A0A087WY60_HUMAN Loading...

CWC25 spliceosome associated protein homolog

AlphaFold DB , UniProt , Accession A0A087WY60, Species HUMAN (Homo sapiens, Human), Gene CWC25, Length 68 aa.

						>A0A087WY60_HUMAN|A0A087WY60|CWC25
MGGGDLNLKKSWHPQTLRNVEKVWKAEQKHEAERKKIEELQRELREERAREEMQRYAEDVGAVKSSWK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	57.7	Low	80.1	Confident	254 Å²	254	105.6 Å²	105.6	100%	1.251	65%	0.646	S	S	*	*				0	107.8	0	-67.6	-170.1	177.3	0	0	107.7
2	G	64.2	Low	81.3	Confident	87 Å²	87	111.1 Å²	111.1	90%	0.897	65%	0.646	S	S	*	*			trans	175.9	70.8	-173.2	0	0	0	0	0	111.1
3	G	62.7	Low	82.4	Confident	76 Å²	76	104.3 Å²	104.3	78%	0.784	60%	0.604	S	S	*	*			trans	-138.8	74	175.9	0	0	0	0	0	108.8
4	G	78.9	Confident	83.2	Confident	69 Å²	69	103 Å²	103	71%	0.711	60%	0.601	S	S	*	*			trans	-60.3	150.3	167.6	0	0	0	0	0	110.1	L6	G4-L6 PolarHBondContact O-N 3.08Å; G4-L6 VanDerWaalsContact O-N 3.11Å
5	D	84.2	Confident	83.9	Confident	74 Å²	74	105.4 Å²	105.4	40%	0.396	60%	0.604	S	S	.	*			trans	-52.2	117.9	-177	-179.6	6.5	0	0	0	111.2	N7 L8	D5-N7 PolarHBondContact O-N 2.96Å; D5-N7 VanDerWaalsContact OD1-CB 3.29Å; D5-N7 WeakPolarHBondContact OD1-CB 3.3Å; D5-N7 PolarHBondContact OD1-N 3.41Å; D5-N7 PolarHBondContact OD1-ND2 3.34Å; D5-N7 VanDerWaalsContact OD1-ND2 3.07Å; D5-L8 HydrophobicContact CB-CD1 4.06Å; D5-L8 HydrophobicContact CB-CG 4.09Å; D5-L8 WeakPolarHBondContact O-CB 3.48Å; D5-L8 PolarHBondContact O-N 3.3Å; D5-L8 VanDerWaalsContact O-N 3.11Å
6	L	85.9	Confident	84.6	Confident	110 Å²	110	100.1 Å²	100.1	58%	0.576	58%	0.575	S	S	*	*	G	3₁₀ helix	trans	-59.5	-26.9	179.9	-175.9	64.6	0	0	0	111.5	G4 L8 K9	G4-L6 PolarHBondContact O-N 3.08Å; G4-L6 VanDerWaalsContact O-N 3.11Å; L6-L8 VanDerWaalsContact C-N 3.29Å; L6-L8 PolarHBondContact O-N 2.87Å; L6-K9 HydrophobicContact CD1-CD 4.39Å; L6-K9 PolarHBondContact O-N 3Å
7	N	87.3	Confident	85.2	Confident	69 Å²	69	103.4 Å²	103.4	37%	0.369	59%	0.589	S	S	.	*	G	3₁₀ helix	trans	-67.6	-29.6	179.4	-63.8	-47.5	0	0	0	112.4	D5 K9 K10 H13	D5-N7 PolarHBondContact O-N 2.96Å; D5-N7 VanDerWaalsContact OD1-CB 3.29Å; D5-N7 WeakPolarHBondContact OD1-CB 3.3Å; D5-N7 PolarHBondContact OD1-N 3.41Å; D5-N7 PolarHBondContact OD1-ND2 3.34Å; D5-N7 VanDerWaalsContact OD1-ND2 3.07Å; N7-K9 PolarHBondContact O-N 2.91Å; N7-K9 VanDerWaalsContact O-N 3.14Å; N7-K10 VanDerWaalsContact O-CB 3.28Å; N7-K10 WeakPolarHBondContact O-CB 3.25Å; N7-K10 WeakPolarHBondContact O-CG 3.4Å; N7-K10 PolarHBondContact O-N 3.45Å; N7-H13 WeakPolarHBondContact O-CB 3.44Å
8	L	86.8	Confident	85.8	Confident	87 Å²	87	106.1 Å²	106.1	46%	0.455	59%	0.588	S	S	.	*	G	3₁₀ helix	trans	-66.1	-16.2	176.8	-65.4	174.4	0	0	0	113.3	D5 L6 Q15 T16	D5-L8 HydrophobicContact CB-CD1 4.06Å; D5-L8 HydrophobicContact CB-CG 4.09Å; D5-L8 WeakPolarHBondContact O-CB 3.48Å; D5-L8 PolarHBondContact O-N 3.3Å; D5-L8 VanDerWaalsContact O-N 3.11Å; L6-L8 VanDerWaalsContact C-N 3.29Å; L6-L8 PolarHBondContact O-N 2.87Å; L8-Q15 HydrophobicContact CD2-CB 4.42Å; L8-T16 WeakPolarHBondContact O-CG2 3.37Å
9	K	87.9	Confident	86.3	Confident	173 Å²	173	101.8 Å²	101.8	75%	0.752	56%	0.564	S	S	*	*	G	3₁₀ helix	trans	-85.4	-9.8	172.6	-60.1	-179.3	-178	177.8	0	112.7	L6 N7	L6-K9 HydrophobicContact CD1-CD 4.39Å; L6-K9 PolarHBondContact O-N 3Å; N7-K9 PolarHBondContact O-N 2.91Å; N7-K9 VanDerWaalsContact O-N 3.14Å
10	K	93.7	Very high	86.9	Confident	86 Å²	86	100.7 Å²	100.7	37%	0.374	56%	0.56	S	S	.	*	S	Bend	trans	-82.2	130.4	-179.6	-55	-62.4	-179.3	-178.6	0	109.7	N7 W12 H13	N7-K10 VanDerWaalsContact O-CB 3.28Å; N7-K10 WeakPolarHBondContact O-CB 3.25Å; N7-K10 WeakPolarHBondContact O-CG 3.4Å; N7-K10 PolarHBondContact O-N 3.45Å; K10-W12 HydrophobicContact CB-CD2 4.11Å; K10-W12 HydrophobicContact CB-CG 4.38Å; K10-W12 HydrophobicContact CB-CZ2 3.94Å; K10-W12 HydrophobicContact CG-CZ2 3.9Å; K10-W12 PolarHBondContact O-N 3.32Å; K10-W12 VanDerWaalsContact O-N 3.16Å; K10-H13 HydrophobicContact CB-CB 4.41Å; K10-H13 WeakPolarHBondContact O-CB 3.36Å; K10-H13 PolarHBondContact O-N 2.98Å; K10-H13 VanDerWaalsContact O-N 3.08Å
11	S	91.9	Very high	87.4	Confident	77 Å²	77	100.2 Å²	100.2	54%	0.538	55%	0.553	S	S	.	*	T	Hydrogen-bonded Turn	trans	-61	-25.2	-177.8	55.7	0	0	0	0	113.9	R18 N19	S11-R18 PolarHBondContact O-NH2 3.14Å; S11-N19 PolarHBondContact O-ND2 2.95Å
12	W	94.1	Very high	89.3	Confident	171 Å²	171	95.4 Å²	95.4	65%	0.648	53%	0.525	S	S	*	.	T	Hydrogen-bonded Turn	trans	-89.8	-9	179.5	55.2	-104.3	0	0	0	113.7	K10	K10-W12 HydrophobicContact CB-CD2 4.11Å; K10-W12 HydrophobicContact CB-CG 4.38Å; K10-W12 HydrophobicContact CB-CZ2 3.94Å; K10-W12 HydrophobicContact CG-CZ2 3.9Å; K10-W12 PolarHBondContact O-N 3.32Å; K10-W12 VanDerWaalsContact O-N 3.16Å
13	H	95.4	Very high	90.9	Very high	23 Å²	23	95.1 Å²	95.1	11%	0.106	51%	0.506	C	S	.	.			trans	-67.6	126.4	-173.9	-170.8	-90	0	0	0	111.1	N7 K10 Q15 T16 N19	N7-H13 WeakPolarHBondContact O-CB 3.44Å; K10-H13 HydrophobicContact CB-CB 4.41Å; K10-H13 WeakPolarHBondContact O-CB 3.36Å; K10-H13 PolarHBondContact O-N 2.98Å; K10-H13 VanDerWaalsContact O-N 3.08Å; H13-Q15 VanDerWaalsContact C-N 3.27Å; H13-Q15 PolarHBondContact ND1-N 3.31Å; H13-Q15 PolarHBondContact O-N 3.04Å; H13-T16 HydrophobicContact CB-CG2 3.94Å; H13-T16 WeakPolarHBondContact O-CG2 3.48Å; H13-T16 PolarHBondContact O-N 2.9Å; H13-T16 VanDerWaalsContact O-N 3.12Å; H13-T16 PolarHBondContact O-OG1 3.42Å; H13-N19 PolarHBondContact O-ND2 3.25Å
14	P	94.1	Very high	92.6	Very high	86 Å²	86	98.1 Å²	98.1	56%	0.558	49%	0.494	S	S	*	.	T	Hydrogen-bonded Turn	trans	-66.1	-30.7	-169.3	24.9	-34.3	0	0	0	112.6	T16 V20	P14-T16 VanDerWaalsContact C-N 3.27Å; P14-T16 PolarHBondContact O-N 3.47Å; P14-V20 WeakPolarHBondContact O-CG2 3.36Å
15	Q	94.4	Very high	93.5	Very high	139 Å²	139	100.4 Å²	100.4	65%	0.65	48%	0.484	S	S	*	.	T	Hydrogen-bonded Turn	trans	-84.4	5.4	179.6	-57.1	178.5	-24.6	0	0	113.8	L8 H13	L8-Q15 HydrophobicContact CD2-CB 4.42Å; H13-Q15 VanDerWaalsContact C-N 3.27Å; H13-Q15 PolarHBondContact ND1-N 3.31Å; H13-Q15 PolarHBondContact O-N 3.04Å
16	T	94.4	Very high	94.2	Very high	21 Å²	21	99.8 Å²	99.8	13%	0.129	49%	0.489	C	S	.	.	S	Bend	trans	-66.2	140.3	167.2	61.4	0	0	0	0	109.4	L8 H13 P14 R18 N19 V20	L8-T16 WeakPolarHBondContact O-CG2 3.37Å; H13-T16 HydrophobicContact CB-CG2 3.94Å; H13-T16 WeakPolarHBondContact O-CG2 3.48Å; H13-T16 PolarHBondContact O-N 2.9Å; H13-T16 VanDerWaalsContact O-N 3.12Å; H13-T16 PolarHBondContact O-OG1 3.42Å; P14-T16 VanDerWaalsContact C-N 3.27Å; P14-T16 PolarHBondContact O-N 3.47Å; T16-R18 PolarHBondContact O-N 3.43Å; T16-R18 VanDerWaalsContact O-N 3.1Å; T16-N19 PolarHBondContact O-N 3.41Å; T16-N19 WeakPolarHBondContact OG1-CB 3.46Å; T16-N19 VanDerWaalsContact OG1-CG 3.23Å; T16-N19 PolarHBondContact OG1-N 2.9Å; T16-N19 PolarHBondContact OG1-ND2 3.18Å; T16-V20 WeakPolarHBondContact O-CG2 3.39Å; T16-V20 PolarHBondContact O-N 3.29Å
17	L	94.6	Very high	94.8	Very high	155 Å²	155	100 Å²	100	81%	0.812	49%	0.487	S	S	*	.	H	α-helix	trans	-51.2	-39.9	-179.2	-68.5	175.5	0	0	0	112.4	N19 V20 E21	L17-N19 PolarHBondContact O-N 3.27Å; L17-V20 PolarHBondContact O-N 2.96Å; L17-E21 VanDerWaalsContact O-CB 3.3Å; L17-E21 WeakPolarHBondContact O-CB 3.3Å; L17-E21 PolarHBondContact O-N 3.08Å
18	R	95.4	Very high	95.3	Very high	152 Å²	152	101.1 Å²	101.1	57%	0.574	49%	0.49	S	S	*	.	H	α-helix	trans	-59.5	-42.9	176.5	-173.8	-175.9	72	173	4.4	112.9	S11 T16 K22	S11-R18 PolarHBondContact O-NH2 3.14Å; T16-R18 PolarHBondContact O-N 3.43Å; T16-R18 VanDerWaalsContact O-N 3.1Å; R18-K22 WeakPolarHBondContact O-CB 3.37Å; R18-K22 PolarHBondContact O-N 3.27Å
19	N	96.8	Very high	95.8	Very high	26 Å²	26	103.3 Å²	103.3	14%	0.139	50%	0.496	C	S	.	.	H	α-helix	trans	-78.4	-36.7	-176.7	-68.3	-10.6	0	0	0	110.9	S11 H13 T16 L17 K22 V23	S11-N19 PolarHBondContact O-ND2 2.95Å; H13-N19 PolarHBondContact O-ND2 3.25Å; T16-N19 PolarHBondContact O-N 3.41Å; T16-N19 WeakPolarHBondContact OG1-CB 3.46Å; T16-N19 VanDerWaalsContact OG1-CG 3.23Å; T16-N19 PolarHBondContact OG1-N 2.9Å; T16-N19 PolarHBondContact OG1-ND2 3.18Å; L17-N19 PolarHBondContact O-N 3.27Å; N19-K22 WeakPolarHBondContact O-CB 3.48Å; N19-K22 PolarHBondContact O-N 2.94Å; N19-V23 WeakPolarHBondContact O-CG2 3.4Å; N19-V23 PolarHBondContact O-N 3.13Å
20	V	97.7	Very high	96.3	Very high	78 Å²	78	100.1 Å²	100.1	47%	0.473	48%	0.484	S	S	.	.	H	α-helix	trans	-59.6	-46.9	170.5	177.9	0	0	0	0	110.5	P14 T16 L17 K22 V23 W24	P14-V20 WeakPolarHBondContact O-CG2 3.36Å; T16-V20 WeakPolarHBondContact O-CG2 3.39Å; T16-V20 PolarHBondContact O-N 3.29Å; L17-V20 PolarHBondContact O-N 2.96Å; V20-K22 VanDerWaalsContact C-N 3.32Å; V20-K22 PolarHBondContact O-N 3.38Å; V20-V23 PolarHBondContact O-N 2.96Å; V20-W24 WeakPolarHBondContact O-CB 3.43Å; V20-W24 PolarHBondContact O-N 3.5Å
21	E	97.6	Very high	96.5	Very high	91 Å²	91	99.9 Å²	99.9	43%	0.425	48%	0.484	S	S	.	.	H	α-helix	trans	-61.7	-39.5	176.4	-172.1	-171.2	170.7	0	0	112	L17 W24 K25	L17-E21 VanDerWaalsContact O-CB 3.3Å; L17-E21 WeakPolarHBondContact O-CB 3.3Å; L17-E21 PolarHBondContact O-N 3.08Å; E21-W24 PolarHBondContact O-N 2.85Å; E21-K25 HydrophobicContact CG-CD 4.42Å; E21-K25 WeakPolarHBondContact O-CG 3.48Å; E21-K25 PolarHBondContact O-N 3.36Å; E21-K25 WeakPolarHBondContact OE1-CE 3.36Å; E21-K25 IonicContact OE1-NZ 3.8Å; E21-K25 PolarHBondContact OE1-NZ 2.92Å
22	K	97.6	Very high	96.8	Very high	154 Å²	154	99.1 Å²	99.1	67%	0.67	48%	0.482	S	S	*	.	H	α-helix	trans	-61.9	-45.1	176.4	-173.5	-177.5	179.1	-176.6	0	111.8	R18 N19 V20 A26	R18-K22 WeakPolarHBondContact O-CB 3.37Å; R18-K22 PolarHBondContact O-N 3.27Å; N19-K22 WeakPolarHBondContact O-CB 3.48Å; N19-K22 PolarHBondContact O-N 2.94Å; V20-K22 VanDerWaalsContact C-N 3.32Å; V20-K22 PolarHBondContact O-N 3.38Å; K22-A26 PolarHBondContact O-N 3.48Å; K22-A26 VanDerWaalsContact O-N 3.16Å
23	V	98.2	Very high	97	Very high	81 Å²	81	95.6 Å²	95.6	49%	0.491	47%	0.473	S	S	.	.	H	α-helix	trans	-63.9	-48.3	176.8	171.9	0	0	0	0	110	N19 V20 K25 A26 E27	N19-V23 WeakPolarHBondContact O-CG2 3.4Å; N19-V23 PolarHBondContact O-N 3.13Å; V20-V23 PolarHBondContact O-N 2.96Å; V23-K25 VanDerWaalsContact C-N 3.35Å; V23-K25 PolarHBondContact O-N 3.06Å; V23-A26 WeakPolarHBondContact O-CA 3.38Å; V23-A26 WeakPolarHBondContact O-CB 3.33Å; V23-A26 PolarHBondContact O-N 3.37Å; V23-E27 HydrophobicContact CG1-CG 4.25Å; V23-E27 WeakPolarHBondContact O-CG 3.46Å; V23-E27 PolarHBondContact O-N 3.42Å
24	W	98	Very high	97.1	Very high	139 Å²	139	102.2 Å²	102.2	53%	0.527	50%	0.497	S	S	.	.	H	α-helix	trans	-57.1	-45.2	179	176.7	63.5	0	0	0	112.6	V20 E21 A26 E27 Q28	V20-W24 WeakPolarHBondContact O-CB 3.43Å; V20-W24 PolarHBondContact O-N 3.5Å; E21-W24 PolarHBondContact O-N 2.85Å; W24-A26 VanDerWaalsContact C-N 3.3Å; W24-A26 PolarHBondContact O-N 3.49Å; W24-E27 PolarHBondContact O-N 2.8Å; W24-Q28 HydrophobicContact CD2-CG 4.34Å; W24-Q28 HydrophobicContact CZ2-CG 4.1Å; W24-Q28 WeakPolarHBondContact O-CG 3.49Å; W24-Q28 PolarHBondContact O-N 3.01Å
25	K	98.3	Very high	97.3	Very high	116 Å²	116	103.9 Å²	103.9	50%	0.504	50%	0.495	S	S	.	.	H	α-helix	trans	-61.5	-37.8	175.1	-74.5	177.9	-176.2	171.1	0	112.7	E21 V23 K29	E21-K25 HydrophobicContact CG-CD 4.42Å; E21-K25 WeakPolarHBondContact O-CG 3.48Å; E21-K25 PolarHBondContact O-N 3.36Å; E21-K25 WeakPolarHBondContact OE1-CE 3.36Å; E21-K25 IonicContact OE1-NZ 3.8Å; E21-K25 PolarHBondContact OE1-NZ 2.92Å; V23-K25 VanDerWaalsContact C-N 3.35Å; V23-K25 PolarHBondContact O-N 3.06Å; K25-K29 PolarHBondContact O-N 3.17Å; K25-K29 VanDerWaalsContact O-N 3.09Å
26	A	98.1	Very high	97.5	Very high	61 Å²	61	104 Å²	104	50%	0.504	49%	0.494	S	S	.	.	H	α-helix	trans	-67.7	-41.6	176.6	0	0	0	0	0	111.6	K22 V23 W24 K29 H30	K22-A26 PolarHBondContact O-N 3.48Å; K22-A26 VanDerWaalsContact O-N 3.16Å; V23-A26 WeakPolarHBondContact O-CA 3.38Å; V23-A26 WeakPolarHBondContact O-CB 3.33Å; V23-A26 PolarHBondContact O-N 3.37Å; W24-A26 VanDerWaalsContact C-N 3.3Å; W24-A26 PolarHBondContact O-N 3.49Å; A26-K29 PolarHBondContact O-N 3.35Å; A26-H30 WeakPolarHBondContact O-CB 3.36Å; A26-H30 PolarHBondContact O-N 3.01Å
27	E	97.8	Very high	97.7	Very high	115 Å²	115	107.3 Å²	107.3	54%	0.537	51%	0.51	S	S	.	.	H	α-helix	trans	-62.8	-45.5	175.9	-71.2	175.6	161.9	0	0	111.7	V23 W24 K29 H30 E31	V23-E27 HydrophobicContact CG1-CG 4.25Å; V23-E27 WeakPolarHBondContact O-CG 3.46Å; V23-E27 PolarHBondContact O-N 3.42Å; W24-E27 PolarHBondContact O-N 2.8Å; E27-K29 VanDerWaalsContact C-N 3.34Å; E27-K29 PolarHBondContact O-N 3.35Å; E27-H30 PolarHBondContact O-N 3.04Å; E27-E31 WeakPolarHBondContact O-CB 3.33Å; E27-E31 PolarHBondContact O-N 2.97Å
28	Q	98.1	Very high	97.8	Very high	92 Å²	92	106 Å²	106	43%	0.43	50%	0.5	S	S	.	.	H	α-helix	trans	-59.3	-43.7	175.4	-72.6	-61.4	120.7	0	0	112	W24 E31 A32	W24-Q28 HydrophobicContact CD2-CG 4.34Å; W24-Q28 HydrophobicContact CZ2-CG 4.1Å; W24-Q28 WeakPolarHBondContact O-CG 3.49Å; W24-Q28 PolarHBondContact O-N 3.01Å; Q28-E31 PolarHBondContact O-N 3.32Å; Q28-A32 PolarHBondContact O-N 2.96Å
29	K	98.2	Very high	98	Very high	134 Å²	134	103.3 Å²	103.3	58%	0.583	49%	0.494	S	S	*	.	H	α-helix	trans	-62.9	-46.2	176.8	-175.9	-176.5	173.2	-169.6	0	111	K25 A26 E27 E31 A32 E33	K25-K29 PolarHBondContact O-N 3.17Å; K25-K29 VanDerWaalsContact O-N 3.09Å; A26-K29 PolarHBondContact O-N 3.35Å; E27-K29 VanDerWaalsContact C-N 3.34Å; E27-K29 PolarHBondContact O-N 3.35Å; K29-E31 VanDerWaalsContact C-N 3.33Å; K29-E31 PolarHBondContact O-N 3.1Å; K29-A32 PolarHBondContact O-N 2.89Å; K29-E33 WeakPolarHBondContact CE-OE1 3.48Å; K29-E33 IonicContact NZ-OE1 2.64Å; K29-E33 WeakPolarHBondContact O-CG 3.35Å; K29-E33 PolarHBondContact O-N 2.7Å
30	H	98.1	Very high	98	Very high	106 Å²	106	106.1 Å²	106.1	49%	0.491	51%	0.508	S	S	.	.	H	α-helix	trans	-62.7	-39.9	179.3	176.9	-104.4	0	0	0	112	A26 E27 E33 R34	A26-H30 WeakPolarHBondContact O-CB 3.36Å; A26-H30 PolarHBondContact O-N 3.01Å; E27-H30 PolarHBondContact O-N 3.04Å; H30-E33 PolarHBondContact O-N 3.42Å; H30-R34 WeakPolarHBondContact CE1-CD 3.46Å; H30-R34 WeakPolarHBondContact O-CB 3.35Å; H30-R34 WeakPolarHBondContact O-CG 3.5Å; H30-R34 PolarHBondContact O-N 2.98Å
31	E	98.1	Very high	98	Very high	81 Å²	81	107.1 Å²	107.1	38%	0.379	51%	0.508	S	S	.	.	H	α-helix	trans	-64	-42.1	175.5	-164.6	-168.5	168.2	0	0	111.9	E27 Q28 K29 R34 K35	E27-E31 WeakPolarHBondContact O-CB 3.33Å; E27-E31 PolarHBondContact O-N 2.97Å; Q28-E31 PolarHBondContact O-N 3.32Å; K29-E31 VanDerWaalsContact C-N 3.33Å; K29-E31 PolarHBondContact O-N 3.1Å; E31-R34 PolarHBondContact O-N 3.41Å; E31-K35 HydrophobicContact CG-CD 4.49Å; E31-K35 WeakPolarHBondContact O-CG 3.33Å; E31-K35 PolarHBondContact O-N 3.43Å; E31-K35 WeakPolarHBondContact OE1-CE 3.35Å; E31-K35 IonicContact OE1-NZ 2.7Å; E31-K35 PolarHBondContact OE1-NZ 3.48Å
32	A	98.1	Very high	98	Very high	61 Å²	61	108.4 Å²	108.4	50%	0.504	51%	0.509	S	S	.	.	H	α-helix	trans	-62.8	-42.9	175.7	0	0	0	0	0	112.1	Q28 K29 K35 K36	Q28-A32 PolarHBondContact O-N 2.96Å; K29-A32 PolarHBondContact O-N 2.89Å; A32-K35 PolarHBondContact O-N 3.33Å; A32-K36 PolarHBondContact O-N 3.49Å; A32-K36 VanDerWaalsContact O-N 3.07Å
33	E	97.9	Very high	98	Very high	96 Å²	96	105.8 Å²	105.8	45%	0.449	50%	0.499	S	S	.	.	H	α-helix	trans	-62.6	-43.2	175.5	-74	175.6	153.2	0	0	111.4	K29 H30 K36 I37	K29-E33 WeakPolarHBondContact CE-OE1 3.48Å; K29-E33 IonicContact NZ-OE1 2.64Å; K29-E33 WeakPolarHBondContact O-CG 3.35Å; K29-E33 PolarHBondContact O-N 2.7Å; H30-E33 PolarHBondContact O-N 3.42Å; E33-K36 PolarHBondContact O-N 2.92Å; E33-I37 VanDerWaalsContact O-CG1 3.3Å; E33-I37 WeakPolarHBondContact O-CG1 3.49Å; E33-I37 PolarHBondContact O-N 3.23Å
34	R	98.1	Very high	98	Very high	163 Å²	163	106.1 Å²	106.1	62%	0.615	50%	0.497	S	S	*	.	H	α-helix	trans	-60.9	-45.9	176.1	-78	-176.1	62.3	-169.5	2.4	112.7	H30 E31 K36 I37 E38	H30-R34 WeakPolarHBondContact CE1-CD 3.46Å; H30-R34 WeakPolarHBondContact O-CB 3.35Å; H30-R34 WeakPolarHBondContact O-CG 3.5Å; H30-R34 PolarHBondContact O-N 2.98Å; E31-R34 PolarHBondContact O-N 3.41Å; R34-K36 VanDerWaalsContact C-N 3.32Å; R34-K36 PolarHBondContact O-N 3.39Å; R34-I37 PolarHBondContact O-N 3.01Å; R34-E38 PolarHBondContact O-N 3.34Å
35	K	98.1	Very high	98	Very high	120 Å²	120	106.4 Å²	106.4	52%	0.522	50%	0.498	S	S	.	.	H	α-helix	trans	-60.2	-42.8	177.5	-77.2	171.8	170.3	162.8	0	111.6	E31 A32 I37 E38 E39	E31-K35 HydrophobicContact CG-CD 4.49Å; E31-K35 WeakPolarHBondContact O-CG 3.33Å; E31-K35 PolarHBondContact O-N 3.43Å; E31-K35 WeakPolarHBondContact OE1-CE 3.35Å; E31-K35 IonicContact OE1-NZ 2.7Å; E31-K35 PolarHBondContact OE1-NZ 3.48Å; A32-K35 PolarHBondContact O-N 3.33Å; K35-I37 PolarHBondContact O-N 3.29Å; K35-E38 PolarHBondContact O-N 3.47Å; K35-E39 PolarHBondContact O-N 3.02Å
36	K	98	Very high	97.9	Very high	141 Å²	141	105.1 Å²	105.1	61%	0.613	49%	0.494	S	S	*	.	H	α-helix	trans	-62.6	-41	176.1	-174.8	172.5	-177	175.2	0	112.4	A32 E33 R34 E39 L40	A32-K36 PolarHBondContact O-N 3.49Å; A32-K36 VanDerWaalsContact O-N 3.07Å; E33-K36 PolarHBondContact O-N 2.92Å; R34-K36 VanDerWaalsContact C-N 3.32Å; R34-K36 PolarHBondContact O-N 3.39Å; K36-E39 PolarHBondContact O-N 3.07Å; K36-L40 HydrophobicContact CG-CD1 4.38Å; K36-L40 WeakPolarHBondContact O-CG 3.47Å; K36-L40 PolarHBondContact O-N 2.97Å; K36-L40 VanDerWaalsContact O-N 3.1Å
37	I	98.2	Very high	97.7	Very high	92 Å²	92	107.3 Å²	107.3	47%	0.472	49%	0.494	S	S	.	.	H	α-helix	trans	-64.7	-42.6	176.8	-68.7	164.7	0	0	0	110.7	E33 R34 K35 E39 L40 Q41	E33-I37 VanDerWaalsContact O-CG1 3.3Å; E33-I37 WeakPolarHBondContact O-CG1 3.49Å; E33-I37 PolarHBondContact O-N 3.23Å; R34-I37 PolarHBondContact O-N 3.01Å; K35-I37 PolarHBondContact O-N 3.29Å; I37-E39 VanDerWaalsContact C-N 3.35Å; I37-E39 PolarHBondContact O-N 3.38Å; I37-L40 PolarHBondContact O-N 3.1Å; I37-Q41 HydrophobicContact CG2-CG 4.4Å; I37-Q41 WeakPolarHBondContact O-CB 3.35Å; I37-Q41 WeakPolarHBondContact O-CG 3.45Å; I37-Q41 PolarHBondContact O-N 3.45Å
38	E	98.3	Very high	97.7	Very high	128 Å²	128	109.2 Å²	109.2	60%	0.598	50%	0.496	S	S	*	.	H	α-helix	trans	-62.7	-41.3	178.7	-176.1	174.7	-167.8	0	0	112.2	R34 K35 Q41 R42	R34-E38 PolarHBondContact O-N 3.34Å; K35-E38 PolarHBondContact O-N 3.47Å; E38-Q41 PolarHBondContact O-N 3.01Å; E38-R42 PolarHBondContact O-N 2.86Å
39	E	98.1	Very high	97.5	Very high	95 Å²	95	107 Å²	107	44%	0.444	49%	0.494	S	S	.	.	H	α-helix	trans	-60.5	-49.6	174.3	178.6	165.3	-129.3	0	0	111.8	K35 K36 I37 Q41 R42 E43	K35-E39 PolarHBondContact O-N 3.02Å; K36-E39 PolarHBondContact O-N 3.07Å; I37-E39 VanDerWaalsContact C-N 3.35Å; I37-E39 PolarHBondContact O-N 3.38Å; E39-Q41 VanDerWaalsContact C-N 3.29Å; E39-Q41 PolarHBondContact O-N 2.87Å; E39-R42 WeakPolarHBondContact O-CB 3.35Å; E39-R42 PolarHBondContact O-N 3.46Å; E39-R42 IonicContact OE1-NH2 3.63Å; E39-E43 PolarHBondContact O-N 3.25Å
40	L	98.1	Very high	97.2	Very high	84 Å²	84	107.9 Å²	107.9	44%	0.44	49%	0.493	S	S	.	.	H	α-helix	trans	-60.9	-38.5	176.8	-70.2	170.5	0	0	0	112.2	K36 I37 R42 E43 L44	K36-L40 HydrophobicContact CG-CD1 4.38Å; K36-L40 WeakPolarHBondContact O-CG 3.47Å; K36-L40 PolarHBondContact O-N 2.97Å; K36-L40 VanDerWaalsContact O-N 3.1Å; I37-L40 PolarHBondContact O-N 3.1Å; L40-R42 VanDerWaalsContact C-N 3.31Å; L40-R42 PolarHBondContact O-N 3.42Å; L40-E43 PolarHBondContact O-N 2.92Å; L40-L44 WeakPolarHBondContact O-CG 3.3Å; L40-L44 PolarHBondContact O-N 3.34Å
41	Q	97.9	Very high	97	Very high	99 Å²	99	107.1 Å²	107.1	46%	0.463	49%	0.49	S	S	.	.	H	α-helix	trans	-65.9	-34.6	174.9	-75.4	-178.3	3	0	0	112.4	I37 E38 E39 R45	I37-Q41 HydrophobicContact CG2-CG 4.4Å; I37-Q41 WeakPolarHBondContact O-CB 3.35Å; I37-Q41 WeakPolarHBondContact O-CG 3.45Å; I37-Q41 PolarHBondContact O-N 3.45Å; E38-Q41 PolarHBondContact O-N 3.01Å; E39-Q41 VanDerWaalsContact C-N 3.29Å; E39-Q41 PolarHBondContact O-N 2.87Å; Q41-R45 WeakPolarHBondContact O-CG 3.21Å; Q41-R45 PolarHBondContact O-N 3.45Å; Q41-R45 VanDerWaalsContact O-N 3.17Å
42	R	97.9	Very high	96.7	Very high	118 Å²	118	109.8 Å²	109.8	45%	0.445	50%	0.502	S	S	.	.	H	α-helix	trans	-66.2	-48.5	174.3	-177.8	-176.4	65.4	-154.1	-4.9	110.5	E38 E39 L40 L44 R45 E46	E38-R42 PolarHBondContact O-N 2.86Å; E39-R42 WeakPolarHBondContact O-CB 3.35Å; E39-R42 PolarHBondContact O-N 3.46Å; E39-R42 IonicContact OE1-NH2 3.63Å; L40-R42 VanDerWaalsContact C-N 3.31Å; L40-R42 PolarHBondContact O-N 3.42Å; R42-L44 VanDerWaalsContact C-N 3.34Å; R42-L44 PolarHBondContact O-N 3.36Å; R42-R45 PolarHBondContact O-N 3.24Å; R42-R45 VanDerWaalsContact O-N 3.1Å; R42-E46 WeakPolarHBondContact CG-OE1 3.39Å; R42-E46 PolarHBondContact O-N 3.11Å
43	E	97.5	Very high	96.3	Very high	100 Å²	100	112.9 Å²	112.9	47%	0.467	51%	0.508	S	S	.	.	H	α-helix	trans	-57	-46.8	178.1	-70.1	178.7	172.5	0	0	111.7	E39 L40 R45 E46 E47	E39-E43 PolarHBondContact O-N 3.25Å; L40-E43 PolarHBondContact O-N 2.92Å; E43-R45 VanDerWaalsContact C-N 3.29Å; E43-R45 PolarHBondContact O-N 3.25Å; E43-E46 PolarHBondContact O-N 3.11Å; E43-E47 WeakPolarHBondContact O-CB 3.47Å; E43-E47 PolarHBondContact O-N 3.09Å
44	L	97.4	Very high	95.8	Very high	88 Å²	88	114.2 Å²	114.2	46%	0.461	51%	0.514	S	S	.	.	H	α-helix	trans	-60.7	-36.2	176.4	-74.8	170.8	0	0	0	113.1	L40 R42 R48	L40-L44 WeakPolarHBondContact O-CG 3.3Å; L40-L44 PolarHBondContact O-N 3.34Å; R42-L44 VanDerWaalsContact C-N 3.34Å; R42-L44 PolarHBondContact O-N 3.36Å; L44-R48 WeakPolarHBondContact O-CB 3.41Å; L44-R48 VanDerWaalsContact O-CG 3.3Å; L44-R48 WeakPolarHBondContact O-CG 3.37Å; L44-R48 PolarHBondContact O-N 3.06Å; L44-R48 VanDerWaalsContact O-N 3.08Å
45	R	96.8	Very high	95.4	Very high	144 Å²	144	114.4 Å²	114.4	54%	0.543	52%	0.515	S	S	.	.	H	α-helix	trans	-69.9	-40.9	176.2	-76.4	-171	-60.1	-105.2	1	111.6	Q41 R42 E43 R48 A49	Q41-R45 WeakPolarHBondContact O-CG 3.21Å; Q41-R45 PolarHBondContact O-N 3.45Å; Q41-R45 VanDerWaalsContact O-N 3.17Å; R42-R45 PolarHBondContact O-N 3.24Å; R42-R45 VanDerWaalsContact O-N 3.1Å; E43-R45 VanDerWaalsContact C-N 3.29Å; E43-R45 PolarHBondContact O-N 3.25Å; R45-R48 PolarHBondContact O-N 2.93Å; R45-A49 WeakPolarHBondContact O-CB 3.45Å; R45-A49 PolarHBondContact O-N 2.95Å
46	E	96.6	Very high	95	Very high	89 Å²	89	116.3 Å²	116.3	42%	0.416	52%	0.52	S	S	.	.	H	α-helix	trans	-65.4	-41	177.1	-71.5	179.1	-159.7	0	0	111.8	R42 E43 A49 R50	R42-E46 WeakPolarHBondContact CG-OE1 3.39Å; R42-E46 PolarHBondContact O-N 3.11Å; E43-E46 PolarHBondContact O-N 3.11Å; E46-A49 PolarHBondContact O-N 3.07Å; E46-R50 WeakPolarHBondContact O-CG 3.4Å; E46-R50 PolarHBondContact O-N 3.32Å
47	E	95.4	Very high	94.3	Very high	107 Å²	107	110.8 Å²	110.8	50%	0.5	50%	0.5	S	S	.	.	H	α-helix	trans	-61.1	-50.5	175.3	-170.1	178.3	174.7	0	0	110.9	E43 A49 R50 E51	E43-E47 WeakPolarHBondContact O-CB 3.47Å; E43-E47 PolarHBondContact O-N 3.09Å; E47-A49 VanDerWaalsContact C-N 3.35Å; E47-A49 PolarHBondContact O-N 2.91Å; E47-R50 WeakPolarHBondContact O-CB 3.29Å; E47-R50 PolarHBondContact O-N 2.91Å; E47-R50 VanDerWaalsContact O-N 3.13Å; E47-E51 WeakPolarHBondContact O-CG 3.49Å; E47-E51 PolarHBondContact O-N 3.1Å
48	R	95.9	Very high	93.7	Very high	156 Å²	156	111.6 Å²	111.6	59%	0.589	50%	0.502	S	S	*	.	H	α-helix	trans	-58.4	-43.6	176.1	-75.2	177.9	-174	174.3	2.6	112.9	L44 R45 R50 E51 E52	L44-R48 WeakPolarHBondContact O-CB 3.41Å; L44-R48 VanDerWaalsContact O-CG 3.3Å; L44-R48 WeakPolarHBondContact O-CG 3.37Å; L44-R48 PolarHBondContact O-N 3.06Å; L44-R48 VanDerWaalsContact O-N 3.08Å; R45-R48 PolarHBondContact O-N 2.93Å; R48-R50 VanDerWaalsContact C-N 3.28Å; R48-R50 PolarHBondContact O-N 3.5Å; R48-E51 PolarHBondContact O-N 2.99Å; R48-E52 WeakPolarHBondContact O-CB 3.42Å; R48-E52 WeakPolarHBondContact O-CG 3.43Å; R48-E52 PolarHBondContact O-N 3.44Å
49	A	95	Very high	92.9	Very high	45 Å²	45	112.3 Å²	112.3	37%	0.372	51%	0.51	S	S	.	.	H	α-helix	trans	-62.7	-36.4	178.7	0	0	0	0	0	112	R45 E46 E47 M53	R45-A49 WeakPolarHBondContact O-CB 3.45Å; R45-A49 PolarHBondContact O-N 2.95Å; E46-A49 PolarHBondContact O-N 3.07Å; E47-A49 VanDerWaalsContact C-N 3.35Å; E47-A49 PolarHBondContact O-N 2.91Å; A49-M53 WeakPolarHBondContact O-CB 3.5Å; A49-M53 WeakPolarHBondContact O-CG 3.2Å; A49-M53 PolarHBondContact O-N 3.27Å
50	R	92.3	Very high	92.2	Very high	152 Å²	152	111.9 Å²	111.9	57%	0.574	51%	0.514	S	S	*	.	H	α-helix	trans	-68.3	-45.5	174.3	-72.1	175.1	-173.6	162.4	7.9	111.8	E46 E47 R48 E52 M53 Q54	E46-R50 WeakPolarHBondContact O-CG 3.4Å; E46-R50 PolarHBondContact O-N 3.32Å; E47-R50 WeakPolarHBondContact O-CB 3.29Å; E47-R50 PolarHBondContact O-N 2.91Å; E47-R50 VanDerWaalsContact O-N 3.13Å; R48-R50 VanDerWaalsContact C-N 3.28Å; R48-R50 PolarHBondContact O-N 3.5Å; R50-E52 VanDerWaalsContact C-N 3.33Å; R50-E52 PolarHBondContact O-N 3.43Å; R50-M53 PolarHBondContact O-N 3.4Å; R50-Q54 WeakPolarHBondContact O-CG 3.48Å; R50-Q54 PolarHBondContact O-N 3.26Å
51	E	93.3	Very high	90.8	Very high	91 Å²	91	110.7 Å²	110.7	43%	0.425	52%	0.522	S	S	.	.	H	α-helix	trans	-60.5	-43	176.7	-70.9	-173.4	158.7	0	0	111.6	E47 R48 Q54 R55	E47-E51 WeakPolarHBondContact O-CG 3.49Å; E47-E51 PolarHBondContact O-N 3.1Å; R48-E51 PolarHBondContact O-N 2.99Å; E51-Q54 PolarHBondContact O-N 2.87Å; E51-R55 WeakPolarHBondContact O-CB 3.42Å; E51-R55 WeakPolarHBondContact O-CG 3.48Å; E51-R55 PolarHBondContact O-N 3.27Å
52	E	92	Very high	89.1	Confident	137 Å²	137	109.9 Å²	109.9	64%	0.64	53%	0.532	S	S	*	.	H	α-helix	trans	-62.9	-43.6	176.1	-75.7	176.4	-178.8	0	0	111.8	R48 R50 R55 Y56	R48-E52 WeakPolarHBondContact O-CB 3.42Å; R48-E52 WeakPolarHBondContact O-CG 3.43Å; R48-E52 PolarHBondContact O-N 3.44Å; R50-E52 VanDerWaalsContact C-N 3.33Å; R50-E52 PolarHBondContact O-N 3.43Å; E52-R55 PolarHBondContact O-N 3.39Å; E52-Y56 VanDerWaalsContact O-CB 3.3Å; E52-Y56 WeakPolarHBondContact O-CB 3.48Å; E52-Y56 PolarHBondContact O-N 3.12Å
53	M	88.9	Confident	87.2	Confident	125 Å²	125	108 Å²	108	62%	0.616	53%	0.534	S	S	*	.	H	α-helix	trans	-63.3	-40.7	175	-78.5	-170	-69.4	0	0	112.4	A49 R50 A57	A49-M53 WeakPolarHBondContact O-CB 3.5Å; A49-M53 WeakPolarHBondContact O-CG 3.2Å; A49-M53 PolarHBondContact O-N 3.27Å; R50-M53 PolarHBondContact O-N 3.4Å; M53-A57 WeakPolarHBondContact O-CB 3.28Å; M53-A57 PolarHBondContact O-N 3.01Å
54	Q	88.1	Confident	85.3	Confident	125 Å²	125	112.4 Å²	112.4	58%	0.584	55%	0.551	S	S	*	*	H	α-helix	trans	-63.7	-49.8	176.7	-75.1	177.8	9.1	0	0	111.1	R50 E51 Y56 A57 E58	R50-Q54 WeakPolarHBondContact O-CG 3.48Å; R50-Q54 PolarHBondContact O-N 3.26Å; E51-Q54 PolarHBondContact O-N 2.87Å; Q54-Y56 VanDerWaalsContact C-N 3.33Å; Q54-Y56 PolarHBondContact O-N 2.9Å; Q54-A57 PolarHBondContact O-N 3.42Å; Q54-A57 VanDerWaalsContact O-N 3.14Å; Q54-E58 WeakPolarHBondContact O-CG 3.46Å; Q54-E58 PolarHBondContact O-N 2.81Å
55	R	90.1	Very high	83.3	Confident	167 Å²	167	112.2 Å²	112.2	63%	0.63	56%	0.557	S	S	*	*	H	α-helix	trans	-57.8	-45.2	176.3	-75.3	-178.3	178.3	-172.1	3.2	112	E51 E52 A57 E58 D59	E51-R55 WeakPolarHBondContact O-CB 3.42Å; E51-R55 WeakPolarHBondContact O-CG 3.48Å; E51-R55 PolarHBondContact O-N 3.27Å; E52-R55 PolarHBondContact O-N 3.39Å; R55-A57 VanDerWaalsContact C-N 3.33Å; R55-A57 PolarHBondContact O-N 2.9Å; R55-E58 PolarHBondContact O-N 3Å; R55-D59 WeakPolarHBondContact O-CB 3.3Å; R55-D59 PolarHBondContact O-N 2.98Å
56	Y	88.3	Confident	81.2	Confident	159 Å²	159	110.8 Å²	110.8	62%	0.624	57%	0.569	S	S	*	*	H	α-helix	trans	-62	-40.5	177.2	-179	-101.8	0	0	0	112.1	E52 Q54 D59 V60	E52-Y56 VanDerWaalsContact O-CB 3.3Å; E52-Y56 WeakPolarHBondContact O-CB 3.48Å; E52-Y56 PolarHBondContact O-N 3.12Å; Q54-Y56 VanDerWaalsContact C-N 3.33Å; Q54-Y56 PolarHBondContact O-N 2.9Å; Y56-D59 PolarHBondContact O-N 3.46Å; Y56-V60 HydrophobicContact CD1-CG2 4.25Å; Y56-V60 HydrophobicContact CD2-CG2 4.14Å; Y56-V60 HydrophobicContact CE1-CG2 3.85Å; Y56-V60 HydrophobicContact CE2-CG2 3.72Å; Y56-V60 HydrophobicContact CG-CG2 4.39Å; Y56-V60 WeakPolarHBondContact O-CB 3.42Å; Y56-V60 VanDerWaalsContact O-CG2 3.25Å; Y56-V60 WeakPolarHBondContact O-CG2 3.13Å; Y56-V60 PolarHBondContact O-N 2.94Å
57	A	85.2	Confident	79.2	Confident	25 Å²	25	117.9 Å²	117.9	21%	0.207	59%	0.592	C	S	.	*	H	α-helix	trans	-67.7	-34.3	177.6	0	0	0	0	0	113.2	M53 Q54 R55 G61 A62 V63	M53-A57 WeakPolarHBondContact O-CB 3.28Å; M53-A57 PolarHBondContact O-N 3.01Å; Q54-A57 PolarHBondContact O-N 3.42Å; Q54-A57 VanDerWaalsContact O-N 3.14Å; R55-A57 VanDerWaalsContact C-N 3.33Å; R55-A57 PolarHBondContact O-N 2.9Å; A57-G61 PolarHBondContact O-N 3.08Å; A57-A62 PolarHBondContact O-N 3.14Å; A57-A62 VanDerWaalsContact O-N 3.08Å; A57-V63 HydrophobicContact CB-CG2 3.82Å; A57-V63 PolarHBondContact O-N 3.18Å
58	E	84.6	Confident	76.7	Confident	109 Å²	109	125.8 Å²	125.8	51%	0.509	63%	0.625	S	S	.	*	H	α-helix	trans	-66.6	-48.1	171.2	-71.2	176.3	174.6	0	0	111.3	Q54 R55 V60 G61	Q54-E58 WeakPolarHBondContact O-CG 3.46Å; Q54-E58 PolarHBondContact O-N 2.81Å; R55-E58 PolarHBondContact O-N 3Å; E58-V60 PolarHBondContact O-N 3.24Å; E58-G61 WeakPolarHBondContact O-CA 3.4Å; E58-G61 PolarHBondContact O-N 2.94Å
59	D	81.9	Confident	75.7	Confident	143 Å²	143	124.3 Å²	124.3	77%	0.765	63%	0.627	S	S	*	*	H	α-helix	trans	-63.6	-39.6	-179.1	-78	-13.2	0	0	0	112.6	R55 Y56 G61	R55-D59 WeakPolarHBondContact O-CB 3.3Å; R55-D59 PolarHBondContact O-N 2.98Å; Y56-D59 PolarHBondContact O-N 3.46Å; D59-G61 PolarHBondContact O-N 3.16Å
60	V	82.9	Confident	74.7	Confident	87 Å²	87	128.5 Å²	128.5	53%	0.527	64%	0.641	S	S	.	*	T	Hydrogen-bonded Turn	trans	-74.5	-6.8	176.2	177.2	0	0	0	0	111.7	Y56 E58 A62	Y56-V60 HydrophobicContact CD1-CG2 4.25Å; Y56-V60 HydrophobicContact CD2-CG2 4.14Å; Y56-V60 HydrophobicContact CE1-CG2 3.85Å; Y56-V60 HydrophobicContact CE2-CG2 3.72Å; Y56-V60 HydrophobicContact CG-CG2 4.39Å; Y56-V60 WeakPolarHBondContact O-CB 3.42Å; Y56-V60 VanDerWaalsContact O-CG2 3.25Å; Y56-V60 WeakPolarHBondContact O-CG2 3.13Å; Y56-V60 PolarHBondContact O-N 2.94Å; E58-V60 PolarHBondContact O-N 3.24Å; V60-A62 PolarHBondContact O-N 3.17Å
61	G	68.8	Low	73.7	Confident	59 Å²	59	127.2 Å²	127.2	61%	0.608	64%	0.644	S	S	*	*	T	Hydrogen-bonded Turn	trans	72	13.3	178.9	0	0	0	0	0	114.1	A57 E58 D59 V63	A57-G61 PolarHBondContact O-N 3.08Å; E58-G61 WeakPolarHBondContact O-CA 3.4Å; E58-G61 PolarHBondContact O-N 2.94Å; D59-G61 PolarHBondContact O-N 3.16Å; G61-V63 VanDerWaalsContact C-N 3.33Å
62	A	61.1	Low	72.5	Confident	81 Å²	81	129.3 Å²	129.3	67%	0.669	66%	0.657	S	S	*	*			trans	-75.6	-24	-179.8	0	0	0	0	0	112.3	A57 V60	A57-A62 PolarHBondContact O-N 3.14Å; A57-A62 VanDerWaalsContact O-N 3.08Å; V60-A62 PolarHBondContact O-N 3.17Å
63	V	58.6	Low	71.3	Confident	79 Å²	79	128.8 Å²	128.8	48%	0.479	66%	0.658	S	S	.	*	S	Bend	trans	-115.3	109.2	175.2	179.9	0	0	0	0	108.5	A57 G61 S65	A57-V63 HydrophobicContact CB-CG2 3.82Å; A57-V63 PolarHBondContact O-N 3.18Å; G61-V63 VanDerWaalsContact C-N 3.33Å; V63-S65 PolarHBondContact O-N 3.16Å
64	K	57.8	Low	70.2	Confident	193 Å²	193	129.1 Å²	129.1	84%	0.839	66%	0.661	S	S	*	*			trans	-63.1	121.5	160.7	-94.2	-174.3	-170.8	178.9	0	106.7	S66	K64-S66 VanDerWaalsContact C-N 3.27Å; K64-S66 PolarHBondContact O-N 2.64Å
65	S	54.9	Low	68.9	Low	83 Å²	83	129.4 Å²	129.4	58%	0.58	67%	0.666	S	S	*	*			trans	-55.6	99.3	159.9	-173.5	0	0	0	0	107.4	V63 W67	V63-S65 PolarHBondContact O-N 3.16Å; S65-W67 PolarHBondContact O-N 2.83Å
66	S	54.1	Low	67.2	Low	115 Å²	115	126.5 Å²	126.5	80%	0.804	67%	0.669	S	S	*	*			trans	-81.8	58.3	171.7	68.2	0	0	0	0	108.2	K64	K64-S66 VanDerWaalsContact C-N 3.27Å; K64-S66 PolarHBondContact O-N 2.64Å
67	W	52.8	Low	65.5	Low	237 Å²	237	123.8 Å²	123.8	90%	0.898	67%	0.673	S	S	*	*			trans	-88.9	109.6	155.1	-89.7	73.8	0	0	0	106.3	S65	S65-W67 PolarHBondContact O-N 2.83Å
68	K	43	Very low	63.7	Low	274 Å²	274	132.7 Å²	132.7	100%	1.191	72%	0.716	S	S	*	*			trans	-118.2	0	165	-154.5	-173.4	-167.4	-174.9	0	107.5

Retrieved 68 of 68 residues in 18.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).