A0A087WY77_HUMAN Loading...

WAP four-disulfide core domain 1

AlphaFold DB , UniProt , Accession A0A087WY77, Species HUMAN (Homo sapiens, Human), Gene WFDC1, Length 66 aa.

						>A0A087WY77_HUMAN|A0A087WY77|WFDC1
MPLTGVGPGSCRRQIIRALCLLLLLLHAGSAKNIWKRALPARLAEKSRVSAWDGEAGAACVGGSQP
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	36.7	Very low	55.9	Low	235 Å²	235	103.8 Å²	103.8	100%	1.158	68%	0.68	S	S	*	*				0	115.1	0	-62.5	-162.9	160.1	0	0	107.6
2	P	55.7	Low	57.9	Low	135 Å²	135	111.6 Å²	111.6	88%	0.877	69%	0.686	S	S	*	*			trans	-78.7	137.8	-172.9	30.9	-29.2	0	0	0	110.7
3	L	54.7	Low	59.8	Low	157 Å²	157	117.8 Å²	117.8	82%	0.822	69%	0.689	S	S	*	*			trans	-61.8	130.2	-176.4	-67.7	125.2	0	0	0	111.6	G5	L3-G5 PolarHBondContact O-N 3.29Å
4	T	52.5	Low	61.6	Low	121 Å²	121	117.2 Å²	117.2	74%	0.742	68%	0.676	S	S	*	*			trans	33.5	81.1	141.5	60.4	0	0	0	0	115.2	V6	T4-V6 PolarHBondContact O-N 3.21Å
5	G	51.8	Low	63.2	Low	85 Å²	85	116 Å²	116	88%	0.876	67%	0.665	S	S	*	*			trans	-66.9	70.4	167	0	0	0	0	0	112.1	L3	L3-G5 PolarHBondContact O-N 3.29Å
6	V	61.8	Low	64.8	Low	93 Å²	93	115.6 Å²	115.6	56%	0.564	66%	0.659	S	S	*	*			trans	-104.3	77.3	161	179.6	0	0	0	0	106.3	T4	T4-V6 PolarHBondContact O-N 3.21Å
7	G	54.8	Low	66.2	Low	41 Å²	41	119.8 Å²	119.8	42%	0.423	66%	0.661	S	S	.	*			trans	-62.6	154.3	169.2	0	0	0	0	0	110.6	G9 S10	G7-G9 PolarHBondContact O-N 3.42Å; G7-S10 PolarHBondContact O-N 2.85Å
8	P	55	Low	67.6	Low	117 Å²	117	116.4 Å²	116.4	76%	0.76	65%	0.651	S	S	*	*	T	Hydrogen-bonded Turn	trans	-56.2	-10	-179.6	16.6	-28.7	0	0	0	115.4	S10	P8-S10 VanDerWaalsContact C-N 3.31Å
9	G	57.3	Low	68.9	Low	52 Å²	52	115.4 Å²	115.4	54%	0.536	64%	0.644	S	S	.	*	H	α-helix	trans	-69.9	-19.2	169.2	0	0	0	0	0	115.2	G7	G7-G9 PolarHBondContact O-N 3.42Å
10	S	64.5	Low	69.9	Low	43 Å²	43	113.8 Å²	113.8	30%	0.301	64%	0.64	S	S	.	*	H	α-helix	trans	-76.9	-37.2	176.3	-179	0	0	0	0	112	G7 P8 R12 R13 Q14	G7-S10 PolarHBondContact O-N 2.85Å; P8-S10 VanDerWaalsContact C-N 3.31Å; S10-R12 PolarHBondContact O-N 2.91Å; S10-R13 PolarHBondContact O-N 2.8Å; S10-Q14 WeakPolarHBondContact O-CB 3.47Å; S10-Q14 WeakPolarHBondContact O-CG 3.44Å; S10-Q14 PolarHBondContact O-N 3.3Å; S10-Q14 PolarHBondContact OG-NE2 3.03Å
11	C	70.4	Confident	70.7	Confident	63 Å²	63	113.4 Å²	113.4	43%	0.426	64%	0.636	S	S	.	*	H	α-helix	trans	-62	-45.5	-178.9	-65.2	0	0	0	0	111.7	R13 Q14 I15	C11-R13 VanDerWaalsContact C-N 3.35Å; C11-R13 PolarHBondContact O-N 3.44Å; C11-Q14 PolarHBondContact O-N 2.95Å; C11-I15 WeakPolarHBondContact O-CB 3.46Å; C11-I15 WeakPolarHBondContact O-CD1 3.33Å; C11-I15 WeakPolarHBondContact O-CG1 3.44Å; C11-I15 PolarHBondContact O-N 3.44Å
12	R	79.9	Confident	73.2	Confident	197 Å²	197	107.7 Å²	107.7	74%	0.743	61%	0.609	S	S	*	*	H	α-helix	trans	-60.4	-43.2	175	-80.9	-172.6	-166.7	-147.4	2.6	112.3	S10 Q14 I15 I16	S10-R12 PolarHBondContact O-N 2.91Å; R12-Q14 VanDerWaalsContact C-N 3.35Å; R12-I15 PolarHBondContact O-N 2.9Å; R12-I16 WeakPolarHBondContact O-CB 3.35Å; R12-I16 WeakPolarHBondContact O-CD1 3.46Å; R12-I16 WeakPolarHBondContact O-CG1 3.39Å; R12-I16 PolarHBondContact O-N 3.36Å
13	R	82.1	Confident	74.7	Confident	192 Å²	192	106.8 Å²	106.8	73%	0.725	60%	0.596	S	S	*	*	H	α-helix	trans	-66.8	-36.2	178.1	-74.2	-179.8	178.9	-152.5	-0.8	112.1	S10 C11 R17	S10-R13 PolarHBondContact O-N 2.8Å; C11-R13 VanDerWaalsContact C-N 3.35Å; C11-R13 PolarHBondContact O-N 3.44Å; R13-R17 WeakPolarHBondContact O-CB 3.22Å; R13-R17 WeakPolarHBondContact O-CG 3.36Å; R13-R17 PolarHBondContact O-N 2.83Å
14	Q	84.6	Confident	76.2	Confident	110 Å²	110	104.9 Å²	104.9	51%	0.514	59%	0.587	S	S	.	*	H	α-helix	trans	-67	-43.2	173.6	-78.9	-177.6	69.7	0	0	111.7	S10 C11 R12 R17 A18	S10-Q14 WeakPolarHBondContact O-CB 3.47Å; S10-Q14 WeakPolarHBondContact O-CG 3.44Å; S10-Q14 PolarHBondContact O-N 3.3Å; S10-Q14 PolarHBondContact OG-NE2 3.03Å; C11-Q14 PolarHBondContact O-N 2.95Å; R12-Q14 VanDerWaalsContact C-N 3.35Å; Q14-R17 PolarHBondContact O-N 3.26Å; Q14-A18 WeakPolarHBondContact O-CB 3.48Å; Q14-A18 PolarHBondContact O-N 2.89Å
15	I	86.2	Confident	77.6	Confident	99 Å²	99	104.9 Å²	104.9	51%	0.508	58%	0.581	S	S	.	*	H	α-helix	trans	-62.3	-46.1	175.8	-67.7	163	0	0	0	110.3	C11 R12 R17 A18 L19	C11-I15 WeakPolarHBondContact O-CB 3.46Å; C11-I15 WeakPolarHBondContact O-CD1 3.33Å; C11-I15 WeakPolarHBondContact O-CG1 3.44Å; C11-I15 PolarHBondContact O-N 3.44Å; R12-I15 PolarHBondContact O-N 2.9Å; I15-R17 VanDerWaalsContact C-N 3.34Å; I15-R17 PolarHBondContact O-N 3.46Å; I15-A18 PolarHBondContact O-N 3.49Å; I15-L19 HydrophobicContact CG2-CD1 3.84Å; I15-L19 HydrophobicContact CG2-CG 4.31Å; I15-L19 WeakPolarHBondContact O-CB 3.41Å; I15-L19 VanDerWaalsContact O-CG 3.27Å; I15-L19 WeakPolarHBondContact O-CG 3.4Å; I15-L19 PolarHBondContact O-N 2.95Å
16	I	88.7	Confident	78.9	Confident	110 Å²	110	106.5 Å²	106.5	56%	0.564	57%	0.569	S	S	*	*	H	α-helix	trans	-61.2	-43.8	176.6	-68.1	163.9	0	0	0	110.8	R12 L19 C20	R12-I16 WeakPolarHBondContact O-CB 3.35Å; R12-I16 WeakPolarHBondContact O-CD1 3.46Å; R12-I16 WeakPolarHBondContact O-CG1 3.39Å; R12-I16 PolarHBondContact O-N 3.36Å; I16-L19 PolarHBondContact O-N 2.85Å; I16-C20 WeakPolarHBondContact O-CB 3.27Å; I16-C20 PolarHBondContact O-N 2.81Å
17	R	89.1	Confident	79.5	Confident	187 Å²	187	109.6 Å²	109.6	71%	0.706	58%	0.577	S	S	*	*	H	α-helix	trans	-61.4	-45.3	175.1	-81.1	178.4	169.3	179.3	-3.7	112	R13 Q14 I15 C20 L21	R13-R17 WeakPolarHBondContact O-CB 3.22Å; R13-R17 WeakPolarHBondContact O-CG 3.36Å; R13-R17 PolarHBondContact O-N 2.83Å; Q14-R17 PolarHBondContact O-N 3.26Å; I15-R17 VanDerWaalsContact C-N 3.34Å; I15-R17 PolarHBondContact O-N 3.46Å; R17-C20 PolarHBondContact O-N 3.31Å; R17-L21 WeakPolarHBondContact O-CG 3.2Å; R17-L21 PolarHBondContact O-N 2.93Å
18	A	90.4	Very high	80.1	Confident	58 Å²	58	109.1 Å²	109.1	48%	0.479	57%	0.57	S	S	.	*	H	α-helix	trans	-62.9	-43.7	178.5	0	0	0	0	0	111.5	Q14 I15 L21 L22	Q14-A18 WeakPolarHBondContact O-CB 3.48Å; Q14-A18 PolarHBondContact O-N 2.89Å; I15-A18 PolarHBondContact O-N 3.49Å; A18-L21 PolarHBondContact O-N 2.88Å; A18-L22 WeakPolarHBondContact O-CB 3.27Å; A18-L22 PolarHBondContact O-N 3.39Å
19	L	93.1	Very high	80.6	Confident	97 Å²	97	105.1 Å²	105.1	51%	0.508	55%	0.55	S	S	.	.	H	α-helix	trans	-63.3	-43.4	175.1	-71.4	171.8	0	0	0	111.8	I15 I16 L22 L23	I15-L19 HydrophobicContact CG2-CD1 3.84Å; I15-L19 HydrophobicContact CG2-CG 4.31Å; I15-L19 WeakPolarHBondContact O-CB 3.41Å; I15-L19 VanDerWaalsContact O-CG 3.27Å; I15-L19 WeakPolarHBondContact O-CG 3.4Å; I15-L19 PolarHBondContact O-N 2.95Å; I16-L19 PolarHBondContact O-N 2.85Å; L19-L22 PolarHBondContact O-N 3.36Å; L19-L23 WeakPolarHBondContact O-CB 3.31Å; L19-L23 VanDerWaalsContact O-CG 3.27Å; L19-L23 WeakPolarHBondContact O-CG 3.33Å; L19-L23 PolarHBondContact O-N 2.92Å
20	C	88.2	Confident	80.8	Confident	84 Å²	84	107 Å²	107	57%	0.568	56%	0.555	S	S	*	*	H	α-helix	trans	-60	-46.4	175.5	-116.5	0	0	0	0	111.8	I16 R17 L23 L24	I16-C20 WeakPolarHBondContact O-CB 3.27Å; I16-C20 PolarHBondContact O-N 2.81Å; R17-C20 PolarHBondContact O-N 3.31Å; C20-L23 PolarHBondContact O-N 3.33Å; C20-L24 VanDerWaalsContact O-CB 3.3Å; C20-L24 WeakPolarHBondContact O-CB 3.34Å; C20-L24 PolarHBondContact O-N 3.25Å
21	L	86.6	Confident	80.5	Confident	105 Å²	105	107.6 Å²	107.6	55%	0.55	56%	0.562	S	S	.	*	H	α-helix	trans	-65.1	-42	177.7	-71.8	174.1	0	0	0	111.8	R17 A18 L24 L25	R17-L21 WeakPolarHBondContact O-CG 3.2Å; R17-L21 PolarHBondContact O-N 2.93Å; A18-L21 PolarHBondContact O-N 2.88Å; L21-L24 PolarHBondContact O-N 3.43Å; L21-L25 VanDerWaalsContact O-CB 3.31Å; L21-L25 WeakPolarHBondContact O-CB 3.3Å; L21-L25 VanDerWaalsContact O-CG 3.22Å; L21-L25 WeakPolarHBondContact O-CG 3.22Å; L21-L25 PolarHBondContact O-N 2.82Å
22	L	89.3	Confident	79.7	Confident	115 Å²	115	111.2 Å²	111.2	60%	0.602	57%	0.57	S	S	*	*	H	α-helix	trans	-63.3	-44.1	178.6	-170.4	69.4	0	0	0	111.3	A18 L19 L25 L26	A18-L22 WeakPolarHBondContact O-CB 3.27Å; A18-L22 PolarHBondContact O-N 3.39Å; L19-L22 PolarHBondContact O-N 3.36Å; L22-L25 PolarHBondContact O-N 2.89Å; L22-L26 VanDerWaalsContact O-CB 3.25Å; L22-L26 WeakPolarHBondContact O-CB 3.12Å; L22-L26 PolarHBondContact O-N 2.82Å
23	L	88.4	Confident	78.5	Confident	116 Å²	116	107.2 Å²	107.2	61%	0.607	56%	0.564	S	S	*	*	H	α-helix	trans	-63.7	-42.4	175.1	-72.2	167	0	0	0	111.7	L19 C20 L26 H27	L19-L23 WeakPolarHBondContact O-CB 3.31Å; L19-L23 VanDerWaalsContact O-CG 3.27Å; L19-L23 WeakPolarHBondContact O-CG 3.33Å; L19-L23 PolarHBondContact O-N 2.92Å; C20-L23 PolarHBondContact O-N 3.33Å; L23-L26 PolarHBondContact O-N 2.84Å; L23-H27 WeakPolarHBondContact O-CB 3.34Å; L23-H27 PolarHBondContact O-N 2.99Å
24	L	85	Confident	77.3	Confident	118 Å²	118	103.8 Å²	103.8	62%	0.618	56%	0.559	S	S	*	*	H	α-helix	trans	-64.2	-42.5	176.9	-174.6	65.2	0	0	0	111.7	C20 L21 H27 A28	C20-L24 VanDerWaalsContact O-CB 3.3Å; C20-L24 WeakPolarHBondContact O-CB 3.34Å; C20-L24 PolarHBondContact O-N 3.25Å; L21-L24 PolarHBondContact O-N 3.43Å; L24-H27 PolarHBondContact O-N 2.7Å; L24-A28 VanDerWaalsContact O-CB 3.26Å; L24-A28 WeakPolarHBondContact O-CB 3.1Å; L24-A28 PolarHBondContact O-N 2.86Å
25	L	81.6	Confident	75.7	Confident	120 Å²	120	107.7 Å²	107.7	63%	0.628	57%	0.569	S	S	*	*	H	α-helix	trans	-68.1	-35.3	175.8	-74	170.5	0	0	0	112	L21 L22 G29	L21-L25 VanDerWaalsContact O-CB 3.31Å; L21-L25 WeakPolarHBondContact O-CB 3.3Å; L21-L25 VanDerWaalsContact O-CG 3.22Å; L21-L25 WeakPolarHBondContact O-CG 3.22Å; L21-L25 PolarHBondContact O-N 2.82Å; L22-L25 PolarHBondContact O-N 2.89Å; L25-G29 VanDerWaalsContact O-CA 3.25Å; L25-G29 WeakPolarHBondContact O-CA 3.42Å; L25-G29 PolarHBondContact O-N 3.41Å
26	L	80.6	Confident	74.2	Confident	120 Å²	120	111.2 Å²	111.2	63%	0.628	58%	0.58	S	S	*	*	H	α-helix	trans	-68.1	-42.3	174.8	-172.3	63.3	0	0	0	110.8	L22 L23 G29 S30	L22-L26 VanDerWaalsContact O-CB 3.25Å; L22-L26 WeakPolarHBondContact O-CB 3.12Å; L22-L26 PolarHBondContact O-N 2.82Å; L23-L26 PolarHBondContact O-N 2.84Å; L26-G29 PolarHBondContact O-N 3.49Å; L26-S30 WeakPolarHBondContact O-CB 3.25Å; L26-S30 PolarHBondContact O-N 3.33Å
27	H	73.7	Confident	72.6	Confident	157 Å²	157	116 Å²	116	73%	0.727	59%	0.591	S	S	*	*	H	α-helix	trans	-66.1	-46.7	176	-162.7	97.5	0	0	0	111.8	L23 L24	L23-H27 WeakPolarHBondContact O-CB 3.34Å; L23-H27 PolarHBondContact O-N 2.99Å; L24-H27 PolarHBondContact O-N 2.7Å
28	A	67.4	Low	70.9	Confident	32 Å²	32	109.2 Å²	109.2	26%	0.264	58%	0.576	S	S	.	*	H	α-helix	trans	-68.4	-36.3	176.4	0	0	0	0	0	112.4	L24 K32	L24-A28 VanDerWaalsContact O-CB 3.26Å; L24-A28 WeakPolarHBondContact O-CB 3.1Å; L24-A28 PolarHBondContact O-N 2.86Å; A28-K32 WeakPolarHBondContact O-CB 3.22Å; A28-K32 WeakPolarHBondContact O-CD 3.43Å; A28-K32 WeakPolarHBondContact O-CG 3.26Å; A28-K32 PolarHBondContact O-N 2.83Å
29	G	66.3	Low	69.3	Low	33 Å²	33	111.2 Å²	111.2	34%	0.34	58%	0.578	S	S	.	*	H	α-helix	trans	-73	-32.8	178.8	0	0	0	0	0	113.1	L25 L26 A31 K32 N33	L25-G29 VanDerWaalsContact O-CA 3.25Å; L25-G29 WeakPolarHBondContact O-CA 3.42Å; L25-G29 PolarHBondContact O-N 3.41Å; L26-G29 PolarHBondContact O-N 3.49Å; G29-A31 VanDerWaalsContact C-N 3.33Å; G29-A31 PolarHBondContact O-N 3.47Å; G29-K32 PolarHBondContact O-N 3.21Å; G29-N33 PolarHBondContact O-N 3.33Å
30	S	61.3	Low	67.6	Low	92 Å²	92	110.2 Å²	110.2	64%	0.643	58%	0.577	S	S	*	*	H	α-helix	trans	-59.4	-43.3	174.4	-175.1	0	0	0	0	111.2	L26	L26-S30 WeakPolarHBondContact O-CB 3.25Å; L26-S30 PolarHBondContact O-N 3.33Å
31	A	56.7	Low	66	Low	54 Å²	54	109 Å²	109	45%	0.446	57%	0.573	S	S	.	*	H	α-helix	trans	-82.4	-29.7	175.1	0	0	0	0	0	113.9	G29 N33 I34	G29-A31 VanDerWaalsContact C-N 3.33Å; G29-A31 PolarHBondContact O-N 3.47Å; A31-N33 VanDerWaalsContact C-N 3.25Å; A31-N33 PolarHBondContact O-N 3.23Å; A31-I34 PolarHBondContact O-N 3.33Å
32	K	55.3	Low	64.5	Low	139 Å²	139	113.4 Å²	113.4	60%	0.604	58%	0.582	S	S	*	*	H	α-helix	trans	-72.2	-13.6	-179.7	-79	169.1	-178.9	178.4	0	113.8	A28 G29 I34 W35 K36	A28-K32 WeakPolarHBondContact O-CB 3.22Å; A28-K32 WeakPolarHBondContact O-CD 3.43Å; A28-K32 WeakPolarHBondContact O-CG 3.26Å; A28-K32 PolarHBondContact O-N 2.83Å; G29-K32 PolarHBondContact O-N 3.21Å; K32-I34 VanDerWaalsContact C-N 3.28Å; K32-W35 PolarHBondContact O-N 2.93Å; K32-K36 WeakPolarHBondContact O-CB 3.25Å; K32-K36 PolarHBondContact O-N 3.43Å
33	N	54.7	Low	63	Low	114 Å²	114	113.4 Å²	113.4	61%	0.61	58%	0.582	S	S	*	*	H	α-helix	trans	-70	-26.5	171.2	-132.3	-65.4	0	0	0	112.7	G29 A31 R37	G29-N33 PolarHBondContact O-N 3.33Å; A31-N33 VanDerWaalsContact C-N 3.25Å; A31-N33 PolarHBondContact O-N 3.23Å; N33-R37 PolarHBondContact O-N 2.85Å
34	I	55.4	Low	61.4	Low	120 Å²	120	110.5 Å²	110.5	62%	0.615	58%	0.575	S	S	*	*	H	α-helix	trans	-74.8	-41.7	174.2	-57.6	172	0	0	0	109.9	A31 K32 R37 A38	A31-I34 PolarHBondContact O-N 3.33Å; K32-I34 VanDerWaalsContact C-N 3.28Å; I34-R37 PolarHBondContact O-N 3.14Å; I34-A38 VanDerWaalsContact O-CB 3.26Å; I34-A38 WeakPolarHBondContact O-CB 3.49Å; I34-A38 PolarHBondContact O-N 3.32Å
35	W	51.4	Low	59.8	Low	192 Å²	192	111.8 Å²	111.8	73%	0.727	58%	0.578	S	S	*	*	H	α-helix	trans	-70.3	-35.6	178.5	-71	55.5	0	0	0	111.7	K32 R37 A38 L39	K32-W35 PolarHBondContact O-N 2.93Å; W35-R37 VanDerWaalsContact C-N 3.26Å; W35-R37 PolarHBondContact O-N 3.4Å; W35-A38 PolarHBondContact O-N 3.4Å; W35-L39 WeakPolarHBondContact O-CA 3.23Å; W35-L39 WeakPolarHBondContact O-CB 3.48Å; W35-L39 PolarHBondContact O-N 3.43Å
36	K	54.7	Low	58.5	Low	172 Å²	172	114.1 Å²	114.1	75%	0.748	58%	0.583	S	S	*	*	H	α-helix	trans	-69.5	-21.2	176.1	-140.7	-170.6	-173.8	-159	0	113.5	K32 P40	K32-K36 WeakPolarHBondContact O-CB 3.25Å; K32-K36 PolarHBondContact O-N 3.43Å; K36-P40 WeakPolarHBondContact O-CD 3.26Å; K36-P40 VanDerWaalsContact O-CG 3.23Å; K36-P40 WeakPolarHBondContact O-CG 3.42Å
37	R	54.5	Low	57.1	Low	210 Å²	210	112.5 Å²	112.5	79%	0.792	58%	0.582	S	S	*	*	H	α-helix	trans	-90.9	-34.4	170.9	-99.5	-175.5	165.8	-164.9	-3.2	113.4	N33 I34 W35 P40	N33-R37 PolarHBondContact O-N 2.85Å; I34-R37 PolarHBondContact O-N 3.14Å; W35-R37 VanDerWaalsContact C-N 3.26Å; W35-R37 PolarHBondContact O-N 3.4Å; R37-P40 WeakPolarHBondContact O-CG 2.98Å
38	A	54.4	Low	56.1	Low	46 Å²	46	112.9 Å²	112.9	38%	0.38	58%	0.577	S	S	.	*	H	α-helix	trans	-81.9	-27	179.3	0	0	0	0	0	113.6	I34 W35 R42	I34-A38 VanDerWaalsContact O-CB 3.26Å; I34-A38 WeakPolarHBondContact O-CB 3.49Å; I34-A38 PolarHBondContact O-N 3.32Å; W35-A38 PolarHBondContact O-N 3.4Å; A38-R42 WeakPolarHBondContact O-CG 2.96Å; A38-R42 PolarHBondContact O-N 3.35Å; A38-R42 VanDerWaalsContact O-N 3.14Å
39	L	56.1	Low	55.3	Low	100 Å²	100	115.8 Å²	115.8	52%	0.524	59%	0.591	S	S	.	*	H	α-helix	trans	-71.2	-42.6	179.2	-168	65.2	0	0	0	114.3	W35 A41 R42 L43	W35-L39 WeakPolarHBondContact O-CA 3.23Å; W35-L39 WeakPolarHBondContact O-CB 3.48Å; W35-L39 PolarHBondContact O-N 3.43Å; L39-A41 VanDerWaalsContact C-N 3.28Å; L39-A41 PolarHBondContact O-N 2.98Å; L39-R42 PolarHBondContact O-N 3.33Å; L39-L43 HydrophobicContact CG-CD1 4.2Å; L39-L43 PolarHBondContact O-N 2.81Å
40	P	57.6	Low	54.6	Low	75 Å²	75	119 Å²	119	49%	0.487	61%	0.608	S	S	.	*	H	α-helix	trans	-64.9	-33.4	173.9	23.3	-32	0	0	0	112.1	K36 R37 A44	K36-P40 WeakPolarHBondContact O-CD 3.26Å; K36-P40 VanDerWaalsContact O-CG 3.23Å; K36-P40 WeakPolarHBondContact O-CG 3.42Å; R37-P40 WeakPolarHBondContact O-CG 2.98Å; P40-A44 WeakPolarHBondContact O-CB 3.33Å; P40-A44 PolarHBondContact O-N 3.16Å
41	A	54.9	Low	54.1	Low	60 Å²	60	118 Å²	118	50%	0.496	61%	0.606	S	S	.	*	H	α-helix	trans	-65	-42.7	175.1	0	0	0	0	0	111.9	L39 E45	L39-A41 VanDerWaalsContact C-N 3.28Å; L39-A41 PolarHBondContact O-N 2.98Å; A41-E45 PolarHBondContact O-N 2.99Å; A41-E45 VanDerWaalsContact O-N 3.16Å
42	R	56.2	Low	53.7	Low	197 Å²	197	125.1 Å²	125.1	74%	0.743	62%	0.621	S	S	*	*	H	α-helix	trans	-75.6	-25.7	178.8	-68.6	-176.7	70.2	-163.5	1.6	114.3	A38 L39	A38-R42 WeakPolarHBondContact O-CG 2.96Å; A38-R42 PolarHBondContact O-N 3.35Å; A38-R42 VanDerWaalsContact O-N 3.14Å; L39-R42 PolarHBondContact O-N 3.33Å
43	L	56.8	Low	53.3	Low	114 Å²	114	125.2 Å²	125.2	60%	0.597	63%	0.628	S	S	*	*	H	α-helix	trans	-77.9	-36.5	172.7	-88.6	163.4	0	0	0	112.3	L39 K46 S47	L39-L43 HydrophobicContact CG-CD1 4.2Å; L39-L43 PolarHBondContact O-N 2.81Å; L43-K46 PolarHBondContact O-N 3.38Å; L43-S47 PolarHBondContact O-N 3.39Å; L43-S47 VanDerWaalsContact O-N 3.12Å
44	A	55.3	Low	53	Low	55 Å²	55	123.1 Å²	123.1	46%	0.455	63%	0.634	S	S	.	*	H	α-helix	trans	-65.7	-38.3	173.9	0	0	0	0	0	112	P40 K46 S47 R48	P40-A44 WeakPolarHBondContact O-CB 3.33Å; P40-A44 PolarHBondContact O-N 3.16Å; A44-K46 VanDerWaalsContact C-N 3.3Å; A44-K46 PolarHBondContact O-N 3.12Å; A44-S47 PolarHBondContact O-N 3.35Å; A44-R48 WeakPolarHBondContact O-CG 3.41Å; A44-R48 PolarHBondContact O-N 3.37Å
45	E	52	Low	52.7	Low	146 Å²	146	125.6 Å²	125.6	68%	0.682	64%	0.643	S	S	*	*	H	α-helix	trans	-60.1	-38.7	175	-159.9	86.5	171.9	0	0	112	A41	A41-E45 PolarHBondContact O-N 2.99Å; A41-E45 VanDerWaalsContact O-N 3.16Å
46	K	52.5	Low	52.5	Low	168 Å²	168	121 Å²	121	73%	0.73	65%	0.645	S	S	*	*	H	α-helix	trans	-83.7	-19.7	-177.6	-161	170.2	176	-160.3	0	113.9	L43 A44	L43-K46 PolarHBondContact O-N 3.38Å; A44-K46 VanDerWaalsContact C-N 3.3Å; A44-K46 PolarHBondContact O-N 3.12Å
47	S	52.8	Low	52.1	Low	86 Å²	86	116.2 Å²	116.2	60%	0.601	65%	0.646	S	S	*	*	H	α-helix	trans	-80.7	-22.6	174	-170.2	0	0	0	0	113.1	L43 A44 V49	L43-S47 PolarHBondContact O-N 3.39Å; L43-S47 VanDerWaalsContact O-N 3.12Å; A44-S47 PolarHBondContact O-N 3.35Å; S47-V49 VanDerWaalsContact C-N 3.31Å
48	R	51.8	Low	51.7	Low	166 Å²	166	110.8 Å²	110.8	63%	0.626	65%	0.646	S	S	*	*	S	Bend	trans	-75.1	-20.6	178.9	-70.1	174.9	68.7	96.2	4	113.4	A44	A44-R48 WeakPolarHBondContact O-CG 3.41Å; A44-R48 PolarHBondContact O-N 3.37Å
49	V	51.4	Low	51.3	Low	92 Å²	92	113.1 Å²	113.1	56%	0.558	67%	0.665	S	S	*	*	G	3₁₀ helix	trans	-72.5	-28	178.1	168	0	0	0	0	112.1	S47	S47-V49 VanDerWaalsContact C-N 3.31Å
50	S	51.7	Low	50.7	Low	101 Å²	101	114 Å²	114	71%	0.706	68%	0.678	S	S	*	*	G	3₁₀ helix	trans	-86.1	-6.9	179	-60.4	0	0	0	0	114.8
51	A	50.5	Low	50.4	Low	72 Å²	72	117.4 Å²	117.4	60%	0.595	70%	0.697	S	S	*	*	G	3₁₀ helix	trans	-94.5	-11.8	176	0	0	0	0	0	113.2
52	W	46.6	Very low	49.8	Very low	203 Å²	203	117.8 Å²	117.8	77%	0.769	71%	0.707	S	S	*	*	T	Hydrogen-bonded Turn	trans	-102.5	-15.6	179.7	-78.8	1.5	0	0	0	114.1	G54	W52-G54 PolarHBondContact O-N 3.33Å
53	D	47.4	Very low	49.5	Very low	140 Å²	140	112.6 Å²	112.6	75%	0.749	72%	0.715	S	S	*	*	T	Hydrogen-bonded Turn	trans	-78.3	0.5	171.8	-78.4	-45.8	0	0	0	113.7
54	G	49.8	Very low	49.1	Very low	71 Å²	71	112.9 Å²	112.9	73%	0.732	73%	0.726	S	S	*	*	T	Hydrogen-bonded Turn	trans	-100.2	-10.2	178.3	0	0	0	0	0	115.8	W52	W52-G54 PolarHBondContact O-N 3.33Å
55	E	49.3	Very low	48.2	Very low	171 Å²	171	118.6 Å²	118.6	80%	0.799	74%	0.744	S	S	*	*	S	Bend	trans	-120.4	23.1	-172.4	-153.7	-139.5	108.6	0	0	113.8
56	A	47	Very low	48.4	Very low	95 Å²	95	120.6 Å²	120.6	79%	0.785	77%	0.769	S	S	*	*	S	Bend	trans	-109.1	6.7	172.9	0	0	0	0	0	113.6
57	G	45.9	Very low	48.2	Very low	73 Å²	73	118.3 Å²	118.3	75%	0.753	77%	0.771	S	S	*	*	S	Bend	trans	-109.6	-9.5	-175.5	0	0	0	0	0	116.6
58	A	44.8	Very low	48	Very low	96 Å²	96	119.9 Å²	119.9	79%	0.793	78%	0.78	S	S	*	*	S	Bend	trans	-105.2	1.7	-172.7	0	0	0	0	0	114.9
59	A	47.5	Very low	47.8	Very low	94 Å²	94	117.4 Å²	117.4	78%	0.777	79%	0.789	S	S	*	*	S	Bend	trans	-95.7	9.1	-177.1	0	0	0	0	0	114.5
60	C	43.5	Very low	47.6	Very low	120 Å²	120	118.9 Å²	118.9	81%	0.811	80%	0.802	S	S	*	*			trans	-134.6	57.3	-179.9	-59.9	0	0	0	0	112.3
61	V	50.2	Low	47.3	Very low	145 Å²	145	120 Å²	120	88%	0.879	81%	0.808	S	S	*	*	S	Bend	trans	-118.4	103.2	155.8	172.4	0	0	0	0	108.4
62	G	43.7	Very low	47.1	Very low	69 Å²	69	123.2 Å²	123.2	71%	0.711	82%	0.822	S	S	*	*			trans	84.2	73	141.3	0	0	0	0	0	116.6	S64	G62-S64 PolarHBondContact O-N 3.35Å
63	G	50.1	Low	47.1	Very low	87 Å²	87	117.5 Å²	117.5	90%	0.897	83%	0.826	S	S	*	*			trans	-65.1	113.6	135.1	0	0	0	0	0	108.3
64	S	48.1	Very low	47.1	Very low	120 Å²	120	115.8 Å²	115.8	84%	0.839	83%	0.832	S	S	*	*			trans	-144.5	96.1	154.6	-122.1	0	0	0	0	107.8	G62	G62-S64 PolarHBondContact O-N 3.35Å
65	Q	36.4	Very low	46.9	Very low	176 Å²	176	119.5 Å²	119.5	82%	0.822	84%	0.841	S	S	*	*			trans	-62.2	163.7	143	-112.9	179.8	-89.3	0	0	108.6
66	P	56.2	Low	46.7	Very low	188 Å²	188	114.8 Å²	114.8	100%	1.221	84%	0.844	S	S	*	*			cis	-98.5	0	24.8	36	-34	0	0	0	116.3

Retrieved 66 of 66 residues in 25.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).