A0A087WYN2_HUMAN Loading...

Golgi associated, gamma adaptin ear containing, ARF binding protein 3

AlphaFold DB , UniProt , Accession A0A087WYN2, Species HUMAN (Homo sapiens, Human), Gene GGA3, Length 46 aa.

>A0A087WYN2_HUMAN|A0A087WYN2|GGA3
MKNCGRRFHNEVGKFRFLNELIKVVSPKYLGDRVSEKVKTKVIELL
Structure Viewer
Loading PAE data...
(Predicted Aligned Error values between residue pairs)
Error loading PAE data: please refresh the page.

 

Download Structure   PDB   PAE   Table  
Site Residue pLDDT pLDDT confidence pLDDT10 pLDDT10 confidence SASA SASA [Ų] SASA10 SASA10 [Ų] RSA RSA unformatted RSA10 RSA10 unformatted Surface Surface10 (not used) Disorder (not used) Disorder Sec. str. Secondary structure Isomer Phi (φ) Psi (ψ) Omega (ω) Chi 1 (χ1) Chi 2 (χ2) Chi 3 (χ3) Chi 4 (χ4) Chi 5 (χ5) Tau (τ) Contacts (colored by PAE) Contact details
1M79.8Confident92.9Very high111 Ų111124.5 Ų124.555%0.54759%0.593SS.*  011.30-49.3-171.7-17000113.7F8 H9 V12 F17M1-F8 HydrophobicContact CB-CE1 4.31Å; M1-F8 HydrophobicContact CG-CE1 4.04Å; M1-F8 HydrophobicContact SD-CE1 4.42Å; M1-H9 PolarHBondContact O-NE2 3.15Å; M1-V12 HydrophobicContact CE-CB 4.08Å; M1-V12 HydrophobicContact CE-CG1 4.24Å; M1-V12 HydrophobicContact CE-CG2 4.23Å; M1-V12 HydrophobicContact SD-CB 4.05Å; M1-V12 HydrophobicContact SD-CG1 4.29Å; M1-V12 HydrophobicContact SD-CG2 3.54Å; M1-V12 VanDerWaalsContact SD-CG2 3.54Å; M1-F17 HydrophobicContact CE-CE1 4.15Å
2K84.9Confident93.2Very high206 Ų206115.3 Ų115.390%0.89655%0.551SS**THydrogen-bonded Turntrans-76.9-24.4-170.5-64.7-178.5177-177.70114.3
3N89.5Confident93.3Very high164 Ų164110.4 Ų110.488%0.87755%0.549SS*.THydrogen-bonded Turntrans-111.836.3-177-60-8.9000112
4C92.6Very high93.6Very high51 Ų51109.4 Ų109.435%0.34554%0.54SS..  trans-125.3144.4-177.5-52.60000110F8 H9C4-F8 HydrophobicContact CB-CB 3.82Å; C4-F8 HydrophobicContact CB-CD1 3.46Å; C4-F8 VanDerWaalsContact CB-CD1 3.46Å; C4-F8 HydrophobicContact CB-CE1 4.26Å; C4-F8 HydrophobicContact CB-CG 3.78Å; C4-H9 PolarHBondContact O-CE1 3.45Å; C4-H9 PolarHBondContact O-NE2 3.03Å
5G95.4Very high93.9Very high52 Ų52112.9 Ų112.954%0.53655%0.551SS.*  trans-79.5174.1179.200000113.9R7 F8 H9G5-R7 PolarHBondContact O-N 2.96Å; G5-R7 VanDerWaalsContact O-N 3.1Å; G5-F8 WeakPolarHBondContact O-CB 3.48Å; G5-F8 PolarHBondContact O-N 3.48Å; G5-H9 PolarHBondContact O-N 3.36Å
6R95.6Very high94.2Very high205 Ų205119.6 Ų119.677%0.77457%0.569SS**Hα-helixtrans-54-34.4-174.3-162.5167-175.1170.80114.3F8 H9 N10R6-F8 VanDerWaalsContact C-N 3.33Å; R6-F8 PolarHBondContact O-N 3.17Å; R6-H9 PolarHBondContact O-N 2.68Å; R6-N10 WeakPolarHBondContact O-CB 3.37Å; R6-N10 PolarHBondContact O-N 3.04Å; R6-N10 PolarHBondContact O-OD1 3.02Å
7R96.3Very high94.3Very high213 Ų213117.4 Ų117.480%0.80456%0.556SS**Hα-helixtrans-60.6-41.7176.4-172.4178.1177.6-172.8-0.3112.1G5 E11G5-R7 PolarHBondContact O-N 2.96Å; G5-R7 VanDerWaalsContact O-N 3.1Å; R7-E11 PolarHBondContact O-N 3.32Å
8F96.9Very high94.5Very high98 Ų98113.5 Ų113.543%0.4354%0.539SS..Hα-helixtrans-70.5-44.5178.7-178.8-93.6000111.1M1 C4 G5 R6 N10 E11 V12M1-F8 HydrophobicContact CB-CE1 4.31Å; M1-F8 HydrophobicContact CG-CE1 4.04Å; M1-F8 HydrophobicContact SD-CE1 4.42Å; C4-F8 HydrophobicContact CB-CB 3.82Å; C4-F8 HydrophobicContact CB-CD1 3.46Å; C4-F8 VanDerWaalsContact CB-CD1 3.46Å; C4-F8 HydrophobicContact CB-CE1 4.26Å; C4-F8 HydrophobicContact CB-CG 3.78Å; G5-F8 WeakPolarHBondContact O-CB 3.48Å; G5-F8 PolarHBondContact O-N 3.48Å; R6-F8 VanDerWaalsContact C-N 3.33Å; R6-F8 PolarHBondContact O-N 3.17Å; F8-N10 VanDerWaalsContact C-N 3.26Å; F8-N10 PolarHBondContact O-N 3.42Å; F8-E11 PolarHBondContact O-N 3.31Å; F8-V12 HydrophobicContact CD1-CG1 4.21Å; F8-V12 HydrophobicContact CE1-CG1 3.63Å; F8-V12 HydrophobicContact CE1-CG2 4.45Å; F8-V12 HydrophobicContact CE2-CG1 4.27Å; F8-V12 HydrophobicContact CZ-CG1 3.67Å; F8-V12 WeakPolarHBondContact O-CG2 3.07Å; F8-V12 PolarHBondContact O-N 2.95Å; F8-V12 VanDerWaalsContact O-N 3.1Å
9H95.9Very high94.7Very high80 Ų80111.5 Ų111.537%0.3753%0.532SS..Hα-helixtrans-58.8-38.3176.1-63.3162.4000112.3M1 C4 G5 R6 E11 V12 G13M1-H9 PolarHBondContact O-NE2 3.15Å; C4-H9 PolarHBondContact O-CE1 3.45Å; C4-H9 PolarHBondContact O-NE2 3.03Å; G5-H9 PolarHBondContact O-N 3.36Å; R6-H9 PolarHBondContact O-N 2.68Å; H9-E11 VanDerWaalsContact C-N 3.32Å; H9-E11 PolarHBondContact O-N 2.88Å; H9-V12 VanDerWaalsContact O-CG2 3.29Å; H9-V12 WeakPolarHBondContact O-CG2 3.32Å; H9-G13 PolarHBondContact O-N 3.37Å
10N96.9Very high94.8Very high92 Ų92110.9 Ų110.949%0.49253%0.529SS..Hα-helixtrans-64.8-33175.7-70.8-6.5000112.9R6 F8 K14R6-N10 WeakPolarHBondContact O-CB 3.37Å; R6-N10 PolarHBondContact O-N 3.04Å; R6-N10 PolarHBondContact O-OD1 3.02Å; F8-N10 VanDerWaalsContact C-N 3.26Å; F8-N10 PolarHBondContact O-N 3.42Å; N10-K14 WeakPolarHBondContact O-CG 3.37Å
11E97.6Very high95Very high97 Ų97107.3 Ų107.345%0.45351%0.513SS..Hα-helixtrans-76-44.3178-67.1-51133.800112.1R7 F8 H9 G13 K14R7-E11 PolarHBondContact O-N 3.32Å; F8-E11 PolarHBondContact O-N 3.31Å; H9-E11 VanDerWaalsContact C-N 3.32Å; H9-E11 PolarHBondContact O-N 2.88Å; E11-G13 VanDerWaalsContact C-N 3.26Å; E11-G13 PolarHBondContact O-N 3.22Å; E11-K14 WeakPolarHBondContact O-CB 3.43Å; E11-K14 PolarHBondContact O-N 3.1Å; E11-K14 IonicContact OE1-NZ 2.79Å; E11-K14 PolarHBondContact OE1-NZ 3.06Å; E11-K14 IonicContact OE2-NZ 2.65Å; E11-K14 PolarHBondContact OE2-NZ 3.41Å
12V96.5Very high95.8Very high15 Ų15106 Ų1069%0.09151%0.507CS..Hα-helixtrans-69.3-24.2179.1-61.10000112.8M1 F8 H9 K14 F17 L18M1-V12 HydrophobicContact CE-CB 4.08Å; M1-V12 HydrophobicContact CE-CG1 4.24Å; M1-V12 HydrophobicContact CE-CG2 4.23Å; M1-V12 HydrophobicContact SD-CB 4.05Å; M1-V12 HydrophobicContact SD-CG1 4.29Å; M1-V12 HydrophobicContact SD-CG2 3.54Å; M1-V12 VanDerWaalsContact SD-CG2 3.54Å; F8-V12 HydrophobicContact CD1-CG1 4.21Å; F8-V12 HydrophobicContact CE1-CG1 3.63Å; F8-V12 HydrophobicContact CE1-CG2 4.45Å; F8-V12 HydrophobicContact CE2-CG1 4.27Å; F8-V12 HydrophobicContact CZ-CG1 3.67Å; F8-V12 WeakPolarHBondContact O-CG2 3.07Å; F8-V12 PolarHBondContact O-N 2.95Å; F8-V12 VanDerWaalsContact O-N 3.1Å; H9-V12 VanDerWaalsContact O-CG2 3.29Å; H9-V12 WeakPolarHBondContact O-CG2 3.32Å; V12-K14 VanDerWaalsContact C-N 3.32Å; V12-F17 HydrophobicContact CB-CD1 3.81Å; V12-F17 HydrophobicContact CB-CE1 3.93Å; V12-F17 HydrophobicContact CB-CG 4.29Å; V12-F17 HydrophobicContact CG1-CD1 4.21Å; V12-F17 HydrophobicContact CG1-CD2 4.49Å; V12-F17 HydrophobicContact CG1-CE1 4.06Å; V12-F17 HydrophobicContact CG1-CE2 4.38Å; V12-F17 HydrophobicContact CG1-CG 4.41Å; V12-F17 HydrophobicContact CG1-CZ 4.16Å; V12-F17 VanDerWaalsContact O-CD1 3.22Å; V12-F17 WeakPolarHBondContact O-CD1 3.49Å; V12-L18 WeakPolarHBondContact O-CD2 3.16Å
13G95.2Very high96.4Very high51 Ų5199.3 Ų99.353%0.52648%0.478SS..THydrogen-bonded Turntrans-78.5-8.9173.900000114.8H9 E11 L18H9-G13 PolarHBondContact O-N 3.37Å; E11-G13 VanDerWaalsContact C-N 3.26Å; E11-G13 PolarHBondContact O-N 3.22Å; G13-L18 WeakPolarHBondContact O-CD1 2.94Å
14K97.9Very high96.7Very high97 Ų9793 Ų9342%0.42245%0.445SS..SBendtrans-76147.5178.3-73.6170.2-169.3175.20110.9N10 E11 V12 R16 F17 L18N10-K14 WeakPolarHBondContact O-CG 3.37Å; E11-K14 WeakPolarHBondContact O-CB 3.43Å; E11-K14 PolarHBondContact O-N 3.1Å; E11-K14 IonicContact OE1-NZ 2.79Å; E11-K14 PolarHBondContact OE1-NZ 3.06Å; E11-K14 IonicContact OE2-NZ 2.65Å; E11-K14 PolarHBondContact OE2-NZ 3.41Å; V12-K14 VanDerWaalsContact C-N 3.32Å; K14-R16 PolarHBondContact O-N 2.74Å; K14-F17 PolarHBondContact O-N 3.02Å; K14-L18 PolarHBondContact O-N 2.92Å
15F97.7Very high97Very high162 Ų16292.4 Ų92.471%0.71144%0.44SS*.Hα-helixtrans-52.8-30.6171.8-68.1-60.9000113.1F17 L18 N19F15-F17 VanDerWaalsContact C-N 3.29Å; F15-F17 PolarHBondContact O-N 3.07Å; F15-L18 PolarHBondContact O-N 2.91Å; F15-N19 WeakPolarHBondContact O-CB 3.47Å; F15-N19 PolarHBondContact O-N 3.13Å; F15-N19 PolarHBondContact O-ND2 3.38Å; F15-N19 VanDerWaalsContact O-ND2 3.15Å; F15-N19 PolarHBondContact O-OD1 3.08Å
16R97.8Very high97Very high219 Ų21991.3 Ų91.383%0.82642%0.424SS*.Hα-helixtrans-56-41.9174.5-173.7179.5179.9-178.41.5112.7K14K14-R16 PolarHBondContact O-N 2.74Å
17F97.4Very high97.1Very high82 Ų8285.5 Ų85.536%0.3641%0.413SS..Hα-helixtrans-83.1-47178.3-177.6-96.4000111.3M1 V12 K14 F15 N19 E20 L21M1-F17 HydrophobicContact CE-CE1 4.15Å; V12-F17 HydrophobicContact CB-CD1 3.81Å; V12-F17 HydrophobicContact CB-CE1 3.93Å; V12-F17 HydrophobicContact CB-CG 4.29Å; V12-F17 HydrophobicContact CG1-CD1 4.21Å; V12-F17 HydrophobicContact CG1-CD2 4.49Å; V12-F17 HydrophobicContact CG1-CE1 4.06Å; V12-F17 HydrophobicContact CG1-CE2 4.38Å; V12-F17 HydrophobicContact CG1-CG 4.41Å; V12-F17 HydrophobicContact CG1-CZ 4.16Å; V12-F17 VanDerWaalsContact O-CD1 3.22Å; V12-F17 WeakPolarHBondContact O-CD1 3.49Å; K14-F17 PolarHBondContact O-N 3.02Å; F15-F17 VanDerWaalsContact C-N 3.29Å; F15-F17 PolarHBondContact O-N 3.07Å; F17-N19 VanDerWaalsContact C-N 3.28Å; F17-N19 PolarHBondContact O-N 3.35Å; F17-E20 PolarHBondContact O-N 3.03Å; F17-E20 VanDerWaalsContact O-N 3.08Å; F17-L21 HydrophobicContact CD1-CD1 4.19Å; F17-L21 HydrophobicContact CE1-CD1 3.65Å; F17-L21 HydrophobicContact CE1-CG 4.13Å; F17-L21 HydrophobicContact CZ-CD1 4.39Å; F17-L21 PolarHBondContact O-N 3.05Å
18L97.4Very high97.1Very high48 Ų4883.5 Ų83.525%0.25141%0.41SS..Hα-helixtrans-60.8-36.4-178.4-61.7177000112.5V12 G13 K14 F15 E20 L21 I22 L46V12-L18 WeakPolarHBondContact O-CD2 3.16Å; G13-L18 WeakPolarHBondContact O-CD1 2.94Å; K14-L18 PolarHBondContact O-N 2.92Å; F15-L18 PolarHBondContact O-N 2.91Å; L18-E20 VanDerWaalsContact C-N 3.27Å; L18-E20 PolarHBondContact O-N 3.3Å; L18-L21 WeakPolarHBondContact O-CB 3.43Å; L18-L21 PolarHBondContact O-N 2.84Å; L18-L21 VanDerWaalsContact O-N 3.13Å; L18-I22 WeakPolarHBondContact O-CG1 3.33Å; L18-I22 PolarHBondContact O-N 2.93Å; L18-L46 HydrophobicContact CD2-CD2 3.79Å
19N97.4Very high97.1Very high75 Ų7583.7 Ų83.740%0.40141%0.409SS..Hα-helixtrans-63.9-32.5177.5-71.7-14.7000112.4F15 F17 I22 K23F15-N19 WeakPolarHBondContact O-CB 3.47Å; F15-N19 PolarHBondContact O-N 3.13Å; F15-N19 PolarHBondContact O-ND2 3.38Å; F15-N19 VanDerWaalsContact O-ND2 3.15Å; F15-N19 PolarHBondContact O-OD1 3.08Å; F17-N19 VanDerWaalsContact C-N 3.28Å; F17-N19 PolarHBondContact O-N 3.35Å; N19-I22 PolarHBondContact O-N 3.5Å; N19-K23 WeakPolarHBondContact O-CG 3.47Å; N19-K23 PolarHBondContact O-N 3.19Å
20E97.7Very high97.1Very high100 Ų10083.4 Ų83.447%0.46741%0.409SS..Hα-helixtrans-68.4-38.6174.6-62.4-50.9127.300111F17 L18 K23 V24F17-E20 PolarHBondContact O-N 3.03Å; F17-E20 VanDerWaalsContact O-N 3.08Å; L18-E20 VanDerWaalsContact C-N 3.27Å; L18-E20 PolarHBondContact O-N 3.3Å; E20-K23 PolarHBondContact O-N 3.32Å; E20-K23 IonicContact OE1-NZ 2.68Å; E20-K23 PolarHBondContact OE1-NZ 3.08Å; E20-K23 IonicContact OE2-NZ 3.36Å; E20-K23 PolarHBondContact OE2-NZ 3.16Å; E20-V24 WeakPolarHBondContact O-CG2 3.32Å; E20-V24 PolarHBondContact O-N 3.32Å
21L97.8Very high97.1Very high36 Ų3679.1 Ų79.119%0.18839%0.386CS..Hα-helixtrans-64.9-39.8173.3-62.5-175.2000112.1F17 L18 K23 V24 V25 V42 L46F17-L21 HydrophobicContact CD1-CD1 4.19Å; F17-L21 HydrophobicContact CE1-CD1 3.65Å; F17-L21 HydrophobicContact CE1-CG 4.13Å; F17-L21 HydrophobicContact CZ-CD1 4.39Å; F17-L21 PolarHBondContact O-N 3.05Å; L18-L21 WeakPolarHBondContact O-CB 3.43Å; L18-L21 PolarHBondContact O-N 2.84Å; L18-L21 VanDerWaalsContact O-N 3.13Å; L21-K23 VanDerWaalsContact C-N 3.32Å; L21-K23 PolarHBondContact O-N 2.86Å; L21-V24 WeakPolarHBondContact O-CB 3.36Å; L21-V24 PolarHBondContact O-N 3.44Å; L21-V24 VanDerWaalsContact O-N 3.12Å; L21-V25 PolarHBondContact O-N 3.12Å; L21-V42 HydrophobicContact CB-CG1 3.92Å; L21-V42 HydrophobicContact CD2-CG1 4.31Å; L21-L46 HydrophobicContact CB-CD2 4.39Å; L21-L46 HydrophobicContact CD1-CD2 3.74Å; L21-L46 HydrophobicContact CD1-CG 4.31Å
22I96.8Very high97Very high82 Ų8280.7 Ų80.742%0.42140%0.398SS..Hα-helixtrans-62.3-39.3176.3-67.9165.5000111.1L18 N19 V24 V25 S26L18-I22 WeakPolarHBondContact O-CG1 3.33Å; L18-I22 PolarHBondContact O-N 2.93Å; N19-I22 PolarHBondContact O-N 3.5Å; I22-V24 PolarHBondContact O-N 3.34Å; I22-V25 WeakPolarHBondContact O-CG2 3.48Å; I22-V25 PolarHBondContact O-N 3.03Å; I22-S26 WeakPolarHBondContact O-CB 3.37Å; I22-S26 PolarHBondContact O-N 3.25Å
23K97.6Very high97Very high67 Ų6789.6 Ų89.629%0.29143%0.43SS..Hα-helixtrans-62-31175.7-71.5170.1-173.91720112.6N19 E20 L21 V25 Y29 L30N19-K23 WeakPolarHBondContact O-CG 3.47Å; N19-K23 PolarHBondContact O-N 3.19Å; E20-K23 PolarHBondContact O-N 3.32Å; E20-K23 IonicContact OE1-NZ 2.68Å; E20-K23 PolarHBondContact OE1-NZ 3.08Å; E20-K23 IonicContact OE2-NZ 3.36Å; E20-K23 PolarHBondContact OE2-NZ 3.16Å; L21-K23 VanDerWaalsContact C-N 3.32Å; L21-K23 PolarHBondContact O-N 2.86Å; K23-V25 VanDerWaalsContact C-N 3.35Å; K23-Y29 HydrophobicContact CB-CD2 4.24Å; K23-Y29 HydrophobicContact CB-CG 4.09Å; K23-Y29 HydrophobicContact CG-CD1 4.1Å; K23-Y29 HydrophobicContact CG-CD2 3.86Å; K23-Y29 HydrophobicContact CG-CE1 4.36Å; K23-Y29 HydrophobicContact CG-CE2 4.11Å; K23-Y29 HydrophobicContact CG-CG 3.84Å; K23-Y29 WeakPolarHBondContact O-CB 3.37Å; K23-L30 WeakPolarHBondContact O-CB 3.38Å; K23-L30 PolarHBondContact O-N 3.41Å; K23-L30 VanDerWaalsContact O-N 3.1Å
24V97.4Very high97.1Very high30 Ų3088.9 Ų88.918%0.18242%0.415CS..Hα-helixtrans-66.5-37.8177.7177.10000111.5E20 L21 I22 G31 V34 V38 V42E20-V24 WeakPolarHBondContact O-CG2 3.32Å; E20-V24 PolarHBondContact O-N 3.32Å; L21-V24 WeakPolarHBondContact O-CB 3.36Å; L21-V24 PolarHBondContact O-N 3.44Å; L21-V24 VanDerWaalsContact O-N 3.12Å; I22-V24 PolarHBondContact O-N 3.34Å; V24-G31 WeakPolarHBondContact O-CA 3.47Å; V24-V34 HydrophobicContact CG1-CG1 4.01Å; V24-V34 HydrophobicContact CG1-CG2 4.32Å; V24-V38 HydrophobicContact CG1-CG1 4.15Å; V24-V42 HydrophobicContact CG1-CG2 4.06Å
25V97.1Very high97.1Very high39 Ų3987.6 Ų87.624%0.23642%0.419CS..Hα-helixtrans-95.6-19.7-176.5-610000113.7L21 I22 K23 P27 K39 V42 I43L21-V25 PolarHBondContact O-N 3.12Å; I22-V25 WeakPolarHBondContact O-CG2 3.48Å; I22-V25 PolarHBondContact O-N 3.03Å; K23-V25 VanDerWaalsContact C-N 3.35Å; V25-P27 WeakPolarHBondContact O-CD 3.4Å; V25-K39 HydrophobicContact CG1-CB 4.31Å; V25-K39 HydrophobicContact CG1-CG 4.38Å; V25-V42 HydrophobicContact CG1-CB 3.98Å; V25-V42 HydrophobicContact CG1-CG1 3.82Å; V25-I43 HydrophobicContact CG1-CG1 4.17Å
26S97.2Very high97Very high29 Ų2985.6 Ų85.620%0.20341%0.411CS..  trans-79.7125.7-176.4179.70000111.9I22 K28 Y29 L30 G31I22-S26 WeakPolarHBondContact O-CB 3.37Å; I22-S26 PolarHBondContact O-N 3.25Å; S26-K28 PolarHBondContact O-N 3.24Å; S26-K28 VanDerWaalsContact O-N 3.17Å; S26-K28 PolarHBondContact OG-N 3.19Å; S26-Y29 PolarHBondContact O-N 2.99Å; S26-L30 PolarHBondContact O-N 3.24Å; S26-G31 WeakPolarHBondContact O-CA 3.47Å; S26-G31 PolarHBondContact O-N 2.79Å
27P96.4Very high97Very high84 Ų8483.5 Ų83.555%0.54541%0.409SS..THydrogen-bonded Turntrans-57.2-28.7174.7-26.935.7000113.4V25 Y29V25-P27 WeakPolarHBondContact O-CD 3.4Å; P27-Y29 PolarHBondContact O-N 2.99Å
28K97.4Very high97.1Very high170 Ų17082.8 Ų82.874%0.73941%0.411SS*.THydrogen-bonded Turntrans-57.7-20.5174.4-175.4177177.4179.60113.1S26S26-K28 PolarHBondContact O-N 3.24Å; S26-K28 VanDerWaalsContact O-N 3.17Å; S26-K28 PolarHBondContact OG-N 3.19Å
29Y96.8Very high97Very high103 Ų10382.3 Ų82.340%0.40441%0.406SS..THydrogen-bonded Turntrans-125-93.6-175.6-59.5-81.3000112.2K23 S26 P27 R33K23-Y29 HydrophobicContact CB-CD2 4.24Å; K23-Y29 HydrophobicContact CB-CG 4.09Å; K23-Y29 HydrophobicContact CG-CD1 4.1Å; K23-Y29 HydrophobicContact CG-CD2 3.86Å; K23-Y29 HydrophobicContact CG-CE1 4.36Å; K23-Y29 HydrophobicContact CG-CE2 4.11Å; K23-Y29 HydrophobicContact CG-CG 3.84Å; K23-Y29 WeakPolarHBondContact O-CB 3.37Å; S26-Y29 PolarHBondContact O-N 2.99Å; P27-Y29 PolarHBondContact O-N 2.99Å; Y29-R33 PolarHBondContact O-NH2 3.1Å
30L95.8Very high97Very high74 Ų7481.7 Ų81.739%0.38741%0.406SS..THydrogen-bonded Turntrans-108.7-7.4-173.3-57.3176.6000112.9K23 S26 D32 R33 V34K23-L30 WeakPolarHBondContact O-CB 3.38Å; K23-L30 PolarHBondContact O-N 3.41Å; K23-L30 VanDerWaalsContact O-N 3.1Å; S26-L30 PolarHBondContact O-N 3.24Å; L30-D32 PolarHBondContact O-N 2.65Å; L30-R33 PolarHBondContact O-N 3.2Å; L30-V34 HydrophobicContact CB-CG2 3.82Å; L30-V34 WeakPolarHBondContact O-CG2 3.49Å; L30-V34 PolarHBondContact O-N 3.38Å
31G95.6Very high97Very high1 Ų182.1 Ų82.11%0.0141%0.406CS..THydrogen-bonded Turntrans-56.1-29.3-171.400000115.2V24 S26 K39V24-G31 WeakPolarHBondContact O-CA 3.47Å; S26-G31 WeakPolarHBondContact O-CA 3.47Å; S26-G31 PolarHBondContact O-N 2.79Å; G31-K39 VanDerWaalsContact O-CD 3.32Å; G31-K39 WeakPolarHBondContact O-CD 3.38Å; G31-K39 WeakPolarHBondContact O-CE 3.2Å; G31-K39 PolarHBondContact O-NZ 2.69Å; G31-K39 VanDerWaalsContact O-NZ 3.07Å
32D96.4Very high97Very high130 Ų13081.3 Ų81.370%0.69540%0.402SS*.THydrogen-bonded Turntrans-89.2-14.2179.8-59.4-22.4000113.2L30L30-D32 PolarHBondContact O-N 2.65Å
33R96.2Very high96.9Very high202 Ų20282.3 Ų82.376%0.76241%0.408SS*.THydrogen-bonded Turntrans-104.1-17.3-177.6-70-179.1-89.1-174.7-6.5113.1Y29 L30Y29-R33 PolarHBondContact O-NH2 3.1Å; L30-R33 PolarHBondContact O-N 3.2Å
34V96.8Very high96.8Very high36 Ų3684.9 Ų84.922%0.21842%0.421CS..SBendtrans-92.4138.9-178.8173.70000109.7V24 L30 V38 K39V24-V34 HydrophobicContact CG1-CG1 4.01Å; V24-V34 HydrophobicContact CG1-CG2 4.32Å; L30-V34 HydrophobicContact CB-CG2 3.82Å; L30-V34 WeakPolarHBondContact O-CG2 3.49Å; L30-V34 PolarHBondContact O-N 3.38Å; V34-V38 HydrophobicContact CG1-CB 3.53Å; V34-V38 HydrophobicContact CG1-CG1 3.46Å; V34-V38 VanDerWaalsContact CG1-CG1 3.46Å; V34-V38 HydrophobicContact CG1-CG2 4.46Å; V34-K39 HydrophobicContact CB-CG 4.44Å; V34-K39 HydrophobicContact CG1-CG 4.11Å
35S97.9Very high96.4Very high71 Ų7189 Ų8950%0.49744%0.441SS..  trans-61.7148.4179.868.40000112K37 V38 K39S35-K37 PolarHBondContact O-N 2.95Å; S35-V38 PolarHBondContact O-N 3.04Å; S35-V38 WeakPolarHBondContact OG-CG2 3.22Å; S35-K39 PolarHBondContact O-N 3.44Å; S35-K39 VanDerWaalsContact O-N 3.16Å
36E97.1Very high95.8Very high119 Ų11993.2 Ų93.256%0.55646%0.462SS*.Hα-helixtrans-56.8-41.3-179-159.356.7-139.400111.8V38 K39 T40E36-V38 PolarHBondContact O-N 3.22Å; E36-K39 PolarHBondContact O-N 3.33Å; E36-K39 VanDerWaalsContact O-N 3.08Å; E36-K39 WeakPolarHBondContact OE2-CE 3.41Å; E36-K39 IonicContact OE2-NZ 2.74Å; E36-K39 PolarHBondContact OE2-NZ 2.96Å; E36-T40 PolarHBondContact O-N 3.07Å; E36-T40 PolarHBondContact O-OG1 3.19Å
37K97.9Very high95.8Very high176 Ų17696.5 Ų96.577%0.76548%0.475SS*.Hα-helixtrans-53.7-39.8175.7-177.3176.6179.6178.70113S35 K41S35-K37 PolarHBondContact O-N 2.95Å; K37-K41 WeakPolarHBondContact O-CB 3.24Å; K37-K41 PolarHBondContact O-N 3.34Å; K37-K41 VanDerWaalsContact O-N 3.16Å
38V97.6Very high95.7Very high67 Ų6797.1 Ų97.141%0.40647%0.471SS..Hα-helixtrans-73.8-42.8179.1172.30000110.5V24 V34 S35 E36 K41 V42V24-V38 HydrophobicContact CG1-CG1 4.15Å; V34-V38 HydrophobicContact CG1-CB 3.53Å; V34-V38 HydrophobicContact CG1-CG1 3.46Å; V34-V38 VanDerWaalsContact CG1-CG1 3.46Å; V34-V38 HydrophobicContact CG1-CG2 4.46Å; S35-V38 PolarHBondContact O-N 3.04Å; S35-V38 WeakPolarHBondContact OG-CG2 3.22Å; E36-V38 PolarHBondContact O-N 3.22Å; V38-K41 PolarHBondContact O-N 3.42Å; V38-V42 HydrophobicContact CG1-CG2 4.5Å; V38-V42 WeakPolarHBondContact O-CG2 3.43Å; V38-V42 PolarHBondContact O-N 2.91Å
39K97.1Very high95.6Very high37 Ų3793.1 Ų93.116%0.16146%0.456CS..Hα-helixtrans-60-48.7176.6-70.2-175.4-69.9179.30111.9V25 G31 V34 S35 E36 K41 V42 I43V25-K39 HydrophobicContact CG1-CB 4.31Å; V25-K39 HydrophobicContact CG1-CG 4.38Å; G31-K39 VanDerWaalsContact O-CD 3.32Å; G31-K39 WeakPolarHBondContact O-CD 3.38Å; G31-K39 WeakPolarHBondContact O-CE 3.2Å; G31-K39 PolarHBondContact O-NZ 2.69Å; G31-K39 VanDerWaalsContact O-NZ 3.07Å; V34-K39 HydrophobicContact CB-CG 4.44Å; V34-K39 HydrophobicContact CG1-CG 4.11Å; S35-K39 PolarHBondContact O-N 3.44Å; S35-K39 VanDerWaalsContact O-N 3.16Å; E36-K39 PolarHBondContact O-N 3.33Å; E36-K39 VanDerWaalsContact O-N 3.08Å; E36-K39 WeakPolarHBondContact OE2-CE 3.41Å; E36-K39 IonicContact OE2-NZ 2.74Å; E36-K39 PolarHBondContact OE2-NZ 2.96Å; K39-K41 VanDerWaalsContact C-N 3.25Å; K39-K41 PolarHBondContact O-N 3.17Å; K39-V42 PolarHBondContact O-N 3.16Å; K39-I43 WeakPolarHBondContact O-CG1 3.44Å; K39-I43 PolarHBondContact O-N 2.95Å
40T97.5Very high95.6Very high63 Ų6392.5 Ų92.539%0.38746%0.459SS..Hα-helixtrans-55.4-44.4174.8-51.20000110.7E36 V42 I43 E44E36-T40 PolarHBondContact O-N 3.07Å; E36-T40 PolarHBondContact O-OG1 3.19Å; T40-V42 PolarHBondContact O-N 3.38Å; T40-I43 PolarHBondContact O-N 3.28Å; T40-E44 WeakPolarHBondContact O-CG 3.41Å; T40-E44 PolarHBondContact O-N 3.29Å
41K97.6Very high95.6Very high109 Ų10993.6 Ų93.647%0.47446%0.464SS..Hα-helixtrans-68.2-34.9-178.3-165.252.7171.2-178.10113.4K37 V38 K39 E44 L45K37-K41 WeakPolarHBondContact O-CB 3.24Å; K37-K41 PolarHBondContact O-N 3.34Å; K37-K41 VanDerWaalsContact O-N 3.16Å; V38-K41 PolarHBondContact O-N 3.42Å; K39-K41 VanDerWaalsContact C-N 3.25Å; K39-K41 PolarHBondContact O-N 3.17Å; K41-E44 VanDerWaalsContact CD-OE2 3.24Å; K41-E44 WeakPolarHBondContact CD-OE2 3.43Å; K41-E44 IonicContact NZ-OE2 2.69Å; K41-E44 PolarHBondContact NZ-OE2 2.86Å; K41-L45 HydrophobicContact CG-CD1 4.18Å; K41-L45 WeakPolarHBondContact O-CD1 3.49Å; K41-L45 WeakPolarHBondContact O-CG 3.45Å; K41-L45 PolarHBondContact O-N 3.34Å
42V96.5Very high95.6Very high18 Ų1899.8 Ų99.811%0.10949%0.494CS..Hα-helixtrans-65.7-42.6174.3171.80000110.4L21 V24 V25 V38 K39 T40 L45 L46L21-V42 HydrophobicContact CB-CG1 3.92Å; L21-V42 HydrophobicContact CD2-CG1 4.31Å; V24-V42 HydrophobicContact CG1-CG2 4.06Å; V25-V42 HydrophobicContact CG1-CB 3.98Å; V25-V42 HydrophobicContact CG1-CG1 3.82Å; V38-V42 HydrophobicContact CG1-CG2 4.5Å; V38-V42 WeakPolarHBondContact O-CG2 3.43Å; V38-V42 PolarHBondContact O-N 2.91Å; K39-V42 PolarHBondContact O-N 3.16Å; T40-V42 PolarHBondContact O-N 3.38Å; V42-L45 PolarHBondContact O-N 3.3Å; V42-L46 HydrophobicContact CG1-CD1 4.14Å; V42-L46 WeakPolarHBondContact O-CG 3.29Å; V42-L46 PolarHBondContact O-N 3.43Å
43I94.8Very high95.5Very high104 Ų10497.6 Ų97.653%0.53348%0.479SS..Hα-helixtrans-63.4-42.1177.5-65.1168.3000111.3V25 K39 T40 L45 L46V25-I43 HydrophobicContact CG1-CG1 4.17Å; K39-I43 WeakPolarHBondContact O-CG1 3.44Å; K39-I43 PolarHBondContact O-N 2.95Å; T40-I43 PolarHBondContact O-N 3.28Å; I43-L45 PolarHBondContact O-N 3.1Å; I43-L46 PolarHBondContact O-N 3.13Å
44E95.6Very high95.5Very high121 Ų12189.6 Ų89.657%0.56546%0.458SS*.Hα-helixtrans-63.3-22.6176-74.4176.2-172.500114.3T40 K41T40-E44 WeakPolarHBondContact O-CG 3.41Å; T40-E44 PolarHBondContact O-N 3.29Å; K41-E44 VanDerWaalsContact CD-OE2 3.24Å; K41-E44 WeakPolarHBondContact CD-OE2 3.43Å; K41-E44 IonicContact NZ-OE2 2.69Å; K41-E44 PolarHBondContact NZ-OE2 2.86Å
45L88.4Confident95.3Very high117 Ų11794.1 Ų94.161%0.61348%0.478SS*.Hα-helixtrans-97.3-12.8-175.6-71.6173000113.4K41 V42 I43K41-L45 HydrophobicContact CG-CD1 4.18Å; K41-L45 WeakPolarHBondContact O-CD1 3.49Å; K41-L45 WeakPolarHBondContact O-CG 3.45Å; K41-L45 PolarHBondContact O-N 3.34Å; V42-L45 PolarHBondContact O-N 3.3Å; I43-L45 PolarHBondContact O-N 3.1Å
46L86.1Confident95.1Very high127 Ų12796.2 Ų96.267%0.66548%0.476SS*.  trans-85.50173.1-75.2172000110.3L18 L21 V42 I43L18-L46 HydrophobicContact CD2-CD2 3.79Å; L21-L46 HydrophobicContact CB-CD2 4.39Å; L21-L46 HydrophobicContact CD1-CD2 3.74Å; L21-L46 HydrophobicContact CD1-CG 4.31Å; V42-L46 HydrophobicContact CG1-CD1 4.14Å; V42-L46 WeakPolarHBondContact O-CG 3.29Å; V42-L46 PolarHBondContact O-N 3.43Å; I43-L46 PolarHBondContact O-N 3.13Å

Retrieved 46 of 46 residues in 391.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).