A0A087WYP4_HUMAN Loading...

Secretory carrier membrane protein 4

AlphaFold DB , UniProt , Accession A0A087WYP4, Species HUMAN (Homo sapiens, Human), Gene SCAMP4, Length 35 aa.

						>A0A087WYP4_HUMAN|A0A087WYP4|SCAMP4
MSGAQGHFLRQCWLSRSSWGAPSATLSAPKAVFPS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	52.3	Low	73.7	Confident	225 Å²	225	116.9 Å²	116.9	100%	1.108	63%	0.634	S	S	*	*				0	112.1	0	-64.4	165.4	80.1	0	0	107.1
2	S	59.6	Low	74.4	Confident	97 Å²	97	111.8 Å²	111.8	68%	0.678	61%	0.612	S	S	*	*			trans	-66.9	133.3	-176.9	-78.6	0	0	0	0	111.3	A4 Q5	S2-A4 PolarHBondContact O-N 3Å; S2-Q5 PolarHBondContact O-N 2.75Å
3	G	68.4	Low	74.9	Confident	53 Å²	53	116.5 Å²	116.5	55%	0.546	62%	0.615	S	S	.	*	H	α-helix	trans	-53.9	-25.4	-174.9	0	0	0	0	0	115.2	Q5 G6 H7	G3-Q5 PolarHBondContact O-N 3.1Å; G3-Q5 VanDerWaalsContact C-N 3.26Å; G3-G6 VanDerWaalsContact O-N 3.15Å; G3-G6 PolarHBondContact O-N 2.86Å; G3-H7 PolarHBondContact O-CD2 2.94Å; G3-H7 PolarHBondContact O-N 2.72Å; G3-H7 VanDerWaalsContact O-N 3.16Å
4	A	70.2	Confident	75.1	Confident	74 Å²	74	113.9 Å²	113.9	61%	0.612	60%	0.601	S	S	*	*	H	α-helix	trans	-56.7	-35.1	175.8	0	0	0	0	0	113.8	S2 H7 F8	S2-A4 PolarHBondContact O-N 3Å; A4-H7 PolarHBondContact O-N 3.18Å; A4-F8 PolarHBondContact O-N 2.69Å
5	Q	72.3	Confident	74.9	Confident	124 Å²	124	110.1 Å²	110.1	58%	0.579	59%	0.588	S	S	*	*	H	α-helix	trans	-70.7	-34.9	-179.8	-152.2	171.2	20.4	0	0	111.5	S2 G3 L9	S2-Q5 PolarHBondContact O-N 2.75Å; G3-Q5 PolarHBondContact O-N 3.1Å; G3-Q5 VanDerWaalsContact C-N 3.26Å; Q5-L9 WeakPolarHBondContact O-CG 3.45Å; Q5-L9 VanDerWaalsContact O-N 3.14Å; Q5-L9 PolarHBondContact O-N 3.22Å; Q5-L9 VanDerWaalsContact O-CG 3.29Å
6	G	81.3	Confident	74.5	Confident	45 Å²	45	115.6 Å²	115.6	46%	0.464	60%	0.598	S	S	.	*	H	α-helix	trans	-68.8	-38.8	174	0	0	0	0	0	112.7	G3 R10	G3-G6 VanDerWaalsContact O-N 3.15Å; G3-G6 PolarHBondContact O-N 2.86Å; G6-R10 WeakPolarHBondContact O-CB 3.32Å; G6-R10 PolarHBondContact O-N 2.98Å
7	H	80.6	Confident	73.9	Confident	127 Å²	127	113 Å²	113	59%	0.588	59%	0.592	S	S	*	*	H	α-helix	trans	-65	-43.6	175.6	-73.6	-71.8	0	0	0	112.3	G3 A4 R10 Q11	G3-H7 PolarHBondContact O-CD2 2.94Å; G3-H7 PolarHBondContact O-N 2.72Å; G3-H7 VanDerWaalsContact O-N 3.16Å; A4-H7 PolarHBondContact O-N 3.18Å; H7-R10 PolarHBondContact O-N 3.26Å; H7-Q11 WeakPolarHBondContact O-CG 3.28Å; H7-Q11 PolarHBondContact O-N 2.94Å
8	F	82.3	Confident	73.4	Confident	142 Å²	142	111.7 Å²	111.7	62%	0.623	59%	0.594	S	S	*	*	H	α-helix	trans	-60.5	-49.2	176.2	-179.4	-103.5	0	0	0	111.7	A4 R10 Q11 C12	A4-F8 PolarHBondContact O-N 2.69Å; F8-R10 VanDerWaalsContact C-N 3.3Å; F8-R10 PolarHBondContact O-N 3.27Å; F8-Q11 PolarHBondContact O-N 3.48Å; F8-C12 PolarHBondContact O-N 3.21Å; F8-C12 PolarHBondContact O-SG 2.95Å
9	L	82	Confident	72.7	Confident	111 Å²	111	117.1 Å²	117.1	58%	0.581	61%	0.606	S	S	*	*	H	α-helix	trans	-61.4	-38.2	178.1	-70.4	171.5	0	0	0	112.4	Q5 C12 W13	Q5-L9 WeakPolarHBondContact O-CG 3.45Å; Q5-L9 VanDerWaalsContact O-N 3.14Å; Q5-L9 PolarHBondContact O-N 3.22Å; Q5-L9 VanDerWaalsContact O-CG 3.29Å; L9-C12 PolarHBondContact O-N 2.88Å; L9-W13 WeakPolarHBondContact O-CB 3.46Å; L9-W13 PolarHBondContact O-N 3.41Å
10	R	81.8	Confident	71.9	Confident	172 Å²	172	114 Å²	114	65%	0.649	60%	0.604	S	S	*	*	H	α-helix	trans	-65.1	-42	176.5	-167	175.6	-172.3	-142.5	0.8	111.9	G6 H7 F8 W13 L14	G6-R10 WeakPolarHBondContact O-CB 3.32Å; G6-R10 PolarHBondContact O-N 2.98Å; H7-R10 PolarHBondContact O-N 3.26Å; F8-R10 VanDerWaalsContact C-N 3.3Å; F8-R10 PolarHBondContact O-N 3.27Å; R10-W13 PolarHBondContact O-N 2.93Å; R10-L14 WeakPolarHBondContact O-CB 3.36Å; R10-L14 PolarHBondContact O-N 3.24Å; R10-L14 WeakPolarHBondContact O-CG 3.34Å; R10-L14 VanDerWaalsContact O-CG 3.28Å; R10-L14 HydrophobicContact CG-CD1 4.25Å
11	Q	80.6	Confident	71.2	Confident	116 Å²	116	112.4 Å²	112.4	54%	0.542	61%	0.607	S	S	.	*	H	α-helix	trans	-66.3	-42.1	174.9	-69.2	-63.2	-26.4	0	0	111.5	H7 F8 W13 L14 S15	H7-Q11 WeakPolarHBondContact O-CG 3.28Å; H7-Q11 PolarHBondContact O-N 2.94Å; F8-Q11 PolarHBondContact O-N 3.48Å; Q11-W13 VanDerWaalsContact C-N 3.32Å; Q11-W13 PolarHBondContact O-N 2.86Å; Q11-L14 PolarHBondContact O-N 2.88Å; Q11-S15 VanDerWaalsContact O-OG 3.08Å; Q11-S15 PolarHBondContact O-OG 3.35Å; Q11-S15 WeakPolarHBondContact O-CB 3.28Å; Q11-S15 PolarHBondContact O-N 3.07Å; Q11-S15 VanDerWaalsContact O-CB 3.31Å
12	C	82	Confident	71.3	Confident	56 Å²	56	107.5 Å²	107.5	38%	0.378	59%	0.592	S	S	.	*	H	α-helix	trans	-60	-40.9	174.3	-67.8	0	0	0	0	112.4	F8 L9 R16	F8-C12 PolarHBondContact O-N 3.21Å; F8-C12 PolarHBondContact O-SG 2.95Å; L9-C12 PolarHBondContact O-N 2.88Å; C12-R16 VanDerWaalsContact O-CB 3.28Å; C12-R16 WeakPolarHBondContact O-CB 3.35Å; C12-R16 PolarHBondContact O-N 2.97Å
13	W	80.3	Confident	70.8	Confident	172 Å²	172	107.3 Å²	107.3	65%	0.652	59%	0.59	S	S	*	*	H	α-helix	trans	-68.3	-45.6	178.5	-166.2	76.6	0	0	0	111.8	L9 R10 Q11 S15 R16 S17	L9-W13 WeakPolarHBondContact O-CB 3.46Å; L9-W13 PolarHBondContact O-N 3.41Å; R10-W13 PolarHBondContact O-N 2.93Å; Q11-W13 VanDerWaalsContact C-N 3.32Å; Q11-W13 PolarHBondContact O-N 2.86Å; W13-S15 PolarHBondContact O-N 3.44Å; W13-R16 PolarHBondContact O-N 3.39Å; W13-S17 PolarHBondContact O-N 2.93Å; W13-S17 PolarHBondContact O-OG 3.09Å
14	L	77.4	Confident	70	Confident	80 Å²	80	109.6 Å²	109.6	42%	0.419	60%	0.604	S	S	.	*	H	α-helix	trans	-61.6	-42.8	175.5	-71.8	168.8	0	0	0	112.1	R10 Q11 S17 S18	R10-L14 WeakPolarHBondContact O-CB 3.36Å; R10-L14 PolarHBondContact O-N 3.24Å; R10-L14 WeakPolarHBondContact O-CG 3.34Å; R10-L14 VanDerWaalsContact O-CG 3.28Å; R10-L14 HydrophobicContact CG-CD1 4.25Å; Q11-L14 PolarHBondContact O-N 2.88Å; L14-S17 PolarHBondContact O-N 3.44Å; L14-S18 WeakPolarHBondContact O-CB 3.4Å; L14-S18 PolarHBondContact O-OG 2.89Å; L14-S18 PolarHBondContact O-N 3.4Å
15	S	73.1	Confident	69.3	Low	58 Å²	58	110.6 Å²	110.6	41%	0.406	60%	0.603	S	S	.	*	H	α-helix	trans	-65.2	-37.6	175.5	-67.4	0	0	0	0	112.5	Q11 W13 S17 S18 W19	Q11-S15 VanDerWaalsContact O-OG 3.08Å; Q11-S15 PolarHBondContact O-OG 3.35Å; Q11-S15 WeakPolarHBondContact O-CB 3.28Å; Q11-S15 PolarHBondContact O-N 3.07Å; Q11-S15 VanDerWaalsContact O-CB 3.31Å; W13-S15 PolarHBondContact O-N 3.44Å; S15-S17 VanDerWaalsContact C-N 3.33Å; S15-S18 WeakPolarHBondContact CA-OG 3.44Å; S15-S18 PolarHBondContact O-N 2.98Å; S15-S18 PolarHBondContact O-OG 3.2Å; S15-S18 VanDerWaalsContact O-OG 3.07Å; S15-W19 PolarHBondContact O-N 3.34Å; S15-W19 WeakPolarHBondContact O-CB 3.31Å
16	R	68.3	Low	68.2	Low	197 Å²	197	112 Å²	112	74%	0.743	61%	0.614	S	S	*	*	H	α-helix	trans	-68.1	-32.4	174.3	180	179.5	-69.4	177.5	-2.1	112.3	C12 W13	C12-R16 VanDerWaalsContact O-CB 3.28Å; C12-R16 WeakPolarHBondContact O-CB 3.35Å; C12-R16 PolarHBondContact O-N 2.97Å; W13-R16 PolarHBondContact O-N 3.39Å
17	S	63.9	Low	66.8	Low	72 Å²	72	114.7 Å²	114.7	50%	0.503	63%	0.625	S	S	.	*	H	α-helix	trans	-78.7	-30.5	175.6	-63.1	0	0	0	0	112.6	W13 L14 S15	W13-S17 PolarHBondContact O-N 2.93Å; W13-S17 PolarHBondContact O-OG 3.09Å; L14-S17 PolarHBondContact O-N 3.44Å; S15-S17 VanDerWaalsContact C-N 3.33Å
18	S	64.6	Low	65.5	Low	89 Å²	89	112.5 Å²	112.5	62%	0.622	63%	0.629	S	S	*	*	H	α-helix	trans	-81.1	-31.6	177.9	67.3	0	0	0	0	112.9	L14 S15 G20	L14-S18 WeakPolarHBondContact O-CB 3.4Å; L14-S18 PolarHBondContact O-OG 2.89Å; L14-S18 PolarHBondContact O-N 3.4Å; S15-S18 WeakPolarHBondContact CA-OG 3.44Å; S15-S18 PolarHBondContact O-N 2.98Å; S15-S18 PolarHBondContact O-OG 3.2Å; S15-S18 VanDerWaalsContact O-OG 3.07Å; S18-G20 PolarHBondContact O-N 3.08Å
19	W	60.9	Low	63.5	Low	214 Å²	214	111 Å²	111	81%	0.811	63%	0.633	S	S	*	*	S	Bend	trans	-75.5	77.2	159.5	-73.3	47.8	0	0	0	106.5	S15 A21	S15-W19 PolarHBondContact O-N 3.34Å; S15-W19 WeakPolarHBondContact O-CB 3.31Å; W19-A21 PolarHBondContact O-N 3.4Å
20	G	55.6	Low	62.2	Low	55 Å²	55	114.5 Å²	114.5	57%	0.567	64%	0.644	S	S	*	*			trans	-37.6	131.9	179.7	0	0	0	0	0	110	S18	S18-G20 PolarHBondContact O-N 3.08Å
21	A	58.1	Low	60.7	Low	81 Å²	81	109.9 Å²	109.9	67%	0.669	64%	0.643	S	S	*	*			trans	-34.8	130.3	176.2	0	0	0	0	0	108.6	W19 S23	W19-A21 PolarHBondContact O-N 3.4Å; A21-S23 VanDerWaalsContact C-N 3.25Å; A21-S23 WeakPolarHBondContact O-CA 3.29Å; A21-S23 PolarHBondContact O-N 3.16Å
22	P	54.6	Low	59.4	Low	122 Å²	122	110.3 Å²	110.3	79%	0.792	65%	0.653	S	S	*	*			trans	-52.8	108.8	169.8	23.7	-30.9	0	0	0	103.6	A24	P22-A24 VanDerWaalsContact C-N 3.35Å; P22-A24 PolarHBondContact O-N 3.15Å
23	S	47.9	Very low	57.6	Low	93 Å²	93	116 Å²	116	65%	0.65	67%	0.672	S	S	*	*			trans	-53.7	111.3	-168.2	-179.9	0	0	0	0	104.1	A21 T25	A21-S23 VanDerWaalsContact C-N 3.25Å; A21-S23 WeakPolarHBondContact O-CA 3.29Å; A21-S23 PolarHBondContact O-N 3.16Å; S23-T25 PolarHBondContact O-N 3.26Å; S23-T25 PolarHBondContact OG-OG1 3.06Å
24	A	53.4	Low	56	Low	101 Å²	101	113.7 Å²	113.7	84%	0.835	68%	0.678	S	S	*	*			trans	-72.3	38.5	-179.7	0	0	0	0	0	109.5	P22 L26	P22-A24 VanDerWaalsContact C-N 3.35Å; P22-A24 PolarHBondContact O-N 3.15Å; A24-L26 PolarHBondContact O-N 3.07Å; A24-L26 VanDerWaalsContact O-N 3.1Å
25	T	54.5	Low	54.4	Low	95 Å²	95	119 Å²	119	58%	0.583	72%	0.722	S	S	*	*			trans	-78.7	67.8	154	-39	0	0	0	0	105.9	S23 S27	S23-T25 PolarHBondContact O-N 3.26Å; S23-T25 PolarHBondContact OG-OG1 3.06Å; T25-S27 PolarHBondContact O-N 2.98Å
26	L	49	Very low	53.5	Low	155 Å²	155	122.1 Å²	122.1	81%	0.812	74%	0.738	S	S	*	*			trans	-71.3	59.8	158.5	-170.3	76.3	0	0	0	108	A24 A28	A24-L26 PolarHBondContact O-N 3.07Å; A24-L26 VanDerWaalsContact O-N 3.1Å; L26-A28 VanDerWaalsContact C-N 3.26Å
27	S	52.1	Low	52.7	Low	101 Å²	101	118.1 Å²	118.1	71%	0.706	74%	0.738	S	S	*	*	S	Bend	trans	-91	80	148.6	-62	0	0	0	0	104.9	T25	T25-S27 PolarHBondContact O-N 2.98Å
28	A	52.3	Low	52.1	Low	81 Å²	81	120.7 Å²	120.7	67%	0.669	75%	0.751	S	S	*	*			trans	21.1	103.5	170.5	0	0	0	0	0	117.3	L26 K30	L26-A28 VanDerWaalsContact C-N 3.26Å; A28-K30 PolarHBondContact O-N 3.39Å
29	P	42.2	Very low	51.4	Low	109 Å²	109	122.5 Å²	122.5	71%	0.708	76%	0.758	S	S	*	*			trans	-75	109.5	151.4	30.9	-24	0	0	0	106.2	A31	P29-A31 PolarHBondContact O-N 2.88Å
30	K	53.5	Low	50.8	Low	186 Å²	186	116.8 Å²	116.8	81%	0.809	76%	0.755	S	S	*	*			trans	-41.4	113.4	159.4	174.9	-174.5	168.6	100.7	0	107	A28 V32	A28-K30 PolarHBondContact O-N 3.39Å; K30-V32 PolarHBondContact O-N 3.14Å
31	A	51.2	Low	50.4	Low	75 Å²	75	120.9 Å²	120.9	62%	0.62	77%	0.768	S	S	*	*			trans	-58.3	102.5	177.8	0	0	0	0	0	108.4	P29 F33	P29-A31 PolarHBondContact O-N 2.88Å; A31-F33 HydrophobicContact CB-CD2 4.21Å; A31-F33 HydrophobicContact CB-CE2 3.89Å; A31-F33 PolarHBondContact O-N 3.27Å
32	V	52.4	Low	49.9	Very low	124 Å²	124	123.8 Å²	123.8	75%	0.752	78%	0.775	S	S	*	*			trans	-89.1	93.9	163	179.8	0	0	0	0	104.8	K30	K30-V32 PolarHBondContact O-N 3.14Å
33	F	44.8	Very low	49.5	Very low	177 Å²	177	123.9 Å²	123.9	78%	0.776	77%	0.773	S	S	*	*			trans	-62.1	130.8	163.8	-70.4	-89.1	0	0	0	107.8	A31 S35	A31-F33 HydrophobicContact CB-CD2 4.21Å; A31-F33 HydrophobicContact CB-CE2 3.89Å; A31-F33 PolarHBondContact O-N 3.27Å; F33-S35 PolarHBondContact O-N 3.48Å
34	P	45.4	Very low	49.7	Very low	122 Å²	122	126.5 Å²	126.5	79%	0.792	78%	0.784	S	S	*	*			trans	-69.7	130.2	163.9	30.1	-30	0	0	0	108
35	S	45	Very low	49.3	Very low	192 Å²	192	128.8 Å²	128.8	100%	1.343	78%	0.779	S	S	*	*			trans	-64	0	171.7	66.4	0	0	0	0	111.8	F33	F33-S35 PolarHBondContact O-N 3.48Å

Retrieved 35 of 35 residues in 286.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).