A0A087WYL8_HUMAN Loading...

ALG11 alpha-1,2-mannosyltransferase

AlphaFold DB , UniProt , Accession A0A087WYL8, Species HUMAN (Homo sapiens, Human), Gene ALG11, Length 30 aa.

						>A0A087WYL8_HUMAN|A0A087WYL8|ALG11
MAAGERSWCLCKLLSFEYVFISSVKMNLVP
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	53.5	Low	73.9	Confident	246 Å²	246	119.4 Å²	119.4	100%	1.212	66%	0.661	S	S	*	*				0	94.2	0	-143.7	140.5	168	0	0	106.6
2	A	61.3	Low	75.3	Confident	77 Å²	77	120.7 Å²	120.7	64%	0.636	66%	0.655	S	S	*	*			trans	-159.9	-15.2	-172.3	0	0	0	0	0	113.9
3	A	62.1	Low	76.6	Confident	84 Å²	84	119.2 Å²	119.2	69%	0.694	65%	0.646	S	S	*	*	H	α-helix	trans	-78.8	-32.6	178.4	0	0	0	0	0	113.4	S7	A3-S7 VanDerWaalsContact O-N 3.11Å; A3-S7 PolarHBondContact O-N 3.19Å
4	G	66.3	Low	77.6	Confident	55 Å²	55	118.7 Å²	118.7	57%	0.567	64%	0.641	S	S	*	*	H	α-helix	trans	-66.6	-44.2	-176.5	0	0	0	0	0	113.7	R6 S7 W8	G4-R6 PolarHBondContact O-N 2.73Å; G4-R6 VanDerWaalsContact C-N 3.34Å; G4-S7 PolarHBondContact O-N 3.08Å; G4-W8 PolarHBondContact O-N 2.87Å
5	E	71.1	Confident	78.5	Confident	157 Å²	157	115.9 Å²	115.9	73%	0.734	63%	0.634	S	S	*	*	H	α-helix	trans	-65.9	-37.2	179.3	-69.3	-177.1	92.2	0	0	112.4	W8 C9	E5-W8 PolarHBondContact O-N 3.43Å; E5-C9 PolarHBondContact O-N 3.48Å
6	R	72.4	Confident	79.3	Confident	196 Å²	196	118.1 Å²	118.1	74%	0.74	64%	0.636	S	S	*	*	H	α-helix	trans	-69.1	-39.3	178	-155.9	172	-179.8	133.9	-1.8	111.6	G4 L10	G4-R6 PolarHBondContact O-N 2.73Å; G4-R6 VanDerWaalsContact C-N 3.34Å; R6-L10 VanDerWaalsContact O-CG 3.31Å; R6-L10 WeakPolarHBondContact O-CG 3.31Å; R6-L10 PolarHBondContact O-N 3.35Å; R6-L10 VanDerWaalsContact O-N 3.14Å
7	S	80.6	Confident	79.9	Confident	65 Å²	65	117.4 Å²	117.4	46%	0.455	63%	0.628	S	S	.	*	H	α-helix	trans	-64.5	-40.8	173.4	-178.9	0	0	0	0	111.7	A3 G4 L10 C11	A3-S7 VanDerWaalsContact O-N 3.11Å; A3-S7 PolarHBondContact O-N 3.19Å; G4-S7 PolarHBondContact O-N 3.08Å; S7-L10 PolarHBondContact O-N 3.5Å; S7-C11 PolarHBondContact O-SG 2.98Å; S7-C11 PolarHBondContact O-N 3.29Å; S7-C11 WeakPolarHBondContact O-CB 3.31Å
8	W	83.7	Confident	80.5	Confident	181 Å²	181	120.2 Å²	120.2	69%	0.686	63%	0.629	S	S	*	*	H	α-helix	trans	-66.8	-40.4	179.8	-146.4	62.9	0	0	0	112.7	G4 E5 C11 K12	G4-W8 PolarHBondContact O-N 2.87Å; E5-W8 PolarHBondContact O-N 3.43Å; W8-C11 PolarHBondContact O-N 2.92Å; W8-K12 PolarHBondContact O-N 3.16Å
9	C	85.9	Confident	81	Confident	82 Å²	82	118.3 Å²	118.3	55%	0.554	62%	0.623	S	S	*	*	H	α-helix	trans	-63.4	-43.2	175.2	-163.7	0	0	0	0	111.7	E5 K12 L13	E5-C9 PolarHBondContact O-N 3.48Å; C9-K12 WeakPolarHBondContact O-CB 3.2Å; C9-K12 PolarHBondContact O-N 3.45Å; C9-L13 PolarHBondContact O-N 3.49Å
10	L	87.9	Confident	81.4	Confident	101 Å²	101	118.8 Å²	118.8	53%	0.529	62%	0.62	S	S	.	*	H	α-helix	trans	-63.5	-43	175.1	-71.6	170.8	0	0	0	112.3	R6 S7 K12 L13 L14	R6-L10 VanDerWaalsContact O-CG 3.31Å; R6-L10 WeakPolarHBondContact O-CG 3.31Å; R6-L10 PolarHBondContact O-N 3.35Å; R6-L10 VanDerWaalsContact O-N 3.14Å; S7-L10 PolarHBondContact O-N 3.5Å; L10-K12 VanDerWaalsContact C-N 3.3Å; L10-K12 PolarHBondContact O-N 2.91Å; L10-L13 PolarHBondContact O-N 2.9Å; L10-L14 PolarHBondContact O-N 2.88Å; L10-L14 WeakPolarHBondContact O-CG 3.44Å; L10-L14 WeakPolarHBondContact O-CB 3.49Å
11	C	87.8	Confident	81.8	Confident	69 Å²	69	117.9 Å²	117.9	47%	0.466	62%	0.615	S	S	.	*	H	α-helix	trans	-61.8	-37.4	175.4	-73.4	0	0	0	0	112.4	S7 W8 S15	S7-C11 PolarHBondContact O-SG 2.98Å; S7-C11 PolarHBondContact O-N 3.29Å; S7-C11 WeakPolarHBondContact O-CB 3.31Å; W8-C11 PolarHBondContact O-N 2.92Å; C11-S15 WeakPolarHBondContact O-CB 3.2Å; C11-S15 PolarHBondContact O-N 3.49Å; C11-S15 PolarHBondContact O-OG 2.98Å
12	K	90.7	Very high	83.3	Confident	135 Å²	135	108.3 Å²	108.3	59%	0.587	57%	0.572	S	S	*	*	H	α-helix	trans	-65.8	-43.8	175.5	-125.1	177.8	180	174.3	0	111.9	W8 C9 L10 S15 F16	W8-K12 PolarHBondContact O-N 3.16Å; C9-K12 WeakPolarHBondContact O-CB 3.2Å; C9-K12 PolarHBondContact O-N 3.45Å; L10-K12 VanDerWaalsContact C-N 3.3Å; L10-K12 PolarHBondContact O-N 2.91Å; K12-S15 PolarHBondContact O-N 3.32Å; K12-F16 PolarHBondContact O-N 3.43Å
13	L	92.5	Very high	84.4	Confident	102 Å²	102	108 Å²	108	53%	0.534	57%	0.565	S	S	.	*	H	α-helix	trans	-62.8	-48.7	178.7	-155.1	99.1	0	0	0	111.2	C9 L10 S15 F16 E17	C9-L13 PolarHBondContact O-N 3.49Å; L10-L13 PolarHBondContact O-N 2.9Å; L13-S15 PolarHBondContact O-N 3.49Å; L13-F16 PolarHBondContact O-N 3.5Å; L13-E17 PolarHBondContact O-N 3.05Å
14	L	90.8	Very high	85.5	Confident	112 Å²	112	107.4 Å²	107.4	59%	0.586	55%	0.553	S	S	*	*	H	α-helix	trans	-63.6	-39.2	178.8	-70.7	170.1	0	0	0	112.3	L10 F16 E17 Y18	L10-L14 PolarHBondContact O-N 2.88Å; L10-L14 WeakPolarHBondContact O-CG 3.44Å; L10-L14 WeakPolarHBondContact O-CB 3.49Å; L14-F16 VanDerWaalsContact C-N 3.32Å; L14-F16 PolarHBondContact O-N 3.18Å; L14-E17 PolarHBondContact O-N 3.09Å; L14-Y18 WeakPolarHBondContact O-CB 3.37Å; L14-Y18 PolarHBondContact O-N 3.45Å
15	S	91.1	Very high	86.4	Confident	76 Å²	76	111.7 Å²	111.7	53%	0.531	56%	0.556	S	S	.	*	H	α-helix	trans	-63.2	-40.3	174.8	-65.5	0	0	0	0	111.7	C11 K12 L13 Y18 V19	C11-S15 WeakPolarHBondContact O-CB 3.2Å; C11-S15 PolarHBondContact O-N 3.49Å; C11-S15 PolarHBondContact O-OG 2.98Å; K12-S15 PolarHBondContact O-N 3.32Å; L13-S15 PolarHBondContact O-N 3.49Å; S15-Y18 PolarHBondContact O-N 3.46Å; S15-V19 VanDerWaalsContact O-CG2 3.32Å; S15-V19 WeakPolarHBondContact O-CG2 3.4Å; S15-V19 PolarHBondContact O-N 3.5Å; S15-V19 VanDerWaalsContact O-N 3.09Å
16	F	90.7	Very high	86.3	Confident	152 Å²	152	111.5 Å²	111.5	67%	0.667	56%	0.557	S	S	*	*	H	α-helix	trans	-66.9	-45.8	178.2	-172.5	-94	0	0	0	111.9	K12 L13 L14 Y18 V19 F20	K12-F16 PolarHBondContact O-N 3.43Å; L13-F16 PolarHBondContact O-N 3.5Å; L14-F16 VanDerWaalsContact C-N 3.32Å; L14-F16 PolarHBondContact O-N 3.18Å; F16-Y18 VanDerWaalsContact C-N 3.33Å; F16-Y18 PolarHBondContact O-N 3.01Å; F16-V19 PolarHBondContact O-N 3.46Å; F16-F20 PolarHBondContact O-N 2.91Å; F16-F20 WeakPolarHBondContact O-CB 3.41Å
17	E	90.9	Very high	85.9	Confident	105 Å²	105	109.4 Å²	109.4	49%	0.491	56%	0.56	S	S	.	*	H	α-helix	trans	-60.3	-42	175.5	-76.9	-152	91.5	0	0	112.1	L13 L14 V19 F20 I21	L13-E17 PolarHBondContact O-N 3.05Å; L14-E17 PolarHBondContact O-N 3.09Å; E17-V19 PolarHBondContact O-N 2.88Å; E17-F20 PolarHBondContact O-N 2.97Å; E17-I21 WeakPolarHBondContact O-CB 3.37Å; E17-I21 WeakPolarHBondContact O-CD1 3.32Å; E17-I21 WeakPolarHBondContact O-CG1 3.38Å; E17-I21 PolarHBondContact O-N 2.99Å
18	Y	89.8	Confident	85.1	Confident	168 Å²	168	113.1 Å²	113.1	66%	0.659	57%	0.574	S	S	*	*	H	α-helix	trans	-60.7	-47	177.2	-178.9	-96.9	0	0	0	112.2	L14 S15 F16 F20 I21 S22	L14-Y18 WeakPolarHBondContact O-CB 3.37Å; L14-Y18 PolarHBondContact O-N 3.45Å; S15-Y18 PolarHBondContact O-N 3.46Å; F16-Y18 VanDerWaalsContact C-N 3.33Å; F16-Y18 PolarHBondContact O-N 3.01Å; Y18-F20 VanDerWaalsContact C-N 3.35Å; Y18-F20 PolarHBondContact O-N 3.31Å; Y18-I21 PolarHBondContact O-N 3.39Å; Y18-S22 WeakPolarHBondContact O-CB 3.43Å; Y18-S22 PolarHBondContact O-N 2.99Å
19	V	90.3	Very high	83.7	Confident	85 Å²	85	109.1 Å²	109.1	52%	0.515	57%	0.57	S	S	.	*	H	α-helix	trans	-64	-41.1	177.9	171.1	0	0	0	0	111.1	S15 F16 E17 S22 S23	S15-V19 VanDerWaalsContact O-CG2 3.32Å; S15-V19 WeakPolarHBondContact O-CG2 3.4Å; S15-V19 PolarHBondContact O-N 3.5Å; S15-V19 VanDerWaalsContact O-N 3.09Å; F16-V19 PolarHBondContact O-N 3.46Å; E17-V19 PolarHBondContact O-N 2.88Å; V19-S22 PolarHBondContact O-N 3.5Å; V19-S23 VanDerWaalsContact O-CB 3.31Å; V19-S23 WeakPolarHBondContact O-CB 3.2Å; V19-S23 PolarHBondContact O-N 3.33Å; V19-S23 PolarHBondContact O-OG 3Å
20	F	89.6	Confident	82.3	Confident	128 Å²	128	114.1 Å²	114.1	56%	0.561	60%	0.601	S	S	*	*	H	α-helix	trans	-62.2	-50.9	176.9	-177.2	-99	0	0	0	111.5	F16 E17 Y18 S22 S23 V24	F16-F20 PolarHBondContact O-N 2.91Å; F16-F20 WeakPolarHBondContact O-CB 3.41Å; E17-F20 PolarHBondContact O-N 2.97Å; Y18-F20 VanDerWaalsContact C-N 3.35Å; Y18-F20 PolarHBondContact O-N 3.31Å; F20-S22 VanDerWaalsContact C-N 3.34Å; F20-S22 PolarHBondContact O-N 2.91Å; F20-S23 PolarHBondContact O-N 3.35Å; F20-V24 PolarHBondContact O-N 3.4Å; F20-V24 WeakPolarHBondContact O-CG2 3.49Å; F20-V24 HydrophobicContact CE2-CG2 4.44Å; F20-V24 HydrophobicContact CE1-CG2 4.13Å; F20-V24 HydrophobicContact CD1-CG2 4.45Å; F20-V24 HydrophobicContact CZ-CG2 4.13Å
21	I	88.9	Confident	82	Confident	100 Å²	100	114.8 Å²	114.8	51%	0.513	61%	0.605	S	S	.	*	H	α-helix	trans	-61.6	-43.4	178.5	-66.8	163.3	0	0	0	110.8	E17 Y18 V24 K25	E17-I21 WeakPolarHBondContact O-CB 3.37Å; E17-I21 WeakPolarHBondContact O-CD1 3.32Å; E17-I21 WeakPolarHBondContact O-CG1 3.38Å; E17-I21 PolarHBondContact O-N 2.99Å; Y18-I21 PolarHBondContact O-N 3.39Å; I21-V24 PolarHBondContact O-N 3.37Å; I21-K25 WeakPolarHBondContact O-CB 3.35Å; I21-K25 PolarHBondContact O-N 2.97Å
22	S	85.4	Confident	81.7	Confident	45 Å²	45	117.2 Å²	117.2	32%	0.315	61%	0.612	S	S	.	*	H	α-helix	trans	-62.6	-43.5	178.4	-176.6	0	0	0	0	111.7	Y18 V19 F20 K25 M26	Y18-S22 WeakPolarHBondContact O-CB 3.43Å; Y18-S22 PolarHBondContact O-N 2.99Å; V19-S22 PolarHBondContact O-N 3.5Å; F20-S22 VanDerWaalsContact C-N 3.34Å; F20-S22 PolarHBondContact O-N 2.91Å; S22-K25 PolarHBondContact O-N 3.14Å; S22-M26 WeakPolarHBondContact O-CB 3.5Å; S22-M26 PolarHBondContact O-N 3.45Å
23	S	84.5	Confident	81.2	Confident	69 Å²	69	116.2 Å²	116.2	48%	0.483	61%	0.614	S	S	.	*	H	α-helix	trans	-64.8	-44.2	178.4	-58.1	0	0	0	0	111.8	V19 F20 M26 N27	V19-S23 VanDerWaalsContact O-CB 3.31Å; V19-S23 WeakPolarHBondContact O-CB 3.2Å; V19-S23 PolarHBondContact O-N 3.33Å; V19-S23 PolarHBondContact O-OG 3Å; F20-S23 PolarHBondContact O-N 3.35Å; S23-M26 PolarHBondContact O-N 3.28Å; S23-N27 PolarHBondContact O-N 3.04Å; S23-N27 VanDerWaalsContact O-N 3.08Å; S23-N27 WeakPolarHBondContact O-CB 3.33Å
24	V	85.8	Confident	80.5	Confident	72 Å²	72	117.1 Å²	117.1	44%	0.436	62%	0.618	S	S	.	*	H	α-helix	trans	-64.7	-42.4	176.3	172.9	0	0	0	0	110.8	F20 I21 N27 L28	F20-V24 PolarHBondContact O-N 3.4Å; F20-V24 WeakPolarHBondContact O-CG2 3.49Å; F20-V24 HydrophobicContact CE2-CG2 4.44Å; F20-V24 HydrophobicContact CE1-CG2 4.13Å; F20-V24 HydrophobicContact CD1-CG2 4.45Å; F20-V24 HydrophobicContact CZ-CG2 4.13Å; I21-V24 PolarHBondContact O-N 3.37Å; V24-N27 PolarHBondContact O-N 3.11Å; V24-L28 WeakPolarHBondContact O-CB 3.5Å; V24-L28 PolarHBondContact O-N 3.28Å
25	K	83.8	Confident	79.9	Confident	145 Å²	145	117.4 Å²	117.4	63%	0.63	62%	0.62	S	S	*	*	H	α-helix	trans	-66.9	-37.5	179.8	-175.6	163	174.5	165.7	0	112.8	I21 S22 N27 L28 V29	I21-K25 WeakPolarHBondContact O-CB 3.35Å; I21-K25 PolarHBondContact O-N 2.97Å; S22-K25 PolarHBondContact O-N 3.14Å; K25-N27 VanDerWaalsContact C-N 3.32Å; K25-L28 PolarHBondContact O-N 2.97Å; K25-V29 PolarHBondContact O-N 3.36Å; K25-V29 VanDerWaalsContact O-N 3.16Å
26	M	68.7	Low	79.1	Confident	154 Å²	154	120.1 Å²	120.1	76%	0.759	63%	0.626	S	S	*	*	H	α-helix	trans	-69.9	-27.4	172.5	-85.2	-178.2	154.3	0	0	113	S22 S23	S22-M26 WeakPolarHBondContact O-CB 3.5Å; S22-M26 PolarHBondContact O-N 3.45Å; S23-M26 PolarHBondContact O-N 3.28Å
27	N	65.1	Low	78.3	Confident	151 Å²	151	117.9 Å²	117.9	81%	0.807	62%	0.623	S	S	*	*	H	α-helix	trans	-82.2	-23.8	176.8	-148.4	-105.3	0	0	0	112.6	S23 V24 K25	S23-N27 PolarHBondContact O-N 3.04Å; S23-N27 VanDerWaalsContact O-N 3.08Å; S23-N27 WeakPolarHBondContact O-CB 3.33Å; V24-N27 PolarHBondContact O-N 3.11Å; K25-N27 VanDerWaalsContact C-N 3.32Å
28	L	63.7	Low	77.4	Confident	143 Å²	143	118.8 Å²	118.8	75%	0.749	63%	0.633	S	S	*	*	H	α-helix	trans	-91.4	-23.3	-178.6	-154.9	90.4	0	0	0	113.8	V24 K25 P30	V24-L28 WeakPolarHBondContact O-CB 3.5Å; V24-L28 PolarHBondContact O-N 3.28Å; K25-L28 PolarHBondContact O-N 2.97Å; L28-P30 VanDerWaalsContact O-CD 3.31Å; L28-P30 WeakPolarHBondContact O-CD 3.31Å
29	V	54.6	Low	76.3	Confident	98 Å²	98	114.8 Å²	114.8	59%	0.594	63%	0.631	S	S	*	*			trans	-101.5	102.1	174.8	-179.5	0	0	0	0	107.9	K25	K25-V29 PolarHBondContact O-N 3.36Å; K25-V29 VanDerWaalsContact O-N 3.16Å
30	P	55.6	Low	75.1	Confident	187 Å²	187	117.5 Å²	117.5	100%	1.214	64%	0.642	S	S	*	*			trans	-65.6	0	170.6	29	-34.1	0	0	0	112.2	L28	L28-P30 VanDerWaalsContact O-CD 3.31Å; L28-P30 WeakPolarHBondContact O-CD 3.31Å

Retrieved 30 of 30 residues in 33.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).