A0A087WYS7_HUMAN Loading...

A-kinase anchoring protein 13

AlphaFold DB , UniProt , Accession A0A087WYS7, Species HUMAN (Homo sapiens, Human), Gene AKAP13, Length 66 aa.

						>A0A087WYS7_HUMAN|A0A087WYS7|AKAP13
MSSSKKSKEKEKEKDKIKEKEKDSKDKEKDKKTVNGHTFSSIPVVGPISCSQCMKPFTNKDAYTCA
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	46.7	Very low	48.8	Very low	238 Å²	238	160.3 Å²	160.3	100%	1.172	83%	0.825	S	S	*	*				0	147.3	0	-72.5	-74.9	169.4	0	108.3
2	S	46.1	Very low	49	Very low	118 Å²	118	160.6 Å²	160.6	83%	0.825	82%	0.815	S	S	*	*			trans	102.3	53.1	174.3	-48.3	0	0	0	117.7	S4	S2-S4 PolarHBondContact O-N 3.49Å
3	S	49.3	Very low	48.7	Very low	123 Å²	123	158.5 Å²	158.5	86%	0.86	80%	0.8	S	S	*	*			trans	-80.7	93.8	157.1	-58.4	0	0	0	110
4	S	50.4	Low	48.8	Very low	104 Å²	104	158.9 Å²	158.9	73%	0.727	79%	0.794	S	S	*	*			trans	-148.7	2.8	174.8	-51.7	0	0	0	116.8	S2	S2-S4 PolarHBondContact O-N 3.49Å
5	K	50.5	Low	48.7	Very low	211 Å²	211	155.3 Å²	155.3	92%	0.917	78%	0.779	S	S	*	*	S	Bend	trans	-85.5	-6.5	-177.3	-78.5	-179.2	175.3	173.9	115.6
6	K	51.6	Low	48.7	Very low	194 Å²	194	155.4 Å²	155.4	84%	0.843	77%	0.773	S	S	*	*	S	Bend	trans	-93.2	-7.1	-165.7	-153.7	161.4	-174.2	173.3	115.8
7	S	51.5	Low	48.9	Very low	95 Å²	95	151.8 Å²	151.8	66%	0.664	76%	0.755	S	S	*	*	S	Bend	trans	-93.8	-18.4	-166.3	-49.5	0	0	0	115.4
8	K	51	Low	48.9	Very low	187 Å²	187	152.2 Å²	152.2	81%	0.813	75%	0.752	S	S	*	*	S	Bend	trans	-84.9	-28	-170.3	-164.1	170.1	-176.6	175.4	114.7
9	E	44.3	Very low	48.7	Very low	159 Å²	159	150.7 Å²	150.7	74%	0.743	74%	0.743	S	S	*	*	H	α-helix	trans	-71.2	-35.6	179.4	-80.7	-178.6	90.4	0	112.5	E11 K12	E9-E11 VanDerWaalsContact C-N 3.29Å; E9-E11 PolarHBondContact O-N 3.3Å; E9-K12 PolarHBondContact O-N 3.3Å
10	K	48.3	Very low	48.7	Very low	174 Å²	174	151.2 Å²	151.2	76%	0.757	74%	0.74	S	S	*	*	H	α-helix	trans	-69.1	-25.2	-174	-151.8	176	-174.3	-178.9	113.7
11	E	47.6	Very low	48.5	Very low	160 Å²	160	150.7 Å²	150.7	75%	0.748	74%	0.737	S	S	*	*	H	α-helix	trans	-79.1	-33.9	179	-140.3	179.2	109.8	0	111.9	E9 K14	E9-E11 VanDerWaalsContact C-N 3.29Å; E9-E11 PolarHBondContact O-N 3.3Å; E11-K14 PolarHBondContact O-N 3.38Å
12	K	50.8	Low	48.7	Very low	164 Å²	164	147.6 Å²	147.6	71%	0.713	72%	0.717	S	S	*	*	H	α-helix	trans	-74.6	-29.4	-176.7	-153.5	177.6	-175.2	-177.7	113.3	E9	E9-K12 PolarHBondContact O-N 3.3Å
13	E	45.3	Very low	48.7	Very low	133 Å²	133	144.3 Å²	144.3	62%	0.621	69%	0.69	S	S	*	*	H	α-helix	trans	-72.1	-37.7	173.8	-101.9	-173.4	92.6	0	112.5	D15 K16 I17	E13-D15 VanDerWaalsContact C-N 3.28Å; E13-D15 PolarHBondContact O-N 3.4Å; E13-K16 PolarHBondContact O-N 3.45Å; E13-I17 WeakPolarHBondContact O-CD1 3.4Å; E13-I17 WeakPolarHBondContact O-CG1 3.34Å; E13-I17 PolarHBondContact O-N 3.3Å
14	K	50.4	Low	48.7	Very low	165 Å²	165	142.1 Å²	142.1	72%	0.717	68%	0.675	S	S	*	*	H	α-helix	trans	-68.6	-30.2	-175.9	-147.5	179	-176.5	-173.3	112.4	E11 K18	E11-K14 PolarHBondContact O-N 3.38Å; K14-K18 PolarHBondContact O-N 3.31Å
15	D	46.2	Very low	48.7	Very low	104 Å²	104	145.8 Å²	145.8	56%	0.556	68%	0.677	S	S	*	*	H	α-helix	trans	-73.2	-43.2	177.2	-156.7	-110.4	0	0	112.1	E13 I17 K18 E19	E13-D15 VanDerWaalsContact C-N 3.28Å; E13-D15 PolarHBondContact O-N 3.4Å; D15-I17 VanDerWaalsContact C-N 3.3Å; D15-I17 PolarHBondContact O-N 3.41Å; D15-K18 PolarHBondContact O-N 3.35Å; D15-E19 PolarHBondContact O-N 3.41Å; D15-E19 VanDerWaalsContact O-N 3.14Å
16	K	49.3	Very low	48.7	Very low	157 Å²	157	139.8 Å²	139.8	68%	0.683	66%	0.655	S	S	*	*	H	α-helix	trans	-60.3	-35.8	175.8	-90.4	-173.8	177.8	-172.7	113.8	E13 K20	E13-K16 PolarHBondContact O-N 3.45Å; K16-K20 WeakPolarHBondContact O-CB 3.46Å; K16-K20 PolarHBondContact O-N 3.19Å
17	I	52.1	Low	48.7	Very low	94 Å²	94	135.5 Å²	135.5	48%	0.482	64%	0.637	S	S	.	*	H	α-helix	trans	-73.2	-37.7	-179.9	-62.9	161.5	0	0	110	E13 D15 K20 E21	E13-I17 WeakPolarHBondContact O-CD1 3.4Å; E13-I17 WeakPolarHBondContact O-CG1 3.34Å; E13-I17 PolarHBondContact O-N 3.3Å; D15-I17 VanDerWaalsContact C-N 3.3Å; D15-I17 PolarHBondContact O-N 3.41Å; I17-K20 PolarHBondContact O-N 3.32Å; I17-E21 PolarHBondContact O-N 3.14Å; I17-E21 VanDerWaalsContact O-N 3.14Å
18	K	49.1	Very low	48.6	Very low	160 Å²	160	139.5 Å²	139.5	70%	0.696	65%	0.645	S	S	*	*	H	α-helix	trans	-70.8	-34.5	-178.2	-147.7	177.3	-173.1	-177.6	113.1	K14 D15 K22	K14-K18 PolarHBondContact O-N 3.31Å; D15-K18 PolarHBondContact O-N 3.35Å; K18-K22 PolarHBondContact O-N 3.44Å
19	E	45.4	Very low	48.7	Very low	123 Å²	123	139.9 Å²	139.9	58%	0.575	65%	0.647	S	S	*	*	H	α-helix	trans	-69.5	-39.9	171.3	-79	-161.7	114.1	0	112.1	D15 E21 K22 D23	D15-E19 PolarHBondContact O-N 3.41Å; D15-E19 VanDerWaalsContact O-N 3.14Å; E19-E21 PolarHBondContact O-N 3.14Å; E19-K22 PolarHBondContact O-N 3.48Å; E19-D23 PolarHBondContact O-N 3.17Å; E19-D23 VanDerWaalsContact O-N 3.17Å
20	K	48.9	Very low	49.3	Very low	160 Å²	160	134.1 Å²	134.1	70%	0.696	62%	0.621	S	S	*	*	H	α-helix	trans	-67.2	-34	-177.9	-153.4	176.3	-175.7	-176	113.2	K16 I17 S24	K16-K20 WeakPolarHBondContact O-CB 3.46Å; K16-K20 PolarHBondContact O-N 3.19Å; I17-K20 PolarHBondContact O-N 3.32Å; K20-S24 PolarHBondContact O-N 3.13Å
21	E	43.9	Very low	49.9	Very low	142 Å²	142	133.2 Å²	133.2	66%	0.664	62%	0.617	S	S	*	*	H	α-helix	trans	-74.8	-28.9	174.7	-75.6	-166.1	97	0	113.5	I17 E19	I17-E21 PolarHBondContact O-N 3.14Å; I17-E21 VanDerWaalsContact O-N 3.14Å; E19-E21 PolarHBondContact O-N 3.14Å
22	K	50.1	Low	50.8	Low	173 Å²	173	132.2 Å²	132.2	75%	0.752	61%	0.61	S	S	*	*	H	α-helix	trans	-75.5	-35.2	179.2	-154.1	177.2	-177.1	-173.7	111.7	K18 E19	K18-K22 PolarHBondContact O-N 3.44Å; E19-K22 PolarHBondContact O-N 3.48Å
23	D	46.7	Very low	51.9	Low	48 Å²	48	129.1 Å²	129.1	26%	0.257	61%	0.605	S	S	.	*	H	α-helix	trans	-64.1	-42.7	173.2	-177.9	-98.6	0	0	112.3	E19 K25 D26 K27	E19-D23 PolarHBondContact O-N 3.17Å; E19-D23 VanDerWaalsContact O-N 3.17Å; D23-K25 VanDerWaalsContact C-N 3.28Å; D23-K25 PolarHBondContact O-N 3.25Å; D23-D26 PolarHBondContact O-N 3.31Å; D23-K27 PolarHBondContact O-N 2.94Å
24	S	48.8	Very low	53.5	Low	78 Å²	78	125.7 Å²	125.7	55%	0.545	59%	0.593	S	S	.	*	H	α-helix	trans	-63.4	-29.4	-179.5	-86.1	0	0	0	114.3	K20	K20-S24 PolarHBondContact O-N 3.13Å
25	K	50.9	Low	55.1	Low	180 Å²	180	125.3 Å²	125.3	78%	0.783	60%	0.599	S	S	*	*	H	α-helix	trans	-83.2	-23.7	-178.3	-164.3	170.6	-178	174.6	113.4	D23	D23-K25 VanDerWaalsContact C-N 3.28Å; D23-K25 PolarHBondContact O-N 3.25Å
26	D	50.2	Low	56.8	Low	85 Å²	85	123.7 Å²	123.7	46%	0.455	61%	0.607	S	S	.	*	H	α-helix	trans	-78.9	-33.9	176.4	-156.5	-98.5	0	0	111.4	D23 E28 K29	D23-D26 PolarHBondContact O-N 3.31Å; D26-E28 VanDerWaalsContact C-N 3.28Å; D26-E28 PolarHBondContact O-N 3.33Å; D26-E28 VanDerWaalsContact O-N 3.16Å; D26-K29 PolarHBondContact O-N 3.26Å
27	K	51.5	Low	58.3	Low	105 Å²	105	121.2 Å²	121.2	46%	0.457	60%	0.598	S	S	.	*	T	Hydrogen-bonded Turn	trans	-60.4	-25.8	-177.4	-145.1	169.1	-168.2	162.8	115.7	D23	D23-K27 PolarHBondContact O-N 2.94Å
28	E	50.1	Low	59.8	Low	179 Å²	179	119.2 Å²	119.2	84%	0.836	59%	0.59	S	S	*	*	T	Hydrogen-bonded Turn	trans	-82.8	-22	-178.6	-114.7	-169.9	103.9	0	113.5	D26	D26-E28 VanDerWaalsContact C-N 3.28Å; D26-E28 PolarHBondContact O-N 3.33Å; D26-E28 VanDerWaalsContact O-N 3.16Å
29	K	52.8	Low	61.4	Low	194 Å²	194	114.5 Å²	114.5	84%	0.843	57%	0.57	S	S	*	*	T	Hydrogen-bonded Turn	trans	-95.1	-14.9	-172.2	-149.1	-179	-179.9	-169.6	113.9	D26	D26-K29 PolarHBondContact O-N 3.26Å
30	D	56.2	Low	63	Low	38 Å²	38	110.1 Å²	110.1	20%	0.203	55%	0.553	C	S	.	*			trans	-106.5	27.4	-169	-138.7	-48	0	0	114.6	K32 F39 S41 Y63	D30-K32 PolarHBondContact O-N 2.89Å; D30-F39 VanDerWaalsContact O-O 3.08Å; D30-S41 WeakPolarHBondContact CB-OG 3.4Å; D30-Y63 HydrophobicContact CB-CE1 4.23Å; D30-Y63 WeakPolarHBondContact OD1-CE1 3.1Å; D30-Y63 PolarHBondContact OD2-OH 3.11Å
31	K	62	Low	64.3	Low	156 Å²	156	102.9 Å²	102.9	68%	0.678	52%	0.522	S	S	*	.			trans	-73.6	85.3	162.9	-77.8	-168.6	-178.7	-169.4	108.8	T38 F39	K31-T38 HydrophobicContact CG-CG2 4.49Å; K31-F39 WeakPolarHBondContact CA-O 3.29Å
32	K	67.1	Low	65.8	Low	138 Å²	138	98.8 Å²	98.8	60%	0.6	50%	0.504	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-96.9	115.3	176	-146.4	178.7	-172.5	-173.9	109.4	D30 V34 F39	D30-K32 PolarHBondContact O-N 2.89Å; K32-V34 HydrophobicContact CG-CG2 4.38Å; K32-V34 PolarHBondContact O-N 2.89Å; K32-F39 PolarHBondContact N-O 3.16Å; K32-F39 PolarHBondContact O-N 3.21Å
33	T	73.2	Confident	67	Low	99 Å²	99	92.8 Å²	92.8	61%	0.607	48%	0.483	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-82.2	116.5	172.6	-43.9	0	0	0	108.7	H37	T33-H37 CarbonylContact C-O 3.55Å; T33-H37 WeakPolarHBondContact CA-O 3.35Å
34	V	79.1	Confident	68.2	Low	62 Å²	62	92.1 Å²	92.1	38%	0.376	48%	0.481	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.4	124	177.9	178	0	0	0	108.2	K32 G36 H37 F39	K32-V34 HydrophobicContact CG-CG2 4.38Å; K32-V34 PolarHBondContact O-N 2.89Å; V34-G36 PolarHBondContact O-N 3.47Å; V34-G36 VanDerWaalsContact O-N 3.11Å; V34-H37 PolarHBondContact N-O 2.74Å; V34-H37 PolarHBondContact O-N 3.1Å; V34-F39 HydrophobicContact CB-CD2 3.89Å; V34-F39 HydrophobicContact CB-CE2 3.78Å; V34-F39 HydrophobicContact CG1-CE2 4.47Å; V34-F39 HydrophobicContact CG2-CD2 4.23Å
35	N	82.6	Confident	69.1	Low	156 Å²	156	94.8 Å²	94.8	83%	0.834	49%	0.494	S	S	*	.	T	Hydrogen-bonded Turn	trans	51.1	35	179	-69.4	45.5	0	0	114.1	H37	N35-H37 VanDerWaalsContact C-N 3.27Å; N35-H37 PolarHBondContact O-N 3.41Å
36	G	83.1	Confident	69.9	Low	71 Å²	71	88.2 Å²	88.2	73%	0.732	48%	0.477	S	S	*	.	T	Hydrogen-bonded Turn	trans	81.7	-3.4	-178.4	0	0	0	0	115.1	V34	V34-G36 PolarHBondContact O-N 3.47Å; V34-G36 VanDerWaalsContact O-N 3.11Å
37	H	81.5	Confident	70.7	Confident	104 Å²	104	91.2 Å²	91.2	48%	0.481	50%	0.501	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-96.4	139.6	171.3	-68.4	-93.7	0	0	110.7	T33 V34 N35 F39 C65	T33-H37 CarbonylContact C-O 3.55Å; T33-H37 WeakPolarHBondContact CA-O 3.35Å; V34-H37 PolarHBondContact N-O 2.74Å; V34-H37 PolarHBondContact O-N 3.1Å; N35-H37 VanDerWaalsContact C-N 3.27Å; N35-H37 PolarHBondContact O-N 3.41Å; H37-F39 HydrophobicContact CB-CD2 4.34Å; H37-F39 HydrophobicContact CB-CE2 3.69Å; H37-F39 HydrophobicContact CB-CZ 4.25Å; H37-C65 HydrophobicContact CB-CB 4.38Å
38	T	82.2	Confident	71.8	Confident	53 Å²	53	89.3 Å²	89.3	33%	0.325	50%	0.495	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.9	115.5	174.6	-57.6	0	0	0	108.3	K31 C65 A66	K31-T38 HydrophobicContact CG-CG2 4.49Å; T38-C65 WeakPolarHBondContact O-CA 3.09Å; T38-A66 PolarHBondContact O-N 2.99Å; T38-A66 VanDerWaalsContact O-N 3.14Å
39	F	82.6	Confident	73.2	Confident	60 Å²	60	84.6 Å²	84.6	26%	0.263	48%	0.482	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.1	143.9	171.8	-68.3	-93.9	0	0	109.3	D30 K31 K32 V34 H37 T64 C65	D30-F39 VanDerWaalsContact O-O 3.08Å; K31-F39 WeakPolarHBondContact CA-O 3.29Å; K32-F39 PolarHBondContact N-O 3.16Å; K32-F39 PolarHBondContact O-N 3.21Å; V34-F39 HydrophobicContact CB-CD2 3.89Å; V34-F39 HydrophobicContact CB-CE2 3.78Å; V34-F39 HydrophobicContact CG1-CE2 4.47Å; V34-F39 HydrophobicContact CG2-CD2 4.23Å; H37-F39 HydrophobicContact CB-CD2 4.34Å; H37-F39 HydrophobicContact CB-CE2 3.69Å; H37-F39 HydrophobicContact CB-CZ 4.25Å; F39-T64 WeakPolarHBondContact CA-O 3.34Å; F39-C65 HydrophobicContact CD1-CB 4.12Å; F39-C65 HydrophobicContact CE1-CB 3.78Å; F39-C65 HydrophobicContact CZ-CB 4.04Å
40	S	78.7	Confident	74.5	Confident	32 Å²	32	76.9 Å²	76.9	22%	0.224	45%	0.452	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-138.2	140.1	174.6	-64.6	0	0	0	109.6	I42 T64	S40-I42 PolarHBondContact O-N 3.14Å; S40-T64 PolarHBondContact N-O 3.5Å; S40-T64 PolarHBondContact O-N 2.85Å; S40-T64 VanDerWaalsContact O-N 3.1Å
41	S	77.4	Confident	75.5	Confident	7 Å²	7	80.4 Å²	80.4	5%	0.049	48%	0.48	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-64.2	127.1	171.5	-60.6	0	0	0	109.7	D30 A62 Y63	D30-S41 WeakPolarHBondContact CB-OG 3.4Å; S41-A62 CarbonylContact C-O 3.54Å; S41-A62 WeakPolarHBondContact CA-O 3.44Å; S41-Y63 WeakPolarHBondContact OG-CE1 3.01Å
42	I	75.5	Confident	76.5	Confident	56 Å²	56	81.6 Å²	81.6	29%	0.287	49%	0.487	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.1	139.6	170.6	57.9	162.3	0	0	109.1	S40 V44 A62 T64	S40-I42 PolarHBondContact O-N 3.14Å; I42-V44 PolarHBondContact O-N 2.99Å; I42-A62 HydrophobicContact CG1-CB 4.14Å; I42-A62 VanDerWaalsContact CG1-O 3.29Å; I42-A62 WeakPolarHBondContact CG1-O 3.35Å; I42-A62 PolarHBondContact N-O 2.89Å; I42-A62 PolarHBondContact O-N 3.41Å; I42-T64 HydrophobicContact CD1-CG2 4.01Å; I42-T64 HydrophobicContact CG1-CG2 4.2Å; I42-T64 HydrophobicContact CG2-CG2 3.64Å
43	P	75	Confident	77.4	Confident	48 Å²	48	78.3 Å²	78.3	31%	0.312	48%	0.481	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-65.5	135.5	170.7	26.6	-32.9	0	0	109.5	V45	P43-V45 PolarHBondContact O-N 2.95Å; P43-V45 VanDerWaalsContact O-N 3.13Å
44	V	72.7	Confident	77.8	Confident	34 Å²	34	81.2 Å²	81.2	21%	0.206	49%	0.49	C	S	.	.			trans	-77.8	99.1	177.6	-179.6	0	0	0	109.1	I42 G46 I48 F57 K60 A62	I42-V44 PolarHBondContact O-N 2.99Å; V44-G46 WeakPolarHBondContact CG1-O 3.43Å; V44-I48 HydrophobicContact CG1-CB 4.03Å; V44-I48 HydrophobicContact CG1-CG2 3.93Å; V44-I48 HydrophobicContact CG2-CG2 4.48Å; V44-F57 HydrophobicContact CG1-CB 4.45Å; V44-F57 HydrophobicContact CG2-CB 4.25Å; V44-K60 PolarHBondContact N-O 2.67Å; V44-A62 HydrophobicContact CG2-CB 3.43Å; V44-A62 VanDerWaalsContact CG2-CB 3.43Å
45	V	66.8	Low	78	Confident	134 Å²	134	84.8 Å²	84.8	81%	0.812	50%	0.5	S	S	*	.			trans	-98.3	89.2	174.6	-87.5	0	0	0	110.5	P43	P43-V45 PolarHBondContact O-N 2.95Å; P43-V45 VanDerWaalsContact O-N 3.13Å
46	G	67.4	Low	77.7	Confident	42 Å²	42	81.8 Å²	81.8	43%	0.433	49%	0.489	S	S	.	.	S	Bend	trans	107.2	177.4	178	0	0	0	0	113.8	V44 I48	V44-G46 WeakPolarHBondContact CG1-O 3.43Å; G46-I48 PolarHBondContact O-N 3.29Å
47	P	67.8	Low	77.4	Confident	147 Å²	147	81.8 Å²	81.8	96%	0.955	47%	0.469	S	S	*	.	S	Bend	trans	-70.5	96.8	-179.9	28.7	-32.6	0	0	109.8
48	I	74.8	Confident	77.1	Confident	66 Å²	66	83.1 Å²	83.1	34%	0.338	49%	0.485	S	S	.	.			trans	-105.9	142.3	178.7	-116.5	172.2	0	0	108.6	V44 G46 P56 F57	V44-I48 HydrophobicContact CG1-CB 4.03Å; V44-I48 HydrophobicContact CG1-CG2 3.93Å; V44-I48 HydrophobicContact CG2-CG2 4.48Å; G46-I48 PolarHBondContact O-N 3.29Å; I48-P56 WeakPolarHBondContact O-CA 3.35Å; I48-F57 HydrophobicContact CB-CD2 4.33Å; I48-F57 HydrophobicContact CG2-CB 4Å; I48-F57 HydrophobicContact CG2-CD2 3.01Å; I48-F57 HydrophobicContact CG2-CE2 3.41Å; I48-F57 VanDerWaalsContact CG2-CE2 3.41Å; I48-F57 HydrophobicContact CG2-CG 3.63Å; I48-F57 HydrophobicContact CG2-CZ 4.35Å; I48-F57 WeakPolarHBondContact O-CD2 3.36Å; I48-F57 PolarHBondContact O-N 2.94Å
49	S	79.7	Confident	76.5	Confident	79 Å²	79	86 Å²	86	55%	0.552	50%	0.499	S	S	*	.	B	Isolated β-bridge	trans	-123.2	139.5	179.2	56.8	0	0	0	111.2	S51 K55	S49-S51 PolarHBondContact O-N 2.92Å; S49-K55 CarbonylContact C-O 3.54Å; S49-K55 WeakPolarHBondContact CA-O 3.42Å
50	C	79	Confident	75.7	Confident	33 Å²	33	90.5 Å²	90.5	22%	0.223	52%	0.518	C	S	.	.			trans	-65.9	126.5	-179.7	176.2	0	0	0	110.7	Q52 C53 M54 K55 F57	C50-Q52 PolarHBondContact O-N 3.24Å; C50-Q52 PolarHBondContact SG-N 3.43Å; C50-Q52 VanDerWaalsContact SG-N 3.45Å; C50-C53 VanDerWaalsContact CB-SG 3.54Å; C50-M54 WeakPolarHBondContact O-CA 3.48Å; C50-M54 PolarHBondContact O-N 2.81Å; C50-K55 PolarHBondContact N-O 3.2Å; C50-F57 VanDerWaalsContact CA-CE2 3.49Å; C50-F57 HydrophobicContact CB-CE2 3.92Å; C50-F57 HydrophobicContact CB-CZ 4.14Å; C50-F57 VanDerWaalsContact N-CE2 3.32Å
51	S	78	Confident	75.4	Confident	112 Å²	112	92.2 Å²	92.2	78%	0.783	52%	0.524	S	S	*	.	T	Hydrogen-bonded Turn	trans	-64.7	-22.2	179.6	-174.2	0	0	0	113.8	S49	S49-S51 PolarHBondContact O-N 2.92Å
52	Q	83.1	Confident	75.4	Confident	180 Å²	180	92 Å²	92	84%	0.841	52%	0.523	S	S	*	.	T	Hydrogen-bonded Turn	trans	-87.2	-40.2	-176.8	-66.2	-63.7	-27.7	0	112.7	C50	C50-Q52 PolarHBondContact O-N 3.24Å; C50-Q52 PolarHBondContact SG-N 3.43Å; C50-Q52 VanDerWaalsContact SG-N 3.45Å
53	C	85.6	Confident	75.6	Confident	69 Å²	69	95.1 Å²	95.1	47%	0.466	53%	0.532	S	S	.	.	T	Hydrogen-bonded Turn	trans	-116	-0	-175.8	65.7	0	0	0	114.1	C50 K55	C50-C53 VanDerWaalsContact CB-SG 3.54Å; C53-K55 HydrophobicContact CB-CG 4.35Å; C53-K55 PolarHBondContact O-N 3.45Å
54	M	81.4	Confident	75.7	Confident	160 Å²	160	95.9 Å²	95.9	79%	0.788	54%	0.536	S	S	*	.			trans	52.5	18	-176.3	-60.6	-139.7	-65.1	0	115	C50	C50-M54 WeakPolarHBondContact O-CA 3.48Å; C50-M54 PolarHBondContact O-N 2.81Å
55	K	82.9	Confident	76.1	Confident	137 Å²	137	97.4 Å²	97.4	60%	0.596	55%	0.548	S	S	*	.	P	Polyproline II helix	trans	-84.5	141.4	176.6	-62.1	-179	-159.5	-71	109.9	S49 C50 C53	S49-K55 CarbonylContact C-O 3.54Å; S49-K55 WeakPolarHBondContact CA-O 3.42Å; C50-K55 PolarHBondContact N-O 3.2Å; C53-K55 HydrophobicContact CB-CG 4.35Å; C53-K55 PolarHBondContact O-N 3.45Å
56	P	76.6	Confident	76.2	Confident	93 Å²	93	97.4 Å²	97.4	60%	0.604	56%	0.562	S	S	*	*	B	Isolated β-bridge	trans	-61.4	143.9	170.6	27.3	-33.4	0	0	109.9	I48 T58	I48-P56 WeakPolarHBondContact O-CA 3.35Å; P56-T58 PolarHBondContact O-N 3.38Å
57	F	77.2	Confident	76.6	Confident	71 Å²	71	100.2 Å²	100.2	31%	0.311	57%	0.568	S	S	.	*	P	Polyproline II helix	trans	-70.1	117.1	171.6	-74.4	-104.3	0	0	108.6	V44 I48 C50 A62	V44-F57 HydrophobicContact CG1-CB 4.45Å; V44-F57 HydrophobicContact CG2-CB 4.25Å; I48-F57 HydrophobicContact CB-CD2 4.33Å; I48-F57 HydrophobicContact CG2-CB 4Å; I48-F57 HydrophobicContact CG2-CD2 3.01Å; I48-F57 HydrophobicContact CG2-CE2 3.41Å; I48-F57 VanDerWaalsContact CG2-CE2 3.41Å; I48-F57 HydrophobicContact CG2-CG 3.63Å; I48-F57 HydrophobicContact CG2-CZ 4.35Å; I48-F57 WeakPolarHBondContact O-CD2 3.36Å; I48-F57 PolarHBondContact O-N 2.94Å; C50-F57 VanDerWaalsContact CA-CE2 3.49Å; C50-F57 HydrophobicContact CB-CE2 3.92Å; C50-F57 HydrophobicContact CB-CZ 4.14Å; C50-F57 VanDerWaalsContact N-CE2 3.32Å; F57-A62 HydrophobicContact CD1-CB 3.53Å; F57-A62 HydrophobicContact CE1-CB 3.36Å; F57-A62 HydrophobicContact CG-CB 4.25Å; F57-A62 HydrophobicContact CZ-CB 3.91Å
58	T	74.2	Confident	77	Confident	133 Å²	133	97.7 Å²	97.7	82%	0.816	55%	0.548	S	S	*	.			trans	-89.4	-10.5	176.7	57.3	0	0	0	112.5	P56	P56-T58 PolarHBondContact O-N 3.38Å
59	N	69.1	Low	77.2	Confident	114 Å²	114	99.5 Å²	99.5	61%	0.61	56%	0.559	S	S	*	*	S	Bend	trans	-99	159.1	176.7	-90.3	-66	0	0	111.3	D61	N59-D61 PolarHBondContact O-N 2.78Å
60	K	67.7	Low	77	Confident	154 Å²	154	100.7 Å²	100.7	67%	0.67	56%	0.56	S	S	*	*	S	Bend	trans	-73.8	-18.1	-179.2	-51.3	-178.7	-176.1	-164.5	112.2	V44	V44-K60 PolarHBondContact N-O 2.67Å
61	D	71.1	Confident	76.9	Confident	67 Å²	67	104.9 Å²	104.9	36%	0.358	58%	0.581	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-119.8	132.8	-174	-48.6	-75	0	0	109.2	N59	N59-D61 PolarHBondContact O-N 2.78Å
62	A	78.2	Confident	76.8	Confident	3 Å²	3	104.5 Å²	104.5	3%	0.025	57%	0.567	C	S	.	*	E	Extended strand (participates in β ladder)	trans	-124.9	153.1	175.1	0	0	0	0	109.9	S41 I42 V44 F57	S41-A62 CarbonylContact C-O 3.54Å; S41-A62 WeakPolarHBondContact CA-O 3.44Å; I42-A62 HydrophobicContact CG1-CB 4.14Å; I42-A62 VanDerWaalsContact CG1-O 3.29Å; I42-A62 WeakPolarHBondContact CG1-O 3.35Å; I42-A62 PolarHBondContact N-O 2.89Å; I42-A62 PolarHBondContact O-N 3.41Å; V44-A62 HydrophobicContact CG2-CB 3.43Å; V44-A62 VanDerWaalsContact CG2-CB 3.43Å; F57-A62 HydrophobicContact CD1-CB 3.53Å; F57-A62 HydrophobicContact CE1-CB 3.36Å; F57-A62 HydrophobicContact CG-CB 4.25Å; F57-A62 HydrophobicContact CZ-CB 3.91Å
63	Y	79.3	Confident	76.4	Confident	122 Å²	122	99.1 Å²	99.1	48%	0.478	55%	0.548	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.8	127.1	174.1	-66.8	-78	0	0	109.6	D30 S41	D30-Y63 HydrophobicContact CB-CE1 4.23Å; D30-Y63 WeakPolarHBondContact OD1-CE1 3.1Å; D30-Y63 PolarHBondContact OD2-OH 3.11Å; S41-Y63 WeakPolarHBondContact OG-CE1 3.01Å
64	T	77.9	Confident	75.7	Confident	63 Å²	63	101.4 Å²	101.4	39%	0.387	55%	0.554	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-114.7	142.8	169	-165.9	0	0	0	109.5	F39 S40 I42	F39-T64 WeakPolarHBondContact CA-O 3.34Å; S40-T64 PolarHBondContact N-O 3.5Å; S40-T64 PolarHBondContact O-N 2.85Å; S40-T64 VanDerWaalsContact O-N 3.1Å; I42-T64 HydrophobicContact CD1-CG2 4.01Å; I42-T64 HydrophobicContact CG1-CG2 4.2Å; I42-T64 HydrophobicContact CG2-CG2 3.64Å
65	C	79.4	Confident	75.2	Confident	67 Å²	67	96.5 Å²	96.5	45%	0.453	54%	0.535	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-78.4	143.5	163.5	57.5	0	0	0	109.4	H37 T38 F39	H37-C65 HydrophobicContact CB-CB 4.38Å; T38-C65 WeakPolarHBondContact O-CA 3.09Å; F39-C65 HydrophobicContact CD1-CB 4.12Å; F39-C65 HydrophobicContact CE1-CB 3.78Å; F39-C65 HydrophobicContact CZ-CB 4.04Å
66	A	68.8	Low	74.5	Confident	134 Å²	134	92.8 Å²	92.8	100%	1.107	53%	0.529	S	S	*	.			trans	-110.9	0	166.3	0	0	0	0	109.8	T38	T38-A66 PolarHBondContact O-N 2.99Å; T38-A66 VanDerWaalsContact O-N 3.14Å

Retrieved 66 of 66 residues in 414.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).