A0A087WY98_HUMAN Loading...

Cyclin Q

AlphaFold DB , UniProt , Accession A0A087WY98, Species HUMAN (Homo sapiens, Human), Gene CCNQ, Length 39 aa.

						>A0A087WY98_HUMAN|A0A087WY98|CCNQ
MEAPEGGGGGPAARGPEGQPAPEARVHFRVARFIMEAGG
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	41.4	Very low	52.7	Low	224 Å²	224	118.6 Å²	118.6	100%	1.103	82%	0.819	S	S	*	*				0	104.7	0	-169.3	138.5	179.7	0	0	106.7
2	E	47.7	Very low	52.7	Low	173 Å²	173	115.3 Å²	115.3	81%	0.808	80%	0.804	S	S	*	*			trans	41.6	97.4	160.7	-53.7	-175.5	103.7	0	0	118.3
3	A	52.2	Low	53	Low	88 Å²	88	114.9 Å²	114.9	73%	0.727	81%	0.813	S	S	*	*			trans	-78.5	134.1	151.6	0	0	0	0	0	107.7	E5	A3-E5 PolarHBondContact O-N 2.91Å
4	P	57.3	Low	53.4	Low	124 Å²	124	119.4 Å²	119.4	81%	0.805	80%	0.803	S	S	*	*			trans	-65	133.9	-179.1	25.7	-32.4	0	0	0	109.9	G6	P4-G6 PolarHBondContact O-N 3.13Å
5	E	56.3	Low	53.7	Low	196 Å²	196	114.3 Å²	114.3	92%	0.916	78%	0.778	S	S	*	*			trans	-56.4	77.8	174.3	-65.3	-87.2	85.6	0	0	110.6	A3 G7	A3-E5 PolarHBondContact O-N 2.91Å; E5-G7 VanDerWaalsContact O-N 3.16Å; E5-G7 PolarHBondContact O-N 3.21Å
6	G	56.6	Low	54.2	Low	78 Å²	78	114.4 Å²	114.4	80%	0.804	78%	0.777	S	S	*	*			trans	-85.1	60.1	172.3	0	0	0	0	0	110.4	P4 G8	P4-G6 PolarHBondContact O-N 3.13Å; G6-G8 VanDerWaalsContact C-N 3.29Å; G6-G8 PolarHBondContact O-N 3.17Å
7	G	51.9	Low	54.3	Low	76 Å²	76	118.5 Å²	118.5	78%	0.784	78%	0.782	S	S	*	*			trans	-88.8	53.5	178.9	0	0	0	0	0	112.9	E5 G9	E5-G7 VanDerWaalsContact O-N 3.16Å; E5-G7 PolarHBondContact O-N 3.21Å; G7-G9 VanDerWaalsContact C-N 3.29Å; G7-G9 PolarHBondContact O-N 3.48Å
8	G	56.3	Low	54.9	Low	85 Å²	85	112.6 Å²	112.6	88%	0.876	75%	0.746	S	S	*	*			trans	-66.6	86.3	170.4	0	0	0	0	0	110.7	G6	G6-G8 VanDerWaalsContact C-N 3.29Å; G6-G8 PolarHBondContact O-N 3.17Å
9	G	52	Low	55.8	Low	65 Å²	65	112.2 Å²	112.2	67%	0.67	73%	0.732	S	S	*	*			trans	-118	78.4	177.7	0	0	0	0	0	111.4	G7	G7-G9 VanDerWaalsContact C-N 3.29Å; G7-G9 PolarHBondContact O-N 3.48Å
10	G	55.3	Low	56.7	Low	63 Å²	63	110.2 Å²	110.2	65%	0.649	72%	0.719	S	S	*	*	S	Bend	trans	-52.2	157.7	153.4	0	0	0	0	0	109.8	A12	G10-A12 VanDerWaalsContact C-N 3.35Å; G10-A12 PolarHBondContact O-N 2.92Å
11	P	52.9	Low	58	Low	133 Å²	133	107.7 Å²	107.7	86%	0.864	71%	0.708	S	S	*	*			trans	-52.9	95.7	-148.4	27.5	-35.4	0	0	0	110.9	A13	P11-A13 PolarHBondContact O-N 3.22Å
12	A	52.3	Low	60	Low	78 Å²	78	101.2 Å²	101.2	65%	0.645	68%	0.682	S	S	*	*			trans	-58.4	118.9	162.7	0	0	0	0	0	103.9	G10 R14	G10-A12 VanDerWaalsContact C-N 3.35Å; G10-A12 PolarHBondContact O-N 2.92Å; A12-R14 PolarHBondContact O-N 3.4Å
13	A	57.2	Low	61.8	Low	111 Å²	111	98.8 Å²	98.8	92%	0.917	67%	0.671	S	S	*	*			trans	-66.1	65.2	168.9	0	0	0	0	0	108	P11 G15	P11-A13 PolarHBondContact O-N 3.22Å; A13-G15 PolarHBondContact O-N 3.47Å
14	R	58.2	Low	63.4	Low	178 Å²	178	96.8 Å²	96.8	67%	0.672	65%	0.654	S	S	*	*			trans	-74.7	123	174.1	-148.1	-172.8	156.6	-172.2	2.4	102.4	A12 G18	A12-R14 PolarHBondContact O-N 3.4Å; R14-G18 VanDerWaalsContact CB-CA 3.42Å; R14-G18 WeakPolarHBondContact CD-O 3.5Å
15	G	58.6	Low	64.9	Low	42 Å²	42	95 Å²	95	43%	0.433	63%	0.632	S	S	.	*			trans	-55	-168	-174.8	0	0	0	0	0	113.3	A13 E17 G18 Q19	A13-G15 PolarHBondContact O-N 3.47Å; G15-E17 PolarHBondContact O-N 2.96Å; G15-G18 WeakPolarHBondContact O-CA 3.38Å; G15-G18 PolarHBondContact O-N 3.16Å; G15-Q19 PolarHBondContact O-N 2.73Å; G15-Q19 VanDerWaalsContact O-N 3.16Å
16	P	60.5	Low	66.6	Low	116 Å²	116	89.1 Å²	89.1	75%	0.753	61%	0.609	S	S	*	*	T	Hydrogen-bonded Turn	trans	-51.7	-29.7	179.3	20.4	-31.3	0	0	0	113.9	G18	P16-G18 VanDerWaalsContact C-N 3.25Å; P16-G18 PolarHBondContact O-N 2.97Å
17	E	56.6	Low	68.4	Low	184 Å²	184	91.8 Å²	91.8	86%	0.86	60%	0.6	S	S	*	*	T	Hydrogen-bonded Turn	trans	-74.5	-10.8	174.3	-66.4	163	81.6	0	0	114.9	G15	G15-E17 PolarHBondContact O-N 2.96Å
18	G	65.3	Low	70.3	Confident	13 Å²	13	94.9 Å²	94.9	13%	0.134	59%	0.592	C	S	.	*	T	Hydrogen-bonded Turn	trans	-111.3	-14.7	-174.7	0	0	0	0	0	115.9	R14 G15 P16	R14-G18 VanDerWaalsContact CB-CA 3.42Å; R14-G18 WeakPolarHBondContact CD-O 3.5Å; G15-G18 WeakPolarHBondContact O-CA 3.38Å; G15-G18 PolarHBondContact O-N 3.16Å; P16-G18 VanDerWaalsContact C-N 3.25Å; P16-G18 PolarHBondContact O-N 2.97Å
19	Q	72.6	Confident	72	Confident	104 Å²	104	98.5 Å²	98.5	49%	0.486	58%	0.579	S	S	.	*	S	Bend	trans	-75.5	124.5	172.8	-104	-167	101.3	0	0	108	G15 A21 R25	G15-Q19 PolarHBondContact O-N 2.73Å; G15-Q19 VanDerWaalsContact O-N 3.16Å; Q19-A21 PolarHBondContact O-N 3.23Å; Q19-R25 VanDerWaalsContact CB-NH2 3.28Å
20	P	72.6	Confident	74	Confident	73 Å²	73	99.1 Å²	99.1	47%	0.474	57%	0.57	S	S	.	*	P	Polyproline II helix	trans	-52.3	145.9	179.2	-16.8	22.2	0	0	0	110.2	A24 R25	P20-A24 HydrophobicContact CB-CB 3.93Å; P20-R25 PolarHBondContact O-NH2 2.65Å; P20-R25 HydrophobicContact CG-CG 4.43Å; P20-R25 PolarHBondContact O-NE 2.96Å; P20-R25 HydrophobicContact CB-CG 4.05Å; P20-R25 VanDerWaalsContact O-CZ 3.22Å
21	A	84.4	Confident	75.8	Confident	58 Å²	58	98.3 Å²	98.3	48%	0.479	56%	0.557	S	S	.	*	P	Polyproline II helix	trans	-49.9	146	172.6	0	0	0	0	0	110	Q19 E23 A24 R25	Q19-A21 PolarHBondContact O-N 3.23Å; A21-E23 PolarHBondContact O-N 3.15Å; A21-E23 VanDerWaalsContact O-N 3.13Å; A21-A24 HydrophobicContact CB-CB 4.49Å; A21-A24 WeakPolarHBondContact O-CA 3.35Å; A21-A24 WeakPolarHBondContact O-CB 3.28Å; A21-A24 PolarHBondContact O-N 2.76Å; A21-R25 PolarHBondContact O-N 3.5Å
22	P	83.6	Confident	77.7	Confident	87 Å²	87	98.9 Å²	98.9	57%	0.565	54%	0.542	S	S	*	.	H	α-helix	trans	-47.9	-43.1	-179.4	-28.5	35.7	0	0	0	113.1	A24 R25 V26	P22-A24 PolarHBondContact O-N 3.02Å; P22-R25 PolarHBondContact O-N 2.94Å; P22-R25 VanDerWaalsContact O-N 3.17Å; P22-R25 WeakPolarHBondContact O-CB 3.41Å; P22-V26 PolarHBondContact O-N 2.92Å
23	E	85.7	Confident	79.7	Confident	123 Å²	123	102.1 Å²	102.1	58%	0.575	54%	0.542	S	S	*	.	H	α-helix	trans	-58.4	-46.5	175.5	-75.5	64.7	-147.6	0	0	111.8	A21 R25 V26 H27	A21-E23 PolarHBondContact O-N 3.15Å; A21-E23 VanDerWaalsContact O-N 3.13Å; E23-R25 PolarHBondContact O-N 2.95Å; E23-V26 WeakPolarHBondContact O-CA 3.45Å; E23-V26 WeakPolarHBondContact O-CB 3.34Å; E23-V26 PolarHBondContact O-N 3Å; E23-H27 PolarHBondContact O-CD2 3.42Å; E23-H27 PolarHBondContact O-N 3Å
24	A	86.4	Confident	81.3	Confident	46 Å²	46	102 Å²	102	38%	0.38	53%	0.525	S	S	.	.	H	α-helix	trans	-60.8	-32.2	178.9	0	0	0	0	0	112	P20 A21 P22 V26 F28	P20-A24 HydrophobicContact CB-CB 3.93Å; A21-A24 HydrophobicContact CB-CB 4.49Å; A21-A24 WeakPolarHBondContact O-CA 3.35Å; A21-A24 WeakPolarHBondContact O-CB 3.28Å; A21-A24 PolarHBondContact O-N 2.76Å; P22-A24 PolarHBondContact O-N 3.02Å; A24-V26 VanDerWaalsContact C-N 3.35Å; A24-F28 PolarHBondContact O-N 3.33Å; A24-F28 WeakPolarHBondContact O-CB 3.46Å
25	R	86.8	Confident	82.9	Confident	87 Å²	87	100.6 Å²	100.6	33%	0.328	53%	0.528	S	S	.	.	H	α-helix	trans	-72.4	-29.2	174.7	-54.1	177.5	-155.1	-148.7	13.9	112.4	Q19 P20 A21 P22 E23 R29	Q19-R25 VanDerWaalsContact CB-NH2 3.28Å; P20-R25 PolarHBondContact O-NH2 2.65Å; P20-R25 HydrophobicContact CG-CG 4.43Å; P20-R25 PolarHBondContact O-NE 2.96Å; P20-R25 HydrophobicContact CB-CG 4.05Å; P20-R25 VanDerWaalsContact O-CZ 3.22Å; A21-R25 PolarHBondContact O-N 3.5Å; P22-R25 PolarHBondContact O-N 2.94Å; P22-R25 VanDerWaalsContact O-N 3.17Å; P22-R25 WeakPolarHBondContact O-CB 3.41Å; E23-R25 PolarHBondContact O-N 2.95Å; R25-R29 WeakPolarHBondContact O-CB 3.34Å; R25-R29 PolarHBondContact O-NE 2.84Å; R25-R29 PolarHBondContact O-N 3.22Å; R25-R29 VanDerWaalsContact O-CG 3.28Å; R25-R29 WeakPolarHBondContact O-CG 3.37Å
26	V	93.1	Very high	84.3	Confident	71 Å²	71	105.2 Å²	105.2	43%	0.43	54%	0.538	S	S	.	.	H	α-helix	trans	-70.5	-50.4	173	176.5	0	0	0	0	109.3	P22 E23 A24 F28 R29 V30	P22-V26 PolarHBondContact O-N 2.92Å; E23-V26 WeakPolarHBondContact O-CA 3.45Å; E23-V26 WeakPolarHBondContact O-CB 3.34Å; E23-V26 PolarHBondContact O-N 3Å; A24-V26 VanDerWaalsContact C-N 3.35Å; V26-F28 VanDerWaalsContact C-N 3.3Å; V26-F28 PolarHBondContact O-N 3.05Å; V26-R29 PolarHBondContact O-N 2.91Å; V26-R29 VanDerWaalsContact O-N 3.15Å; V26-V30 HydrophobicContact CG1-CG2 4.25Å; V26-V30 WeakPolarHBondContact O-CG2 3.35Å; V26-V30 PolarHBondContact O-N 3.41Å
27	H	93.9	Very high	85.6	Confident	134 Å²	134	102.7 Å²	102.7	62%	0.62	53%	0.527	S	S	*	.	H	α-helix	trans	-56.9	-43.8	177.6	-67.7	-65.4	0	0	0	112.1	E23 V30 A31	E23-H27 PolarHBondContact O-CD2 3.42Å; E23-H27 PolarHBondContact O-N 3Å; H27-V30 PolarHBondContact O-N 3.3Å; H27-A31 WeakPolarHBondContact O-CB 3.31Å; H27-A31 PolarHBondContact O-N 3.31Å; H27-A31 VanDerWaalsContact O-CB 3.31Å
28	F	91.3	Very high	86.5	Confident	142 Å²	142	97.2 Å²	97.2	62%	0.623	52%	0.52	S	S	*	.	H	α-helix	trans	-60.7	-46.3	176.5	-177.6	-96.8	0	0	0	112.7	A24 V26 R32	A24-F28 PolarHBondContact O-N 3.33Å; A24-F28 WeakPolarHBondContact O-CB 3.46Å; V26-F28 VanDerWaalsContact C-N 3.3Å; V26-F28 PolarHBondContact O-N 3.05Å; F28-R32 WeakPolarHBondContact O-CB 3.44Å; F28-R32 PolarHBondContact O-N 3Å
29	R	92.9	Very high	86	Confident	160 Å²	160	103.2 Å²	103.2	60%	0.604	58%	0.581	S	S	*	*	H	α-helix	trans	-65.1	-41	179	-76.5	-179.8	-72.3	173.3	-0.6	112.2	R25 V26 F33	R25-R29 WeakPolarHBondContact O-CB 3.34Å; R25-R29 PolarHBondContact O-NE 2.84Å; R25-R29 PolarHBondContact O-N 3.22Å; R25-R29 VanDerWaalsContact O-CG 3.28Å; R25-R29 WeakPolarHBondContact O-CG 3.37Å; V26-R29 PolarHBondContact O-N 2.91Å; V26-R29 VanDerWaalsContact O-N 3.15Å; R29-F33 WeakPolarHBondContact O-CB 3.44Å; R29-F33 PolarHBondContact O-N 2.73Å
30	V	93.8	Very high	86.7	Confident	78 Å²	78	103.2 Å²	103.2	47%	0.473	59%	0.586	S	S	.	*	H	α-helix	trans	-66.6	-47.2	177.8	172.4	0	0	0	0	111.1	V26 H27 R32 F33 I34	V26-V30 HydrophobicContact CG1-CG2 4.25Å; V26-V30 WeakPolarHBondContact O-CG2 3.35Å; V26-V30 PolarHBondContact O-N 3.41Å; H27-V30 PolarHBondContact O-N 3.3Å; V30-R32 VanDerWaalsContact C-N 3.32Å; V30-R32 PolarHBondContact O-N 3.47Å; V30-F33 PolarHBondContact O-N 3.13Å; V30-I34 PolarHBondContact O-N 3.2Å; V30-I34 WeakPolarHBondContact O-CG1 3.37Å; V30-I34 HydrophobicContact CG1-CD1 3.79Å
31	A	93.5	Very high	87.4	Confident	47 Å²	47	104.7 Å²	104.7	39%	0.388	59%	0.592	S	S	.	*	H	α-helix	trans	-59.6	-44.4	177.7	0	0	0	0	0	111.4	H27 F33 I34 M35	H27-A31 WeakPolarHBondContact O-CB 3.31Å; H27-A31 PolarHBondContact O-N 3.31Å; H27-A31 VanDerWaalsContact O-CB 3.31Å; A31-F33 PolarHBondContact O-N 3.47Å; A31-I34 PolarHBondContact O-N 2.96Å; A31-M35 HydrophobicContact CB-CE 4.49Å; A31-M35 WeakPolarHBondContact O-CE 3.42Å; A31-M35 WeakPolarHBondContact O-CG 3.17Å; A31-M35 PolarHBondContact O-N 2.7Å
32	R	92.9	Very high	87.6	Confident	145 Å²	145	107.3 Å²	107.3	55%	0.547	60%	0.598	S	S	.	*	H	α-helix	trans	-58	-48	175	-176.6	-175.8	178.8	114.6	2	111.7	F28 V30 I34 M35 E36	F28-R32 WeakPolarHBondContact O-CB 3.44Å; F28-R32 PolarHBondContact O-N 3Å; V30-R32 VanDerWaalsContact C-N 3.32Å; V30-R32 PolarHBondContact O-N 3.47Å; R32-I34 VanDerWaalsContact C-N 3.33Å; R32-I34 PolarHBondContact O-N 2.89Å; R32-M35 PolarHBondContact O-N 3.43Å; R32-E36 WeakPolarHBondContact O-CB 3.37Å; R32-E36 PolarHBondContact O-N 3.05Å; R32-E36 VanDerWaalsContact O-CB 3.31Å; R32-E36 IonicContact NE-OE2 3.54Å
33	F	93.1	Very high	87.9	Confident	146 Å²	146	108.5 Å²	108.5	64%	0.64	60%	0.6	S	S	*	*	H	α-helix	trans	-59.6	-43.8	179.9	-179.3	-96.1	0	0	0	112.1	R29 V30 A31 E36 A37	R29-F33 WeakPolarHBondContact O-CB 3.44Å; R29-F33 PolarHBondContact O-N 2.73Å; V30-F33 PolarHBondContact O-N 3.13Å; A31-F33 PolarHBondContact O-N 3.47Å; F33-E36 PolarHBondContact O-N 3.43Å; F33-A37 HydrophobicContact CE1-CB 4.23Å; F33-A37 HydrophobicContact CZ-CB 4.3Å; F33-A37 WeakPolarHBondContact O-CB 3.31Å; F33-A37 PolarHBondContact O-N 3.35Å
34	I	92	Very high	88	Confident	109 Å²	109	107.6 Å²	107.6	56%	0.559	60%	0.602	S	S	*	*	H	α-helix	trans	-64	-43.3	179.1	-66.6	164.8	0	0	0	111.2	V30 A31 R32 E36 G38	V30-I34 PolarHBondContact O-N 3.2Å; V30-I34 WeakPolarHBondContact O-CG1 3.37Å; V30-I34 HydrophobicContact CG1-CD1 3.79Å; A31-I34 PolarHBondContact O-N 2.96Å; R32-I34 VanDerWaalsContact C-N 3.33Å; R32-I34 PolarHBondContact O-N 2.89Å; I34-E36 VanDerWaalsContact C-N 3.31Å; I34-E36 PolarHBondContact O-N 3.23Å; I34-G38 PolarHBondContact O-N 3.16Å; I34-G38 VanDerWaalsContact O-N 3.13Å
35	M	90.7	Very high	88.1	Confident	148 Å²	148	111.7 Å²	111.7	73%	0.729	62%	0.617	S	S	*	*	H	α-helix	trans	-65.9	-34.1	177.6	-70.3	-175.6	-67.7	0	0	112.6	A31 R32	A31-M35 HydrophobicContact CB-CE 4.49Å; A31-M35 WeakPolarHBondContact O-CE 3.42Å; A31-M35 WeakPolarHBondContact O-CG 3.17Å; A31-M35 PolarHBondContact O-N 2.7Å; R32-M35 PolarHBondContact O-N 3.43Å
36	E	89.6	Confident	88.2	Confident	138 Å²	138	113.5 Å²	113.5	65%	0.645	64%	0.637	S	S	*	*	H	α-helix	trans	-82.5	-33	-178.3	-168.7	171.4	162.7	0	0	112.6	R32 F33 I34	R32-E36 WeakPolarHBondContact O-CB 3.37Å; R32-E36 PolarHBondContact O-N 3.05Å; R32-E36 VanDerWaalsContact O-CB 3.31Å; R32-E36 IonicContact NE-OE2 3.54Å; F33-E36 PolarHBondContact O-N 3.43Å; I34-E36 VanDerWaalsContact C-N 3.31Å; I34-E36 PolarHBondContact O-N 3.23Å
37	A	87.1	Confident	87.8	Confident	64 Å²	64	116.8 Å²	116.8	53%	0.529	65%	0.653	S	S	.	*	H	α-helix	trans	-87.8	-14	-178.9	0	0	0	0	0	114.2	F33 G39	F33-A37 HydrophobicContact CE1-CB 4.23Å; F33-A37 HydrophobicContact CZ-CB 4.3Å; F33-A37 WeakPolarHBondContact O-CB 3.31Å; F33-A37 PolarHBondContact O-N 3.35Å; A37-G39 VanDerWaalsContact C-N 3.29Å
38	G	74.8	Confident	87.3	Confident	69 Å²	69	115.3 Å²	115.3	71%	0.711	66%	0.656	S	S	*	*	T	Hydrogen-bonded Turn	trans	-86.5	10.5	178.6	0	0	0	0	0	115.1	I34	I34-G38 PolarHBondContact O-N 3.16Å; I34-G38 VanDerWaalsContact O-N 3.13Å
39	G	56.1	Low	86.9	Confident	138 Å²	138	112.9 Å²	112.9	100%	1.423	66%	0.659	S	S	*	*			trans	-83	0	176.3	0	0	0	0	0	113.6	A37	A37-G39 VanDerWaalsContact C-N 3.29Å

Retrieved 39 of 39 residues in 20.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).