O-N 2.91Å
46	R	91.2	Very high	88.6	Confident	125 Å²	125	76.4 Å²	76.4	47%	0.472	40%	0.398	S	S	.	.	H	α-helix	trans	-49.9	-34.6	-177.9	64.7	179.2	179.8	178.7	-0	114.8	Y29 H48 M49	Y29-R46 PolarHBondContact O-N 2.79Å; R46-H48 VanDerWaalsContact C-N 3.28Å; R46-H48 PolarHBondContact O-N 2.78Å; R46-M49 PolarHBondContact O-N 2.83Å
47	T	90.1	Very high	88.5	Confident	56 Å²	56	72.4 Å²	72.4	34%	0.344	37%	0.371	S	S	.	.	H	α-helix	trans	-77.4	-12.9	178.8	64.7	0	0	0	0	113.8	H45 E108 R112	H45-T47 PolarHBondContact ND1-OG1 2.76Å; H45-T47 PolarHBondContact O-N 2.8Å; T47-E108 VanDerWaalsContact CB-OE1 3.32Å; T47-E108 WeakPolarHBondContact CB-OE1 3.07Å; T47-E108 PolarHBondContact OG1-OE1 2.95Å; T47-R112 PolarHBondContact OG1-NH2 3.01Å
48	H	92.3	Very high	88.6	Confident	7 Å²	7	71.9 Å²	71.9	3%	0.032	36%	0.356	C	S	.	.	H	α-helix	trans	-104.1	-2.6	174.2	-69.6	-73.5	0	0	0	112.8	V44 H45 R46 S86 M87 K88 E108 R112	V44-H48 HydrophobicContact CG1-CB 4.18Å; H45-H48 CarbonylContact O-C 3.56Å; H45-H48 WeakPolarHBondContact O-CA 3.48Å; H45-H48 PolarHBondContact O-N 2.86Å; R46-H48 VanDerWaalsContact C-N 3.28Å; R46-H48 PolarHBondContact O-N 2.78Å; H48-S86 PolarHBondContact ND1-OG 3.24Å; H48-M87 PolarHBondContact O-N 2.89Å; H48-K88 PolarHBondContact O-N 3.49Å; H48-E108 IonicContact CE1-OE1 2.72Å; H48-E108 IonicContact CE1-OE2 3.26Å; H48-E108 PolarHBondContact CE1-OE2 2.97Å; H48-E108 IonicContact ND1-OE2 3.57Å; H48-E108 IonicContact NE2-OE1 3.79Å; H48-R112 PolarHBondContact CD2-NH2 3.31Å; H48-R112 PolarHBondContact NE2-NH1 3.45Å; H48-R112 PolarHBondContact NE2-NH2 2.79Å
49	M	91.9	Very high	88.7	Confident	7 Å²	7	77.4 Å²	77.4	3%	0.034	38%	0.379	C	S	.	.	H	α-helix	trans	-75	-40.1	176.5	-68	-177.2	75.4	0	0	111.8	A31 V44 H45 R46 P57 I60 V61	A31-M49 HydrophobicContact CB-CE 3.99Å; V44-M49 HydrophobicContact CB-CG 4.33Å; V44-M49 HydrophobicContact CG1-CB 4.4Å; V44-M49 HydrophobicContact CG1-CG 3.53Å; H45-M49 PolarHBondContact O-N 2.91Å; R46-M49 PolarHBondContact O-N 2.83Å; M49-P57 HydrophobicContact CE-CB 3.75Å; M49-P57 HydrophobicContact SD-CB 3.45Å; M49-P57 WeakPolarHBondContact SD-CB 3.45Å; M49-I60 HydrophobicContact CE-CB 4.5Å; M49-V61 HydrophobicContact CE-CG1 4.25Å; M49-V61 HydrophobicContact CE-CG2 3.46Å; M49-V61 VanDerWaalsContact CE-CG2 3.46Å
50	S	89.4	Confident	88.9	Confident	41 Å²	41	71.2 Å²	71.2	29%	0.287	36%	0.36	S	S	.	.			trans	-142.2	161.6	179.7	-171	0	0	0	0	111.3	C52	S50-C52 VanDerWaalsContact C-N 3.32Å; S50-C52 PolarHBondContact OG-N 2.84Å
51	S	85.6	Confident	89.1	Confident	114 Å²	114	67.5 Å²	67.5	80%	0.797	35%	0.345	S	S	*	.	S	Bend	trans	-74.7	-27.6	169.6	-167.6	0	0	0	0	111.6
52	C	85.3	Confident	89.2	Confident	98 Å²	98	68 Å²	68	66%	0.662	35%	0.35	S	S	*	.	S	Bend	trans	-85.7	160.7	177.6	-60.9	0	0	0	0	111.3	S50 V54	S50-C52 VanDerWaalsContact C-N 3.32Å; S50-C52 PolarHBondContact OG-N 2.84Å; C52-V54 WeakPolarHBondContact O-CG2 3.5Å; C52-V54 PolarHBondContact O-N 3.13Å
53	R	80.8	Confident	89.3	Confident	220 Å²	220	72.7 Å²	72.7	83%	0.83	38%	0.379	S	S	*	.			trans	-62.8	127.7	172.4	-175.8	174.8	175.7	164.4	1.6	109.3	D55	R53-D55 IonicContact NE-OD1 3.72Å
54	V	82.1	Confident	89.3	Confident	20 Å²	20	72.5 Å²	72.5	12%	0.121	39%	0.387	C	S	.	.			trans	-110.9	119	177.7	-180	0	0	0	0	107.8	C52 K56 I60	C52-V54 WeakPolarHBondContact O-CG2 3.5Å; C52-V54 PolarHBondContact O-N 3.13Å; V54-K56 WeakPolarHBondContact CG1-O 3.31Å; V54-I60 HydrophobicContact CB-CD1 3.9Å; V54-I60 HydrophobicContact CG1-CD1 3.34Å; V54-I60 HydrophobicContact CG1-CG1 4.17Å; V54-I60 HydrophobicContact CG2-CD1 3.27Å
55	D	84.6	Confident	89.3	Confident	122 Å²	122	75.6 Å²	75.6	65%	0.652	40%	0.404	S	S	*	.	S	Bend	trans	-83.1	-45.9	173.8	-68.1	-55.6	0	0	0	110.9	R53	R53-D55 IonicContact NE-OD1 3.72Å
56	K	86.3	Confident	89.4	Confident	126 Å²	126	79.9 Å²	79.9	55%	0.548	42%	0.422	S	S	.	.			trans	-124.9	119.6	177	-66.4	179	-170.7	167	0	111.4	V54 S58 E59	V54-K56 WeakPolarHBondContact CG1-O 3.31Å; K56-S58 PolarHBondContact O-N 2.84Å; K56-E59 HydrophobicContact CB-CG 4.01Å; K56-E59 PolarHBondContact O-N 2.95Å
57	P	86.8	Confident	89.6	Confident	2 Å²	2	74.5 Å²	74.5	1%	0.013	40%	0.402	C	S	.	.	G	3₁₀ helix	trans	-67.4	-24.7	178.1	25.6	-32.1	0	0	0	113.1	V26 T27 M49 E59 I60 V61	V26-P57 HydrophobicContact CG1-CB 4.19Å; V26-P57 HydrophobicContact CG1-CG 4.3Å; T27-P57 WeakPolarHBondContact O-CG 3.41Å; M49-P57 HydrophobicContact CE-CB 3.75Å; M49-P57 HydrophobicContact SD-CB 3.45Å; M49-P57 WeakPolarHBondContact SD-CB 3.45Å; P57-E59 PolarHBondContact O-N 3.06Å; P57-I60 PolarHBondContact O-N 3.34Å; P57-I60 VanDerWaalsContact O-N 3.14Å; P57-V61 PolarHBondContact O-N 3.41Å
58	S	88.6	Confident	89.9	Confident	63 Å²	63	75.1 Å²	75.1	44%	0.441	40%	0.399	S	S	.	.	G	3₁₀ helix	trans	-65.5	-13.1	174.7	-51	0	0	0	0	114.4	K56	K56-S58 PolarHBondContact O-N 2.84Å
59	E	86.4	Confident	90	Very high	144 Å²	144	74.8 Å²	74.8	67%	0.673	40%	0.397	S	S	*	.	G	3₁₀ helix	trans	-88.5	-10.2	175.8	-64.9	177	174.7	0	0	112.4	K56 P57	K56-E59 HydrophobicContact CB-CG 4.01Å; K56-E59 PolarHBondContact O-N 2.95Å; P57-E59 PolarHBondContact O-N 3.06Å
60	I	88.1	Confident	90.2	Very high	73 Å²	73	74.5 Å²	74.5	37%	0.374	40%	0.396	S	S	.	.	T	Hydrogen-bonded Turn	trans	-104.2	-38.4	-175.2	-56.6	-173.9	0	0	0	111.6	M49 V54 P57	M49-I60 HydrophobicContact CE-CB 4.5Å; V54-I60 HydrophobicContact CB-CD1 3.9Å; V54-I60 HydrophobicContact CG1-CD1 3.34Å; V54-I60 HydrophobicContact CG1-CG1 4.17Å; V54-I60 HydrophobicContact CG2-CD1 3.27Å; P57-I60 PolarHBondContact O-N 3.34Å; P57-I60 VanDerWaalsContact O-N 3.14Å
61	V	92.1	Very high	90.4	Very high	3 Å²	3	72.6 Å²	72.6	2%	0.018	38%	0.382	C	S	.	.			trans	-138.2	141.2	-177.2	-61.4	0	0	0	0	110.2	V23 V26 A31 M49 P57 V67 M87	V23-V61 HydrophobicContact CG1-CG2 4.45Å; V23-V61 HydrophobicContact CG2-CB 4.1Å; V23-V61 HydrophobicContact CG2-CG2 4.41Å; V26-V61 HydrophobicContact CG2-CG2 3.98Å; A31-V61 HydrophobicContact CB-CG2 3.99Å; M49-V61 HydrophobicContact CE-CG1 4.25Å; M49-V61 HydrophobicContact CE-CG2 3.46Å; M49-V61 VanDerWaalsContact CE-CG2 3.46Å; P57-V61 PolarHBondContact O-N 3.41Å; V61-V67 HydrophobicContact CG1-CG1 4.2Å; V61-M87 HydrophobicContact CG1-CE 3.79Å; V61-M87 HydrophobicContact CG1-SD 4.42Å
62	D	94.2	Very high	90.7	Very high	105 Å²	105	68 Å²	68	56%	0.561	35%	0.349	S	S	*	.			trans	-106.1	158.8	172.2	-74.8	-59.4	0	0	0	111.3	V23 G64 D65	V23-D62 VanDerWaalsContact CB-O 3.24Å; V23-D62 WeakPolarHBondContact CB-O 3.43Å; V23-D62 WeakPolarHBondContact CG1-O 3.43Å; D62-G64 PolarHBondContact O-N 3.28Å; D62-D65 PolarHBondContact N-OD2 2.79Å; D62-D65 WeakPolarHBondContact O-CB 3.32Å; D62-D65 PolarHBondContact O-N 3.29Å
63	V	95.9	Very high	91	Very high	98 Å²	98	64.3 Å²	64.3	59%	0.594	33%	0.327	S	S	*	.	T	Hydrogen-bonded Turn	trans	-65.4	127.1	174.5	178.8	0	0	0	0	109.3	A24 V26	A24-V63 WeakPolarHBondContact O-CG1 3.46Å; V26-V63 HydrophobicContact CG2-CG2 4.22Å
64	G	95.3	Very high	91.4	Very high	39 Å²	39	60.5 Å²	60.5	40%	0.402	31%	0.313	S	S	.	.	T	Hydrogen-bonded Turn	trans	100	-9.6	-175.5	0	0	0	0	0	114.3	V23 D62	V23-G64 PolarHBondContact O-N 2.86Å; D62-G64 PolarHBondContact O-N 3.28Å
65	D	95.4	Very high	91.8	Very high	65 Å²	65	64.8 Å²	64.8	35%	0.348	33%	0.331	S	S	.	.			trans	-68.2	142.6	-179.7	-77.5	-15.6	0	0	0	112.7	E22 V23 D62	E22-D65 CarbonylContact C-O 3.49Å; E22-D65 VanDerWaalsContact CA-O 3.31Å; E22-D65 WeakPolarHBondContact CA-O 3.42Å; V23-D65 HydrophobicContact CG2-CB 3.99Å; V23-D65 WeakPolarHBondContact CG2-O 3.24Å; V23-D65 PolarHBondContact N-O 3.45Å; D62-D65 PolarHBondContact N-OD2 2.79Å; D62-D65 WeakPolarHBondContact O-CB 3.32Å; D62-D65 PolarHBondContact O-N 3.29Å
66	K	95.1	Very high	91.9	Very high	150 Å²	150	65.2 Å²	65.2	65%	0.652	33%	0.331	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-94.6	113.2	174.6	-66.3	-173.6	-179	-174.6	0	110.1	Q20 G21	Q20-K66 HydrophobicContact CG-CB 4.32Å; G21-K66 WeakPolarHBondContact O-CA 3.4Å
67	V	95.4	Very high	91.8	Very high	11 Å²	11	66.4 Å²	66.4	7%	0.067	34%	0.336	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.2	149.7	-176.4	-65.5	0	0	0	0	111.7	Q20 G21 V23 I33 V61 V69 M87	Q20-V67 WeakPolarHBondContact CA-O 3.34Å; G21-V67 PolarHBondContact N-O 2.84Å; G21-V67 PolarHBondContact O-N 2.75Å; V23-V67 HydrophobicContact CG2-CG1 4.39Å; V23-V67 HydrophobicContact CG2-CG2 4.16Å; I33-V67 HydrophobicContact CD1-CG2 3.8Å; I33-V67 HydrophobicContact CG1-CG2 4.39Å; I33-V67 HydrophobicContact CG2-CG2 4.33Å; V61-V67 HydrophobicContact CG1-CG1 4.2Å; V67-V69 HydrophobicContact CG2-CG1 4.14Å; V67-M87 HydrophobicContact CB-CE 3.89Å; V67-M87 HydrophobicContact CG1-CE 3.77Å; V67-M87 HydrophobicContact CG2-CE 4.31Å; V67-M87 HydrophobicContact CG2-SD 4.42Å
68	W	95.9	Very high	91.3	Very high	69 Å²	69	73.2 Å²	73.2	26%	0.261	37%	0.373	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-90	127.5	173.7	-71.5	95.4	0	0	0	110.4	I18 Q20 V90 Q92 G95	I18-W68 HydrophobicContact CG2-CE3 3.87Å; I18-W68 HydrophobicContact CG2-CZ3 4.4Å; Q20-W68 HydrophobicContact CB-CD2 4.12Å; Q20-W68 HydrophobicContact CB-CE3 4.04Å; Q20-W68 HydrophobicContact CB-CH2 4.15Å; Q20-W68 HydrophobicContact CB-CZ2 4.21Å; Q20-W68 HydrophobicContact CB-CZ3 4.06Å; Q20-W68 HydrophobicContact CG-CD2 4.46Å; W68-V90 HydrophobicContact CB-CB 4.42Å; W68-V90 HydrophobicContact CB-CG1 3.65Å; W68-Q92 PolarHBondContact O-NE2 3.49Å; W68-Q92 PolarHBondContact O-OE1 3.13Å; W68-G95 VanDerWaalsContact CD2-CA 3.46Å
69	V	95.5	Very high	90.8	Very high	0 Å²	0	77.1 Å²	77.1	0%	0	39%	0.388	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-134.5	147.2	-175.4	-70.9	0	0	0	0	111	I18 F19 I33 V44 V67 L85 M87	I18-V69 WeakPolarHBondContact CA-O 3.46Å; F19-V69 HydrophobicContact CD2-CG2 3.75Å; F19-V69 HydrophobicContact CE1-CG2 4.34Å; F19-V69 HydrophobicContact CE2-CG2 3.29Å; F19-V69 HydrophobicContact CG-CG2 4.43Å; F19-V69 HydrophobicContact CZ-CG2 3.64Å; F19-V69 PolarHBondContact N-O 3.36Å; F19-V69 PolarHBondContact O-N 2.55Å; I33-V69 HydrophobicContact CG1-CG1 4.41Å; I33-V69 HydrophobicContact CG2-CG2 4.45Å; V44-V69 HydrophobicContact CG2-CG1 4.19Å; V67-V69 HydrophobicContact CG2-CG1 4.14Å; V69-L85 HydrophobicContact CB-CB 4.46Å; V69-L85 HydrophobicContact CG2-CD1 4.21Å; V69-M87 HydrophobicContact CG1-CG 3.56Å
70	K	94.9	Very high	90.6	Very high	2 Å²	2	80.2 Å²	80.2	1%	0.009	39%	0.394	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.8	134.4	171.1	-173.8	166.8	174.9	173.1	0	110	T17 I18 I72 L85 S86 V89 V90 D97 D99 N102	T17-K70 WeakPolarHBondContact O-CA 3.43Å; I18-K70 HydrophobicContact CD1-CD 4.47Å; I18-K70 HydrophobicContact CG1-CB 3.98Å; I18-K70 HydrophobicContact CG1-CD 4.19Å; I18-K70 HydrophobicContact CG1-CG 4.02Å; K70-I72 PolarHBondContact O-N 3.49Å; K70-L85 WeakPolarHBondContact O-CA 3.42Å; K70-S86 PolarHBondContact N-O 2.96Å; K70-S86 PolarHBondContact O-N 2.93Å; K70-V89 HydrophobicContact CB-CG2 3.67Å; K70-V89 HydrophobicContact CD-CG2 3.72Å; K70-V89 HydrophobicContact CG-CG2 4.24Å; K70-V90 HydrophobicContact CB-CG2 3.56Å; K70-D97 VanDerWaalsContact NZ-CG 3.29Å; K70-D97 IonicContact NZ-OD1 3.61Å; K70-D97 PolarHBondContact NZ-OD1 3.39Å; K70-D97 VanDerWaalsContact NZ-OD1 3.11Å; K70-D97 IonicContact NZ-OD2 2.74Å; K70-D97 PolarHBondContact NZ-OD2 3.04Å; K70-D99 PolarHBondContact NZ-O 3.15Å; K70-N102 WeakPolarHBondContact CE-OD1 3.48Å; K70-N102 PolarHBondContact NZ-OD1 2.72Å
71	L	93.9	Very high	90.5	Very high	0 Å²	0	78.4 Å²	78.4	0%	0	39%	0.385	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-73.3	112.3	172.1	-177.4	67.3	0	0	0	110.1	P13 A14 L15 Y16 T17 F19 V83 L85	P13-L71 HydrophobicContact CG-CD2 4.2Å; P13-L71 WeakPolarHBondContact O-CD2 3.47Å; A14-L71 WeakPolarHBondContact O-CD2 3.36Å; L15-L71 HydrophobicContact CD1-CG 4.43Å; Y16-L71 WeakPolarHBondContact CA-O 3.39Å; Y16-L71 PolarHBondContact N-O 2.85Å; T17-L71 PolarHBondContact O-N 3.19Å; F19-L71 HydrophobicContact CE1-CB 4.33Å; L71-V83 HydrophobicContact CD1-CG1 3.39Å; L71-L85 HydrophobicContact CB-CD2 4.27Å; L71-L85 HydrophobicContact CD1-CD2 3.67Å
72	I	93.1	Very high	90.3	Very high	19 Å²	19	83.8 Å²	83.8	10%	0.097	41%	0.408	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.1	-23.7	-177.7	60.1	164.8	0	0	0	113.3	K70 S84 S86 I105	K70-I72 PolarHBondContact O-N 3.49Å; I72-S84 WeakPolarHBondContact CG1-O 3.42Å; I72-S84 PolarHBondContact N-O 3.21Å; I72-S86 VanDerWaalsContact CG2-CB 3.44Å; I72-I105 HydrophobicContact CB-CD1 4.39Å; I72-I105 HydrophobicContact CB-CG2 4.01Å; I72-I105 HydrophobicContact CG2-CD1 3.49Å; I72-I105 VanDerWaalsContact CG2-CD1 3.49Å; I72-I105 HydrophobicContact CG2-CG1 3.96Å; I72-I105 HydrophobicContact CG2-CG2 4.19Å
73	G	90.8	Very high	90.3	Very high	20 Å²	20	79 Å²	79	21%	0.206	38%	0.382	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-163.5	143.8	-179.1	0	0	0	0	0	111.6	S84	G73-S84 PolarHBondContact N-O 2.74Å; G73-S84 PolarHBondContact O-N 2.9Å
74	R	90.1	Very high	90.2	Very high	139 Å²	139	75.8 Å²	75.8	53%	0.525	36%	0.364	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-134.8	128.7	170	67.9	-177.6	-171.8	173.3	6.2	108.4	K82	R74-K82 WeakPolarHBondContact CA-O 3.42Å
75	E	88.7	Confident	90.2	Very high	111 Å²	111	74 Å²	74	52%	0.519	35%	0.345	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.3	128.9	176.3	-67.6	173.5	-118.1	0	0	107.9	I81 K82	E75-I81 WeakPolarHBondContact O-CA 3.42Å; E75-K82 HydrophobicContact CB-CB 4.39Å; E75-K82 PolarHBondContact N-O 2.86Å; E75-K82 PolarHBondContact O-N 3.1Å
76	M	86.7	Confident	90.2	Very high	130 Å²	130	70.9 Å²	70.9	64%	0.64	33%	0.329	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-118.2	105.9	175.7	-177.2	177.5	-177.5	0	0	107.3	E10 I81	E10-M76 WeakPolarHBondContact OE1-CE 3.25Å; M76-I81 HydrophobicContact CG-CG1 4.23Å
77	K	85.9	Confident	90.1	Very high	151 Å²	151	64.2 Å²	64.2	66%	0.657	30%	0.3	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-133.8	122.6	-179.6	-169.5	177.1	-176.9	178.3	0	109.9	D79 R80	K77-D79 PolarHBondContact O-N 3.5Å; K77-R80 PolarHBondContact N-O 2.9Å; K77-R80 WeakPolarHBondContact O-CA 3.27Å; K77-R80 WeakPolarHBondContact O-CB 3.26Å; K77-R80 PolarHBondContact O-N 3.01Å
78	N	76.3	Confident	90	Very high	146 Å²	146	65.9 Å²	65.9	78%	0.781	31%	0.306	S	S	*	.	T	Hydrogen-bonded Turn	trans	45.7	56.7	172.7	-58.3	-9.3	0	0	0	112.8	R80	N78-R80 PolarHBondContact O-N 2.9Å
79	D	77.8	Confident	89.9	Confident	144 Å²	144	62.6 Å²	62.6	77%	0.77	29%	0.294	S	S	*	.	T	Hydrogen-bonded Turn	trans	71.1	-14.8	-178	-153	-102.3	0	0	0	116.1	K77 I81	K77-D79 PolarHBondContact O-N 3.5Å; D79-I81 PolarHBondContact O-N 3.01Å
80	R	81.7	Confident	89.9	Confident	209 Å²	209	62.9 Å²	62.9	79%	0.789	30%	0.296	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-86	117.2	174.6	-60.9	-175.5	-176.5	179.3	1.2	110.1	K77 N78	K77-R80 PolarHBondContact N-O 2.9Å; K77-R80 WeakPolarHBondContact O-CA 3.27Å; K77-R80 WeakPolarHBondContact O-CB 3.26Å; K77-R80 PolarHBondContact O-N 3.01Å; N78-R80 PolarHBondContact O-N 2.9Å
81	I	85.9	Confident	89.8	Confident	36 Å²	36	65.7 Å²	65.7	19%	0.185	31%	0.311	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.2	115.5	173.6	-57.1	178.4	0	0	0	107.7	L12 K40 E75 M76 D79 V83	L12-I81 HydrophobicContact CD1-CG2 3.82Å; K40-I81 HydrophobicContact CG-CD1 4.29Å; E75-I81 WeakPolarHBondContact O-CA 3.42Å; M76-I81 HydrophobicContact CG-CG1 4.23Å; D79-I81 PolarHBondContact O-N 3.01Å; I81-V83 HydrophobicContact CG2-CG2 3.86Å
82	K	89	Confident	89.7	Confident	116 Å²	116	69.4 Å²	69.4	50%	0.504	33%	0.328	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.1	123.6	173.3	-176.1	-176.3	173	-165.8	0	108.7	R74 E75	R74-K82 WeakPolarHBondContact CA-O 3.42Å; E75-K82 HydrophobicContact CB-CB 4.39Å; E75-K82 PolarHBondContact N-O 2.86Å; E75-K82 PolarHBondContact O-N 3.1Å
83	V	93.1	Very high	89.6	Confident	4 Å²	4	71.9 Å²	71.9	2%	0.024	36%	0.358	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.3	117.1	-179.1	-176.4	0	0	0	0	108	L12 I35 L43 L71 I81 L85	L12-V83 HydrophobicContact CD1-CG2 4.41Å; L12-V83 HydrophobicContact CD2-CG1 4.48Å; L12-V83 HydrophobicContact CD2-CG2 3.65Å; I35-V83 HydrophobicContact CD1-CG1 3.85Å; L43-V83 PolarHBondContact N-O 3.41Å; L71-V83 HydrophobicContact CD1-CG1 3.39Å; I81-V83 HydrophobicContact CG2-CG2 3.86Å; V83-L85 HydrophobicContact CG1-CD2 4.09Å; V83-L85 HydrophobicContact CG1-CG 4.39Å
84	S	94.1	Very high	89.5	Confident	31 Å²	31	75.7 Å²	75.7	22%	0.217	38%	0.378	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.3	125.2	-179.7	-57.7	0	0	0	0	109.3	I72 G73	I72-S84 WeakPolarHBondContact CG1-O 3.42Å; I72-S84 PolarHBondContact N-O 3.21Å; G73-S84 PolarHBondContact N-O 2.74Å; G73-S84 PolarHBondContact O-N 2.9Å
85	L	95	Very high	89.5	Confident	1 Å²	1	69.7 Å²	69.7	1%	0.005	36%	0.359	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.7	156.5	-177.5	-61.2	-179.6	0	0	0	110.9	F19 I33 I35 L43 V44 V69 K70 L71 V83	F19-L85 HydrophobicContact CE1-CD2 4.29Å; F19-L85 HydrophobicContact CZ-CD1 4.33Å; F19-L85 HydrophobicContact CZ-CD2 3.76Å; I33-L85 HydrophobicContact CB-CD1 3.92Å; I33-L85 HydrophobicContact CG1-CD1 4.34Å; I35-L85 HydrophobicContact CG1-CD1 4.48Å; L43-L85 PolarHBondContact O-N 3.01Å; V44-L85 HydrophobicContact CG2-CB 3.57Å; V44-L85 HydrophobicContact CG2-CD1 4.45Å; V69-L85 HydrophobicContact CB-CB 4.46Å; V69-L85 HydrophobicContact CG2-CD1 4.21Å; K70-L85 WeakPolarHBondContact O-CA 3.42Å; L71-L85 HydrophobicContact CB-CD2 4.27Å; L71-L85 HydrophobicContact CD1-CD2 3.67Å; V83-L85 HydrophobicContact CG1-CD2 4.09Å; V83-L85 HydrophobicContact CG1-CG 4.39Å
86	S	95.1	Very high	89.7	Confident	0 Å²	0	71.5 Å²	71.5	0%	0	37%	0.365	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-135.5	131.1	177.2	-173.3	0	0	0	0	111.5	H48 K70 I72	H48-S86 PolarHBondContact ND1-OG 3.24Å; K70-S86 PolarHBondContact N-O 2.96Å; K70-S86 PolarHBondContact O-N 2.93Å; I72-S86 VanDerWaalsContact CG2-CB 3.44Å
87	M	94.2	Very high	90	Very high	10 Å²	10	67.6 Å²	67.6	5%	0.049	35%	0.347	C	S	.	.	S	Bend	trans	-96.7	-33.1	175.7	-68.5	172.7	63.4	0	0	111.6	V44 H48 V61 V67 V69 V89 V90 Q92	V44-M87 HydrophobicContact CG1-CG 4.04Å; V44-M87 HydrophobicContact CG1-SD 4.13Å; V44-M87 HydrophobicContact CG2-CG 4.14Å; V44-M87 HydrophobicContact CG2-SD 4.3Å; H48-M87 PolarHBondContact O-N 2.89Å; V61-M87 HydrophobicContact CG1-CE 3.79Å; V61-M87 HydrophobicContact CG1-SD 4.42Å; V67-M87 HydrophobicContact CB-CE 3.89Å; V67-M87 HydrophobicContact CG1-CE 3.77Å; V67-M87 HydrophobicContact CG2-CE 4.31Å; V67-M87 HydrophobicContact CG2-SD 4.42Å; V69-M87 HydrophobicContact CG1-CG 3.56Å; M87-V89 PolarHBondContact O-N 2.88Å; M87-V89 VanDerWaalsContact O-N 3.13Å; M87-V90 PolarHBondContact O-N 2.81Å; M87-Q92 PolarHBondContact O-NE2 3.34Å
88	K	92.9	Very high	90.2	Very high	45 Å²	45	65.1 Å²	65.1	20%	0.196	34%	0.34	C	S	.	.	T	Hydrogen-bonded Turn	trans	-62.5	-23.8	-175.4	70.4	171	-177.7	176.8	0	115	H48 V90 E108	H48-K88 PolarHBondContact O-N 3.49Å; K88-V90 VanDerWaalsContact C-N 3.33Å; K88-E108 IonicContact NZ-OE2 3.11Å; K88-E108 PolarHBondContact NZ-OE2 2.81Å
89	V	93.4	Very high	90.8	Very high	1 Å²	1	58.8 Å²	58.8	1%	0.006	31%	0.306	C	S	.	.	T	Hydrogen-bonded Turn	trans	-92.1	3.8	-178.8	-61.9	0	0	0	0	112.3	K70 M87 L98 D99 I105	K70-V89 HydrophobicContact CB-CG2 3.67Å; K70-V89 HydrophobicContact CD-CG2 3.72Å; K70-V89 HydrophobicContact CG-CG2 4.24Å; M87-V89 PolarHBondContact O-N 2.88Å; M87-V89 VanDerWaalsContact O-N 3.13Å; V89-L98 WeakPolarHBondContact O-CB 3.44Å; V89-L98 PolarHBondContact O-N 3.27Å; V89-D99 HydrophobicContact CB-CB 4Å; V89-D99 HydrophobicContact CG1-CB 3.89Å; V89-I105 HydrophobicContact CG1-CD1 4.16Å; V89-I105 HydrophobicContact CG1-CG1 4.05Å; V89-I105 HydrophobicContact CG2-CD1 4.43Å
90	V	94.6	Very high	91.3	Very high	5 Å²	5	56.1 Å²	56.1	3%	0.03	30%	0.297	C	S	.	.	B	Isolated β-bridge	trans	-129.3	135.3	-179.4	-169.1	0	0	0	0	109.7	I18 W68 K70 M87 K88 Q92	I18-V90 HydrophobicContact CD1-CG1 4.25Å; I18-V90 HydrophobicContact CD1-CG2 4.01Å; I18-V90 HydrophobicContact CG1-CG2 3.99Å; I18-V90 HydrophobicContact CG2-CG1 3.71Å; I18-V90 HydrophobicContact CG2-CG2 4.29Å; W68-V90 HydrophobicContact CB-CB 4.42Å; W68-V90 HydrophobicContact CB-CG1 3.65Å; K70-V90 HydrophobicContact CB-CG2 3.56Å; M87-V90 PolarHBondContact O-N 2.81Å; K88-V90 VanDerWaalsContact C-N 3.33Å; V90-Q92 PolarHBondContact O-N 2.92Å; V90-Q92 PolarHBondContact O-NE2 3.33Å
91	N	93.6	Very high	91.8	Very high	61 Å²	61	52.1 Å²	52.1	33%	0.326	29%	0.291	S	S	.	.			trans	-71.5	123.4	172.7	-171.2	-72.7	0	0	0	110.2	G93 T94 G95 K96 L98	N91-G93 VanDerWaalsContact C-N 3.33Å; N91-G93 PolarHBondContact O-N 3.46Å; N91-G93 WeakPolarHBondContact OD1-CA 3.1Å; N91-G93 PolarHBondContact OD1-N 2.91Å; N91-T94 PolarHBondContact OD1-N 3.48Å; N91-T94 PolarHBondContact OD1-OG1 3.2Å; N91-G95 VanDerWaalsContact O-CA 3.25Å; N91-G95 WeakPolarHBondContact O-CA 3.48Å; N91-G95 PolarHBondContact O-N 3.44Å; N91-K96 PolarHBondContact N-O 3.23Å; N91-L98 HydrophobicContact CB-CD1 4.36Å; N91-L98 HydrophobicContact CB-CD2 4.17Å; N91-L98 HydrophobicContact CB-CG 4.3Å
92	Q	92	Very high	91.9	Very high	79 Å²	79	51.4 Å²	51.4	37%	0.369	29%	0.288	S	S	.	.	T	Hydrogen-bonded Turn	trans	-73.3	-21.2	-177.5	-59.6	-55.7	-48.9	0	0	114	W68 M87 V90	W68-Q92 PolarHBondContact O-NE2 3.49Å; W68-Q92 PolarHBondContact O-OE1 3.13Å; M87-Q92 PolarHBondContact O-NE2 3.34Å; V90-Q92 PolarHBondContact O-N 2.92Å; V90-Q92 PolarHBondContact O-NE2 3.33Å
93	G	90.1	Very high	91.9	Very high	70 Å²	70	49 Å²	49	72%	0.722	28%	0.282	S	S	*	.	T	Hydrogen-bonded Turn	trans	-83.2	-40.1	177.3	0	0	0	0	0	113	N91	N91-G93 VanDerWaalsContact C-N 3.33Å; N91-G93 PolarHBondContact O-N 3.46Å; N91-G93 WeakPolarHBondContact OD1-CA 3.1Å; N91-G93 PolarHBondContact OD1-N 2.91Å
94	T	90.3	Very high	91.6	Very high	101 Å²	101	52.6 Å²	52.6	62%	0.62	30%	0.301	S	S	*	.	T	Hydrogen-bonded Turn	trans	-111.9	-11.8	-172.3	68.9	0	0	0	0	114.5	N91 K96	N91-T94 PolarHBondContact OD1-N 3.48Å; N91-T94 PolarHBondContact OD1-OG1 3.2Å; T94-K96 PolarHBondContact O-N 3.03Å; T94-K96 WeakPolarHBondContact OG1-CB 3.12Å; T94-K96 PolarHBondContact OG1-N 2.92Å
95	G	89.9	Confident	91.3	Very high	13 Å²	13	51.4 Å²	51.4	13%	0.134	29%	0.292	C	S	.	.			trans	67.2	15.7	-172.7	0	0	0	0	0	114.1	W68 N91	W68-G95 VanDerWaalsContact CD2-CA 3.46Å; N91-G95 VanDerWaalsContact O-CA 3.25Å; N91-G95 WeakPolarHBondContact O-CA 3.48Å; N91-G95 PolarHBondContact O-N 3.44Å
96	K	92.4	Very high	90.9	Very high	149 Å²	149	55.4 Å²	55.4	65%	0.648	31%	0.311	S	S	*	.			trans	-78.9	140.5	-178.4	-170.2	176.3	179.2	-179.7	0	110.4	N91 T94 L98	N91-K96 PolarHBondContact N-O 3.23Å; T94-K96 PolarHBondContact O-N 3.03Å; T94-K96 WeakPolarHBondContact OG1-CB 3.12Å; T94-K96 PolarHBondContact OG1-N 2.92Å; K96-L98 PolarHBondContact O-N 3.36Å
97	D	92.6	Very high	90.4	Very high	47 Å²	47	59.8 Å²	59.8	25%	0.251	33%	0.331	S	S	.	.	B	Isolated β-bridge	trans	-66.1	124.4	172.1	-159.4	-11.9	0	0	0	110.6	I18 K70 D99	I18-D97 HydrophobicContact CD1-CB 3.43Å; I18-D97 VanDerWaalsContact CD1-CB 3.43Å; K70-D97 VanDerWaalsContact NZ-CG 3.29Å; K70-D97 IonicContact NZ-OD1 3.61Å; K70-D97 PolarHBondContact NZ-OD1 3.39Å; K70-D97 VanDerWaalsContact NZ-OD1 3.11Å; K70-D97 IonicContact NZ-OD2 2.74Å; K70-D97 PolarHBondContact NZ-OD2 3.04Å; D97-D99 VanDerWaalsContact OD1-C 3.3Å; D97-D99 PolarHBondContact OD1-N 3.09Å
98	L	90.6	Very high	89.9	Confident	99 Å²	99	60.9 Å²	60.9	52%	0.518	34%	0.336	S	S	.	.	S	Bend	trans	-94.7	-16.1	175.7	-60.4	176.6	0	0	0	112.1	V89 N91 K96	V89-L98 WeakPolarHBondContact O-CB 3.44Å; V89-L98 PolarHBondContact O-N 3.27Å; N91-L98 HydrophobicContact CB-CD1 4.36Å; N91-L98 HydrophobicContact CB-CD2 4.17Å; N91-L98 HydrophobicContact CB-CG 4.3Å; K96-L98 PolarHBondContact O-N 3.36Å
99	D	89.6	Confident	89.3	Confident	13 Å²	13	63 Å²	63	7%	0.07	35%	0.347	C	S	.	.			trans	-132.1	71	-179.9	-172.3	30.2	0	0	0	110.2	K70 V89 D97 N101 N102 V103 I104	K70-D99 PolarHBondContact NZ-O 3.15Å; V89-D99 HydrophobicContact CB-CB 4Å; V89-D99 HydrophobicContact CG1-CB 3.89Å; D97-D99 VanDerWaalsContact OD1-C 3.3Å; D97-D99 PolarHBondContact OD1-N 3.09Å; D99-N101 PolarHBondContact O-N 3.09Å; D99-N102 PolarHBondContact O-N 2.97Å; D99-N102 VanDerWaalsContact O-N 3.09Å; D99-N102 PolarHBondContact O-OD1 3.11Å; D99-N102 PolarHBondContact OD1-N 3.44Å; D99-N102 WeakPolarHBondContact OD2-CA 3.29Å; D99-V103 PolarHBondContact OD1-N 2.7Å; D99-V103 PolarHBondContact OD2-N 2.91Å; D99-V103 VanDerWaalsContact OD2-N 3.15Å; D99-I104 HydrophobicContact CB-CD1 4.26Å; D99-I104 WeakPolarHBondContact OD2-CB 3.41Å; D99-I104 PolarHBondContact OD2-N 2.83Å; D99-I104 VanDerWaalsContact OD2-N 3.09Å
100	P	88.3	Confident	88.8	Confident	89 Å²	89	70.6 Å²	70.6	58%	0.578	38%	0.375	S	S	*	.	T	Hydrogen-bonded Turn	trans	-63.4	-26.9	-176.7	26.1	-35	0	0	0	112.7
101	N	90.3	Very high	88.1	Confident	125 Å²	125	78.6 Å²	78.6	67%	0.668	41%	0.405	S	S	*	.	T	Hydrogen-bonded Turn	trans	-91	-0.5	179.8	-64.3	-28.2	0	0	0	113.1	D99 V103	D99-N101 PolarHBondContact O-N 3.09Å; N101-V103 HydrophobicContact CB-CG2 3.76Å; N101-V103 PolarHBondContact O-N 2.9Å; N101-V103 VanDerWaalsContact O-N 3.07Å
102	N	89.6	Confident	87.1	Confident	21 Å²	21	81.2 Å²	81.2	11%	0.112	41%	0.41	C	S	.	.			trans	55.8	21.5	-179.3	-52.9	-51.4	0	0	0	115.1	Y16 K70 D99 I104 I105 E106	Y16-N102 HydrophobicContact CE1-CB 4.32Å; K70-N102 WeakPolarHBondContact CE-OD1 3.48Å; K70-N102 PolarHBondContact NZ-OD1 2.72Å; D99-N102 PolarHBondContact O-N 2.97Å; D99-N102 VanDerWaalsContact O-N 3.09Å; D99-N102 PolarHBondContact O-OD1 3.11Å; D99-N102 PolarHBondContact OD1-N 3.44Å; D99-N102 WeakPolarHBondContact OD2-CA 3.29Å; N102-I104 VanDerWaalsContact C-N 3.3Å; N102-I104 PolarHBondContact O-N 3.17Å; N102-I105 HydrophobicContact CB-CD1 4.2Å; N102-I105 PolarHBondContact O-N 3.4Å; N102-E106 WeakPolarHBondContact O-CG 3.39Å; N102-E106 PolarHBondContact O-N 3Å
103	V	89.3	Confident	85.8	Confident	64 Å²	64	85.3 Å²	85.3	39%	0.388	42%	0.422	S	S	.	.	H	α-helix	trans	-65.7	-38.1	-172.3	175.7	0	0	0	0	110.6	D99 N101 I105 Q107	D99-V103 PolarHBondContact OD1-N 2.7Å; D99-V103 PolarHBondContact OD2-N 2.91Å; D99-V103 VanDerWaalsContact OD2-N 3.15Å; N101-V103 HydrophobicContact CB-CG2 3.76Å; N101-V103 PolarHBondContact O-N 2.9Å; N101-V103 VanDerWaalsContact O-N 3.07Å; V103-I105 VanDerWaalsContact C-N 3.33Å; V103-Q107 HydrophobicContact CG1-CG 4.32Å; V103-Q107 WeakPolarHBondContact O-CB 3.25Å; V103-Q107 VanDerWaalsContact O-CG 3.26Å; V103-Q107 WeakPolarHBondContact O-CG 3.32Å; V103-Q107 PolarHBondContact O-N 3.15Å
104	I	86.9	Confident	84.3	Confident	80 Å²	80	85.8 Å²	85.8	41%	0.41	42%	0.415	S	S	.	.	H	α-helix	trans	-66.8	-41.9	-178.3	-58.2	174	0	0	0	109.7	D99 N102 E108	D99-I104 HydrophobicContact CB-CD1 4.26Å; D99-I104 WeakPolarHBondContact OD2-CB 3.41Å; D99-I104 PolarHBondContact OD2-N 2.83Å; D99-I104 VanDerWaalsContact OD2-N 3.09Å; N102-I104 VanDerWaalsContact C-N 3.3Å; N102-I104 PolarHBondContact O-N 3.17Å; I104-E108 WeakPolarHBondContact O-CB 3.15Å; I104-E108 PolarHBondContact O-N 2.92Å; I104-E108 VanDerWaalsContact O-N 3.13Å
105	I	87.3	Confident	82.4	Confident	6 Å²	6	89.5 Å²	89.5	3%	0.031	42%	0.423	C	S	.	.	H	α-helix	trans	-64.9	-49.2	-179.7	-60.3	158.6	0	0	0	109.8	I72 V89 N102 V103 Q107 E108 E109	I72-I105 HydrophobicContact CB-CD1 4.39Å; I72-I105 HydrophobicContact CB-CG2 4.01Å; I72-I105 HydrophobicContact CG2-CD1 3.49Å; I72-I105 VanDerWaalsContact CG2-CD1 3.49Å; I72-I105 HydrophobicContact CG2-CG1 3.96Å; I72-I105 HydrophobicContact CG2-CG2 4.19Å; V89-I105 HydrophobicContact CG1-CD1 4.16Å; V89-I105 HydrophobicContact CG1-CG1 4.05Å; V89-I105 HydrophobicContact CG2-CD1 4.43Å; N102-I105 HydrophobicContact CB-CD1 4.2Å; N102-I105 PolarHBondContact O-N 3.4Å; V103-I105 VanDerWaalsContact C-N 3.33Å; I105-Q107 PolarHBondContact O-N 3.06Å; I105-E108 PolarHBondContact O-N 3.49Å; I105-E109 WeakPolarHBondContact O-CB 3.49Å; I105-E109 PolarHBondContact O-N 2.83Å
106	E	85.6	Confident	80.8	Confident	86 Å²	86	96.7 Å²	96.7	40%	0.402	45%	0.453	S	S	.	.	H	α-helix	trans	-62.1	-44.4	-179.6	-73	-170.3	173.2	0	0	112.9	N102 E108 E109 R110	N102-E106 WeakPolarHBondContact O-CG 3.39Å; N102-E106 PolarHBondContact O-N 3Å; E106-E108 VanDerWaalsContact C-N 3.34Å; E106-E108 PolarHBondContact O-N 3.33Å; E106-E109 PolarHBondContact O-N 3.03Å; E106-R110 WeakPolarHBondContact O-CG 3.48Å; E106-R110 PolarHBondContact O-N 2.85Å; E106-R110 IonicContact OE2-NH2 3.71Å; E106-R110 PolarHBondContact OE2-NH2 2.86Å
107	Q	85.6	Confident	78.9	Confident	92 Å²	92	95.1 Å²	95.1	43%	0.43	45%	0.451	S	S	.	.	H	α-helix	trans	-63.6	-41.1	178.9	-74	179.5	4.8	0	0	111.7	V103 I105 R110 R111	V103-Q107 HydrophobicContact CG1-CG 4.32Å; V103-Q107 WeakPolarHBondContact O-CB 3.25Å; V103-Q107 VanDerWaalsContact O-CG 3.26Å; V103-Q107 WeakPolarHBondContact O-CG 3.32Å; V103-Q107 PolarHBondContact O-N 3.15Å; I105-Q107 PolarHBondContact O-N 3.06Å; Q107-R110 PolarHBondContact O-N 3.41Å; Q107-R111 WeakPolarHBondContact O-CB 3.15Å; Q107-R111 VanDerWaalsContact O-CG 3.27Å; Q107-R111 WeakPolarHBondContact O-CG 3.42Å; Q107-R111 PolarHBondContact O-N 3.33Å
108	E	83.3	Confident	77.1	Confident	33 Å²	33	103.3 Å²	103.3	15%	0.154	48%	0.48	C	S	.	.	H	α-helix	trans	-69.2	-37.9	178.7	-165	178.7	162.5	0	0	111.7	T47 H48 K88 I104 I105 E106 R111 R112	T47-E108 VanDerWaalsContact CB-OE1 3.32Å; T47-E108 WeakPolarHBondContact CB-OE1 3.07Å; T47-E108 PolarHBondContact OG1-OE1 2.95Å; H48-E108 IonicContact CE1-OE1 2.72Å; H48-E108 IonicContact CE1-OE2 3.26Å; H48-E108 PolarHBondContact CE1-OE2 2.97Å; H48-E108 IonicContact ND1-OE2 3.57Å; H48-E108 IonicContact NE2-OE1 3.79Å; K88-E108 IonicContact NZ-OE2 3.11Å; K88-E108 PolarHBondContact NZ-OE2 2.81Å; I104-E108 WeakPolarHBondContact O-CB 3.15Å; I104-E108 PolarHBondContact O-N 2.92Å; I104-E108 VanDerWaalsContact O-N 3.13Å; I105-E108 PolarHBondContact O-N 3.49Å; E106-E108 VanDerWaalsContact C-N 3.34Å; E106-E108 PolarHBondContact O-N 3.33Å; E108-R111 PolarHBondContact O-N 2.95Å; E108-R112 WeakPolarHBondContact O-CG 3.14Å; E108-R112 PolarHBondContact O-N 3.32Å; E108-R112 IonicContact OE1-CZ 3.9Å; E108-R112 IonicContact OE1-NE 3.36Å; E108-R112 IonicContact OE1-NH2 2.55Å; E108-R112 PolarHBondContact OE1-NH2 2.81Å
109	E	81	Confident	75.4	Confident	88 Å²	88	105 Å²	105	41%	0.411	50%	0.495	S	S	.	.	H	α-helix	trans	-64.6	-43.4	174.4	-167.1	172.7	176.3	0	0	111.6	I105 E106 R111 R112 R113	I105-E109 WeakPolarHBondContact O-CB 3.49Å; I105-E109 PolarHBondContact O-N 2.83Å; E106-E109 PolarHBondContact O-N 3.03Å; E109-R111 PolarHBondContact O-N 3.5Å; E109-R112 PolarHBondContact O-N 2.91Å; E109-R113 WeakPolarHBondContact O-CG 3.21Å; E109-R113 PolarHBondContact O-N 2.82Å; E109-R113 IonicContact OE1-CZ 2.75Å; E109-R113 IonicContact OE1-NE 3.78Å; E109-R113 IonicContact OE1-NH2 3.93Å; E109-R113 PolarHBondContact OE1-NH2 3.48Å
110	R	82.3	Confident	73.6	Confident	161 Å²	161	108 Å²	108	61%	0.608	53%	0.528	S	S	*	.	H	α-helix	trans	-59.3	-46.4	172.1	-74.2	-176.5	-150	160.6	11	111.5	E106 Q107 R112 R113 S114	E106-R110 WeakPolarHBondContact O-CG 3.48Å; E106-R110 PolarHBondContact O-N 2.85Å; E106-R110 IonicContact OE2-NH2 3.71Å; E106-R110 PolarHBondContact OE2-NH2 2.86Å; Q107-R110 PolarHBondContact O-N 3.41Å; R110-R112 VanDerWaalsContact C-N 3.32Å; R110-R112 PolarHBondContact O-N 3.26Å; R110-R113 PolarHBondContact O-N 2.89Å; R110-R113 VanDerWaalsContact O-N 3.15Å; R110-S114 WeakPolarHBondContact O-CB 3.44Å; R110-S114 PolarHBondContact O-N 3.13Å; R110-S114 PolarHBondContact O-OG 3.07Å
111	R	79.8	Confident	72.2	Confident	174 Å²	174	112 Å²	112	66%	0.657	54%	0.54	S	S	*	.	H	α-helix	trans	-59.9	-40.3	178.4	-77.5	176.2	-175.3	177.6	3.8	112.5	Q107 E108 E109 S114	Q107-R111 WeakPolarHBondContact O-CB 3.15Å; Q107-R111 VanDerWaalsContact O-CG 3.27Å; Q107-R111 WeakPolarHBondContact O-CG 3.42Å; Q107-R111 PolarHBondContact O-N 3.33Å; E108-R111 PolarHBondContact O-N 2.95Å; E109-R111 PolarHBondContact O-N 3.5Å; R111-S114 VanDerWaalsContact CA-OG 3.29Å; R111-S114 WeakPolarHBondContact CA-OG 3.45Å; R111-S114 PolarHBondContact O-OG 3.26Å
112	R	71.9	Confident	70.7	Confident	116 Å²	116	115.1 Å²	115.1	44%	0.438	55%	0.547	S	S	.	.	H	α-helix	trans	-65.3	-38.9	175.5	-75.5	-175	-171.1	158.8	15.7	112.3	T47 H48 E108 E109 R110	T47-R112 PolarHBondContact OG1-NH2 3.01Å; H48-R112 PolarHBondContact CD2-NH2 3.31Å; H48-R112 PolarHBondContact NE2-NH1 3.45Å; H48-R112 PolarHBondContact NE2-NH2 2.79Å; E108-R112 WeakPolarHBondContact O-CG 3.14Å; E108-R112 PolarHBondContact O-N 3.32Å; E108-R112 IonicContact OE1-CZ 3.9Å; E108-R112 IonicContact OE1-NE 3.36Å; E108-R112 IonicContact OE1-NH2 2.55Å; E108-R112 PolarHBondContact OE1-NH2 2.81Å; E109-R112 PolarHBondContact O-N 2.91Å; R110-R112 VanDerWaalsContact C-N 3.32Å; R110-R112 PolarHBondContact O-N 3.26Å
113	R	65.9	Low	69.4	Low	165 Å²	165	121 Å²	121	62%	0.623	58%	0.577	S	S	*	*	H	α-helix	trans	-71.8	-39.7	177.4	-68	179.2	-171.8	-148.7	6	112.2	E109 R110 F115 Q116	E109-R113 WeakPolarHBondContact O-CG 3.21Å; E109-R113 PolarHBondContact O-N 2.82Å; E109-R113 IonicContact OE1-CZ 2.75Å; E109-R113 IonicContact OE1-NE 3.78Å; E109-R113 IonicContact OE1-NH2 3.93Å; E109-R113 PolarHBondContact OE1-NH2 3.48Å; R110-R113 PolarHBondContact O-N 2.89Å; R110-R113 VanDerWaalsContact O-N 3.15Å; R113-F115 PolarHBondContact O-N 3.19Å; R113-Q116 PolarHBondContact O-N 3.1Å
114	S	58.1	Low	68.1	Low	80 Å²	80	122.9 Å²	122.9	56%	0.559	59%	0.589	S	S	*	*	G	3₁₀ helix	trans	-70.6	-8.8	-177.2	55.2	0	0	0	0	114.7	R110 R111 Q116	R110-S114 WeakPolarHBondContact O-CB 3.44Å; R110-S114 PolarHBondContact O-N 3.13Å; R110-S114 PolarHBondContact O-OG 3.07Å; R111-S114 VanDerWaalsContact CA-OG 3.29Å; R111-S114 WeakPolarHBondContact CA-OG 3.45Å; R111-S114 PolarHBondContact O-OG 3.26Å; S114-Q116 PolarHBondContact O-N 3.33Å
115	F	50.8	Low	67	Low	179 Å²	179	126.4 Å²	126.4	79%	0.785	61%	0.608	S	S	*	*	G	3₁₀ helix	trans	-81	3.2	175.7	-130.6	-90.6	0	0	0	113.4	R113	R113-F115 PolarHBondContact O-N 3.19Å
116	Q	54.9	Low	65.5	Low	163 Å²	163	133.8 Å²	133.8	76%	0.762	64%	0.642	S	S	*	*	G	3₁₀ helix	trans	-96.3	-1.5	-173.1	-157.5	153.3	-3.8	0	0	115.2	R113 S114	R113-Q116 PolarHBondContact O-N 3.1Å; S114-Q116 PolarHBondContact O-N 3.33Å
117	D	52.4	Low	64.2	Low	117 Å²	117	133.5 Å²	133.5	63%	0.626	66%	0.655	S	S	*	*	S	Bend	trans	-121.4	9.6	-161.4	-66.7	-43.5	0	0	0	119.1
118	Y	55	Low	63	Low	219 Å²	219	134.2 Å²	134.2	86%	0.859	67%	0.665	S	S	*	*	S	Bend	trans	-140.4	2.4	176.6	-72.9	-80.3	0	0	0	118.2
119	T	55.8	Low	61.7	Low	134 Å²	134	138.6 Å²	138.6	82%	0.822	69%	0.689	S	S	*	*	S	Bend	trans	-94.3	1.5	177.5	59.1	0	0	0	0	113.9
120	G	52.3	Low	60.6	Low	75 Å²	75	141.2 Å²	141.2	77%	0.773	71%	0.706	S	S	*	*	S	Bend	trans	-95.4	-21.4	-176.2	0	0	0	0	0	115.7	K122	G120-K122 PolarHBondContact O-N 3.48Å
121	Q	58.6	Low	59.6	Low	174 Å²	174	138 Å²	138	81%	0.813	70%	0.704	S	S	*	*			trans	-97.5	92.3	169.9	-75.6	-177.7	-21.1	0	0	108	I123	Q121-I123 VanDerWaalsContact C-N 3.35Å; Q121-I123 PolarHBondContact O-N 2.68Å
122	K	57.3	Low	58.6	Low	190 Å²	190	133.8 Å²	133.8	83%	0.826	70%	0.698	S	S	*	*			trans	-51.3	110.4	152.6	-94.2	-175.4	174.5	-173.7	0	105.5	G120 T124	G120-K122 PolarHBondContact O-N 3.48Å; K122-T124 HydrophobicContact CB-CG2 4.49Å; K122-T124 PolarHBondContact O-N 2.88Å
123	I	64.1	Low	57.5	Low	144 Å²	144	131 Å²	131	74%	0.738	70%	0.695	S	S	*	*			trans	-67.3	92.4	162.9	-54.8	172.4	0	0	0	104	Q121 L125	Q121-I123 VanDerWaalsContact C-N 3.35Å; Q121-I123 PolarHBondContact O-N 2.68Å; I123-L125 HydrophobicContact CG2-CD1 4.5Å; I123-L125 HydrophobicContact CG2-CG 4.02Å; I123-L125 PolarHBondContact O-N 2.74Å
124	T	60.6	Low	57.3	Low	104 Å²	104	133.6 Å²	133.6	64%	0.638	71%	0.711	S	S	*	*			trans	-68.3	91.3	165.1	47.6	0	0	0	0	105.4	K122 E126	K122-T124 HydrophobicContact CB-CG2 4.49Å; K122-T124 PolarHBondContact O-N 2.88Å; T124-E126 PolarHBondContact O-N 2.77Å
125	L	63.4	Low	57	Low	154 Å²	154	139.9 Å²	139.9	81%	0.806	73%	0.728	S	S	*	*			trans	-67	76.5	160	-77	148.6	0	0	0	106.1	I123 A127	I123-L125 HydrophobicContact CG2-CD1 4.5Å; I123-L125 HydrophobicContact CG2-CG 4.02Å; I123-L125 PolarHBondContact O-N 2.74Å; L125-A127 PolarHBondContact O-N 2.83Å
126	E	57.7	Low	57.7	Low	161 Å²	161	135.5 Å²	135.5	75%	0.752	72%	0.719	S	S	*	*			trans	-65.3	90.7	159.1	-71.8	-173.9	166.1	0	0	105.2	T124 V128	T124-E126 PolarHBondContact O-N 2.77Å; E126-V128 PolarHBondContact O-N 3.49Å
127	A	57.8	Low	57.9	Low	81 Å²	81	130.2 Å²	130.2	67%	0.669	71%	0.709	S	S	*	*			trans	-64.9	89.1	171.8	0	0	0	0	0	107.2	L125 L129	L125-A127 PolarHBondContact O-N 2.83Å; A127-L129 PolarHBondContact O-N 2.96Å
128	V	60.3	Low	57.7	Low	107 Å²	107	128.9 Å²	128.9	65%	0.648	71%	0.708	S	S	*	*			trans	-70.3	85.2	168.2	-176.1	0	0	0	0	106.8	E126 N130	E126-V128 PolarHBondContact O-N 3.49Å; V128-N130 VanDerWaalsContact CG1-OD1 3.25Å; V128-N130 WeakPolarHBondContact CG1-OD1 3.49Å; V128-N130 PolarHBondContact O-N 3.37Å
129	L	55.6	Low	57.8	Low	124 Å²	124	127.1 Å²	127.1	65%	0.649	70%	0.704	S	S	*	*			trans	-70.8	86.9	169.1	-73.4	169.4	0	0	0	107.7	A127 T131	A127-L129 PolarHBondContact O-N 2.96Å; L129-T131 PolarHBondContact O-N 3.49Å
130	N	57	Low	57.5	Low	144 Å²	144	123.9 Å²	123.9	77%	0.77	70%	0.698	S	S	*	*			trans	-70.7	51.2	166.3	-79.5	-10.7	0	0	0	110.9	V128	V128-N130 VanDerWaalsContact CG1-OD1 3.25Å; V128-N130 WeakPolarHBondContact CG1-OD1 3.49Å; V128-N130 PolarHBondContact O-N 3.37Å
131	T	61.4	Low	57	Low	94 Å²	94	129.4 Å²	129.4	58%	0.577	70%	0.703	S	S	*	*			trans	-111.6	100.7	177.6	59.7	0	0	0	0	108.9	L129	L129-T131 PolarHBondContact O-N 3.49Å
132	T	59.1	Low	56.3	Low	84 Å²	84	130.4 Å²	130.4	52%	0.515	71%	0.708	S	S	.	*	B	Isolated β-bridge	trans	-80.8	122.8	171.9	-48.1	0	0	0	0	109.1	K134	T132-K134 PolarHBondContact O-N 3.18Å
133	C	49.1	Very low	55.8	Low	58 Å²	58	130.4 Å²	130.4	39%	0.392	71%	0.711	S	S	.	*			trans	-68.2	119.3	180	179.8	0	0	0	0	111	K135 C136 G137	C133-K135 PolarHBondContact O-N 2.77Å; C133-C136 VanDerWaalsContact CB-SG 3.59Å; C133-C136 PolarHBondContact O-N 3.04Å; C133-C136 PolarHBondContact SG-SG 2.93Å; C133-G137 WeakPolarHBondContact O-CA 2.95Å; C133-G137 PolarHBondContact O-N 3.3Å
134	K	61.1	Low	54.7	Low	220 Å²	220	133.2 Å²	133.2	96%	0.957	72%	0.718	S	S	*	*	T	Hydrogen-bonded Turn	trans	-67.6	-11	178.8	-73.4	-174.4	178.1	-179.2	0	114.8	T132	T132-K134 PolarHBondContact O-N 3.18Å
135	K	53.4	Low	53.8	Low	211 Å²	211	137.3 Å²	137.3	92%	0.917	73%	0.73	S	S	*	*	T	Hydrogen-bonded Turn	trans	-93.2	-30.7	177.6	-93.1	-169.8	178.2	-175.8	0	114.1	C133	C133-K135 PolarHBondContact O-N 2.77Å
136	C	65.9	Low	52.6	Low	87 Å²	87	139.8 Å²	139.8	59%	0.588	75%	0.751	S	S	*	*	T	Hydrogen-bonded Turn	trans	-130.4	-9.6	-174.7	60.7	0	0	0	0	115	C133 C138	C133-C136 VanDerWaalsContact CB-SG 3.59Å; C133-C136 PolarHBondContact O-N 3.04Å; C133-C136 PolarHBondContact SG-SG 2.93Å; C136-C138 PolarHBondContact O-N 2.73Å; C136-C138 VanDerWaalsContact O-N 3.1Å
137	G	58.8	Low	52.4	Low	53 Å²	53	138.8 Å²	138.8	55%	0.546	75%	0.751	S	S	.	*			trans	73.9	-8.1	172.5	0	0	0	0	0	116.8	C133	C133-G137 WeakPolarHBondContact O-CA 2.95Å; C133-G137 PolarHBondContact O-N 3.3Å
138	C	47.8	Very low	52.1	Low	89 Å²	89	141.8 Å²	141.8	60%	0.601	76%	0.756	S	S	*	*	P	Polyproline II helix	trans	-73	140.1	177.5	-62	0	0	0	0	111.9	C136	C136-C138 PolarHBondContact O-N 2.73Å; C136-C138 VanDerWaalsContact O-N 3.1Å
139	K	56.2	Low	51.6	Low	182 Å²	182	143.7 Å²	143.7	79%	0.791	76%	0.762	S	S	*	*	B	Isolated β-bridge	trans	-80.3	125.6	165.2	-68.1	-175.8	178.7	-176	0	107.6	E141	K139-E141 PolarHBondContact O-N 3.45Å
140	G	50.4	Low	51.4	Low	66 Å²	66	144.9 Å²	144.9	68%	0.68	77%	0.768	S	S	*	*	P	Polyproline II helix	trans	-80.9	117.6	-177	0	0	0	0	0	111.1
141	E	41.6	Very low	51	Low	190 Å²	190	144.9 Å²	144.9	89%	0.888	77%	0.768	S	S	*	*			trans	-129.7	107.3	162.2	-142.9	169.6	-165.1	0	0	105.3	K139	K139-E141 PolarHBondContact O-N 3.45Å
142	E	43.7	Very low	50.4	Low	196 Å²	196	148.3 Å²	148.3	92%	0.916	78%	0.781	S	S	*	*			trans	-135.7	106.2	161.2	-88.8	-159.6	115.5	0	0	108
143	E	46.4	Very low	49.7	Very low	190 Å²	190	152.9 Å²	152.9	89%	0.888	80%	0.8	S	S	*	*			trans	-54	128.9	159.6	-83.5	169.5	127.7	0	0	109.9
144	K	41	Very low	49.8	Very low	202 Å²	202	160.2 Å²	160.2	88%	0.878	83%	0.831	S	S	*	*			trans	-116.4	101.3	151.8	-89.5	-174.2	176.5	-177.3	0	108.6	T146	K144-T146 PolarHBondContact O-N 3.01Å
145	E	41.8	Very low	48.8	Very low	191 Å²	191	155.3 Å²	155.3	89%	0.893	82%	0.821	S	S	*	*			trans	-54.6	118.1	162.9	-165.8	175.4	116.5	0	0	109.3
146	T	39	Very low	48.4	Very low	206 Å²	206	150.2 Å²	150.2	100%	1.264	81%	0.812	S	S	*	*			trans	-154.8	0	149	-44.1	0	0	0	0	109.5	K144	K144-T146 PolarHBondContact O-N 3.01Å

Retrieved 146 of 146 residues in 44.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).