A0A087WYU0_HUMAN Loading...

26S proteasome complex subunit SEM1

Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins.

AlphaFold DB , UniProt , Accession A0A087WYU0, Species HUMAN (Homo sapiens, Human), Gene SEM1, Length 66 aa.

						>A0A087WYU0_HUMAN|A0A087WYU0|SEM1
MSEKKQPVDLGLLEEDDEFEEFPAEDWAGLDEDEDAHVWEDNWDDDNVEDDFSNQLRDMGNVSISV
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	36.1	Very low	51.5	Low	241 Å²	241	133.3 Å²	133.3	100%	1.187	70%	0.7	S	S	*	*				0	121.2	0	-74.3	-62.7	-171.3	0	0	106.7
2	S	45	Very low	51.8	Low	107 Å²	107	131.5 Å²	131.5	75%	0.748	69%	0.691	S	S	*	*			trans	-57.3	131.8	-164.1	-60.1	0	0	0	0	114.2	K4	S2-K4 PolarHBondContact O-N 2.76Å
3	E	52.1	Low	52	Low	149 Å²	149	127.7 Å²	127.7	70%	0.696	67%	0.671	S	S	*	*			trans	-57.4	123.9	155.8	179.4	139.7	30.5	0	0	109.7	K5	E3-K5 HydrophobicContact CG-CG 4.44Å; E3-K5 IonicContact OE2-NZ 2.71Å; E3-K5 PolarHBondContact OE2-NZ 3.13Å
4	K	46.7	Very low	52.2	Low	174 Å²	174	128.4 Å²	128.4	76%	0.757	67%	0.669	S	S	*	*			trans	-127.6	88.3	161.2	-70.1	-166.5	179.4	78.6	0	106.3	S2 Q6	S2-K4 PolarHBondContact O-N 2.76Å; K4-Q6 PolarHBondContact O-N 2.79Å
5	K	55.1	Low	52.3	Low	166 Å²	166	128.7 Å²	128.7	72%	0.722	67%	0.665	S	S	*	*			trans	-57	107.5	158.9	-80.7	-177.3	169.2	75.4	0	105.8	E3	E3-K5 HydrophobicContact CG-CG 4.44Å; E3-K5 IonicContact OE2-NZ 2.71Å; E3-K5 PolarHBondContact OE2-NZ 3.13Å
6	Q	57.3	Low	52.5	Low	158 Å²	158	128.3 Å²	128.3	74%	0.738	67%	0.665	S	S	*	*			trans	-51.6	134.2	164.8	-63.1	-96.3	-56.8	0	0	105.9	K4 V8	K4-Q6 PolarHBondContact O-N 2.79Å; Q6-V8 VanDerWaalsContact C-N 3.31Å; Q6-V8 PolarHBondContact O-N 2.71Å
7	P	52.3	Low	53	Low	123 Å²	123	129.8 Å²	129.8	80%	0.799	67%	0.674	S	S	*	*			trans	-59.1	106.5	169.3	26.3	-30.6	0	0	0	105.4	D9	P7-D9 PolarHBondContact O-N 3.05Å
8	V	56.9	Low	53.7	Low	97 Å²	97	131.7 Å²	131.7	59%	0.588	68%	0.679	S	S	*	*			trans	-57.2	124.4	173.2	-170.4	0	0	0	0	104.7	Q6 L10 L13	Q6-V8 VanDerWaalsContact C-N 3.31Å; Q6-V8 PolarHBondContact O-N 2.71Å; V8-L10 PolarHBondContact O-N 2.7Å; V8-L13 HydrophobicContact CB-CD1 4.12Å; V8-L13 HydrophobicContact CG1-CD1 3.53Å; V8-L13 HydrophobicContact CG1-CD2 4.43Å; V8-L13 HydrophobicContact CG1-CG 4.02Å
9	D	53.9	Low	54.1	Low	110 Å²	110	132.7 Å²	132.7	59%	0.588	68%	0.678	S	S	*	*			trans	-63.1	100.4	-175.7	-165.6	8.7	0	0	0	107.6	P7 G11 L12	P7-D9 PolarHBondContact O-N 3.05Å; D9-G11 PolarHBondContact O-N 2.65Å; D9-G11 VanDerWaalsContact O-N 3.12Å; D9-L12 HydrophobicContact CB-CD1 4.18Å; D9-L12 WeakPolarHBondContact O-CB 3.5Å; D9-L12 PolarHBondContact O-N 3.16Å
10	L	55.4	Low	54.6	Low	113 Å²	113	133.6 Å²	133.6	59%	0.592	68%	0.68	S	S	*	*	H	α-helix	trans	-63.4	-19.7	-170.4	-67.8	168	0	0	0	111.4	V8 L13 E14	V8-L10 PolarHBondContact O-N 2.7Å; L10-L13 HydrophobicContact CD2-CD1 4.11Å; L10-L13 PolarHBondContact O-N 2.87Å; L10-E14 WeakPolarHBondContact O-CB 3.25Å; L10-E14 VanDerWaalsContact O-CG 3.26Å; L10-E14 WeakPolarHBondContact O-CG 3.39Å; L10-E14 PolarHBondContact O-N 3.04Å
11	G	55.8	Low	55.1	Low	28 Å²	28	136.7 Å²	136.7	29%	0.289	69%	0.692	S	S	.	*	H	α-helix	trans	-64.9	-39.5	171	0	0	0	0	0	113	D9 L13 E14 E15	D9-G11 PolarHBondContact O-N 2.65Å; D9-G11 VanDerWaalsContact O-N 3.12Å; G11-L13 PolarHBondContact O-N 3.26Å; G11-E14 PolarHBondContact O-N 3.21Å; G11-E15 WeakPolarHBondContact O-CB 3.26Å; G11-E15 WeakPolarHBondContact O-CG 3.39Å; G11-E15 PolarHBondContact O-N 3.46Å
12	L	55.6	Low	56	Low	112 Å²	112	131.8 Å²	131.8	59%	0.586	66%	0.664	S	S	*	*	H	α-helix	trans	-69.9	-20.9	174.5	-79	167.7	0	0	0	113.1	D9	D9-L12 HydrophobicContact CB-CD1 4.18Å; D9-L12 WeakPolarHBondContact O-CB 3.5Å; D9-L12 PolarHBondContact O-N 3.16Å
13	L	54.2	Low	56.9	Low	82 Å²	82	132 Å²	132	43%	0.429	66%	0.662	S	S	.	*	H	α-helix	trans	-89.7	-34	175.3	-67.7	173.5	0	0	0	112	V8 L10 G11 E15 D16 D17	V8-L13 HydrophobicContact CB-CD1 4.12Å; V8-L13 HydrophobicContact CG1-CD1 3.53Å; V8-L13 HydrophobicContact CG1-CD2 4.43Å; V8-L13 HydrophobicContact CG1-CG 4.02Å; L10-L13 HydrophobicContact CD2-CD1 4.11Å; L10-L13 PolarHBondContact O-N 2.87Å; G11-L13 PolarHBondContact O-N 3.26Å; L13-E15 VanDerWaalsContact C-N 3.33Å; L13-D16 PolarHBondContact O-N 3.34Å; L13-D17 PolarHBondContact O-N 3.3Å
14	E	53.9	Low	57.3	Low	138 Å²	138	129.7 Å²	129.7	65%	0.645	67%	0.669	S	S	*	*	H	α-helix	trans	-68.3	-33.9	172.4	-74.6	172.8	-163.7	0	0	111.1	L10 G11 D16 D17 E18	L10-E14 WeakPolarHBondContact O-CB 3.25Å; L10-E14 VanDerWaalsContact O-CG 3.26Å; L10-E14 WeakPolarHBondContact O-CG 3.39Å; L10-E14 PolarHBondContact O-N 3.04Å; G11-E14 PolarHBondContact O-N 3.21Å; E14-D16 VanDerWaalsContact C-N 3.31Å; E14-D16 PolarHBondContact O-N 2.83Å; E14-D17 PolarHBondContact O-N 3.37Å; E14-E18 PolarHBondContact O-N 3.27Å
15	E	54.5	Low	57.8	Low	132 Å²	132	127.9 Å²	127.9	62%	0.617	66%	0.663	S	S	*	*	H	α-helix	trans	-67.4	-26.5	171.4	-72.6	168.8	-151.5	0	0	113.1	G11 L13 E18	G11-E15 WeakPolarHBondContact O-CB 3.26Å; G11-E15 WeakPolarHBondContact O-CG 3.39Å; G11-E15 PolarHBondContact O-N 3.46Å; L13-E15 VanDerWaalsContact C-N 3.33Å; E15-E18 PolarHBondContact O-N 3.44Å
16	D	54.9	Low	57.8	Low	122 Å²	122	126.9 Å²	126.9	65%	0.652	67%	0.666	S	S	*	*	H	α-helix	trans	-78.8	-25.3	178.1	-155.6	27.4	0	0	0	112	L13 E14	L13-D16 PolarHBondContact O-N 3.34Å; E14-D16 VanDerWaalsContact C-N 3.31Å; E14-D16 PolarHBondContact O-N 2.83Å
17	D	60.6	Low	57.7	Low	155 Å²	155	127 Å²	127	83%	0.829	66%	0.66	S	S	*	*	H	α-helix	trans	-83.5	-13.8	171	-92.2	-17.1	0	0	0	112.8	L13 E14	L13-D17 PolarHBondContact O-N 3.3Å; E14-D17 PolarHBondContact O-N 3.37Å
18	E	66.3	Low	57.7	Low	163 Å²	163	125.3 Å²	125.3	76%	0.762	66%	0.656	S	S	*	*	S	Bend	trans	-95.5	3.7	177.4	-162.2	160.9	-159.9	0	0	112.7	E14 E15 E20	E14-E18 PolarHBondContact O-N 3.27Å; E15-E18 PolarHBondContact O-N 3.44Å; E18-E20 PolarHBondContact O-N 3.38Å
19	F	61.5	Low	57.6	Low	151 Å²	151	123.7 Å²	123.7	66%	0.662	66%	0.659	S	S	*	*	S	Bend	trans	-64.2	118.1	165.5	-155.4	-98.5	0	0	0	108.2	E21 F22	F19-E21 PolarHBondContact O-N 3.5Å; F19-E21 VanDerWaalsContact O-N 3.16Å; F19-F22 HydrophobicContact CD1-CD2 4.18Å; F19-F22 HydrophobicContact CD1-CE2 4.33Å; F19-F22 AromaticContact CE1-CD2 3.61Å; F19-F22 HydrophobicContact CE1-CD2 3.61Å; F19-F22 AromaticContact CE1-CE2 3.65Å; F19-F22 HydrophobicContact CE1-CE2 3.65Å; F19-F22 HydrophobicContact CZ-CD2 4.32Å; F19-F22 AromaticContact CZ-CE2 3.93Å; F19-F22 HydrophobicContact CZ-CE2 3.93Å
20	E	64.4	Low	57.5	Low	151 Å²	151	124.3 Å²	124.3	71%	0.706	66%	0.661	S	S	*	*			trans	-50.2	126.7	177.4	-71.4	-170.7	177.2	0	0	108.8	E18 F22	E18-E20 PolarHBondContact O-N 3.38Å; E20-F22 VanDerWaalsContact O-CD2 3.25Å; E20-F22 WeakPolarHBondContact O-CD2 3.17Å; E20-F22 PolarHBondContact O-N 3.31Å
21	E	63.8	Low	57.4	Low	199 Å²	199	123.6 Å²	123.6	93%	0.93	66%	0.658	S	S	*	*			trans	-57.7	85.9	165.7	-95.9	-174.6	163.2	0	0	106.8	F19	F19-E21 PolarHBondContact O-N 3.5Å; F19-E21 VanDerWaalsContact O-N 3.16Å
22	F	55.8	Low	57.3	Low	137 Å²	137	131 Å²	131	60%	0.601	69%	0.685	S	S	*	*			trans	-54.5	134	170	-82.4	-88.5	0	0	0	105.6	F19 E20 A24	F19-F22 HydrophobicContact CD1-CD2 4.18Å; F19-F22 HydrophobicContact CD1-CE2 4.33Å; F19-F22 AromaticContact CE1-CD2 3.61Å; F19-F22 HydrophobicContact CE1-CD2 3.61Å; F19-F22 AromaticContact CE1-CE2 3.65Å; F19-F22 HydrophobicContact CE1-CE2 3.65Å; F19-F22 HydrophobicContact CZ-CD2 4.32Å; F19-F22 AromaticContact CZ-CE2 3.93Å; F19-F22 HydrophobicContact CZ-CE2 3.93Å; E20-F22 VanDerWaalsContact O-CD2 3.25Å; E20-F22 WeakPolarHBondContact O-CD2 3.17Å; E20-F22 PolarHBondContact O-N 3.31Å; F22-A24 PolarHBondContact O-N 2.96Å
23	P	65.1	Low	57.3	Low	111 Å²	111	130.7 Å²	130.7	72%	0.721	69%	0.685	S	S	*	*			trans	-49	128.4	171.8	22.8	-32	0	0	0	106.3	E25	P23-E25 VanDerWaalsContact C-N 3.26Å; P23-E25 PolarHBondContact O-N 3.41Å
24	A	58.8	Low	57.3	Low	101 Å²	101	133.6 Å²	133.6	84%	0.835	70%	0.696	S	S	*	*			trans	-52.2	103.7	174.9	0	0	0	0	0	106	F22 D26	F22-A24 PolarHBondContact O-N 2.96Å; A24-D26 PolarHBondContact O-N 2.83Å; A24-D26 VanDerWaalsContact O-N 3.13Å
25	E	57.8	Low	57.3	Low	136 Å²	136	131.2 Å²	131.2	64%	0.636	69%	0.688	S	S	*	*			trans	-60.9	125.1	179.8	-166.5	139.9	-156.2	0	0	104.2	P23 W27	P23-E25 VanDerWaalsContact C-N 3.26Å; P23-E25 PolarHBondContact O-N 3.41Å; E25-W27 PolarHBondContact O-N 3.06Å
26	D	55.4	Low	57.3	Low	146 Å²	146	127 Å²	127	78%	0.781	68%	0.675	S	S	*	*			trans	-70.1	78.2	-179.5	-137.7	-33.1	0	0	0	105.2	A24 A28	A24-D26 PolarHBondContact O-N 2.83Å; A24-D26 VanDerWaalsContact O-N 3.13Å; D26-A28 PolarHBondContact O-N 3.22Å
27	W	55.8	Low	57.4	Low	161 Å²	161	125.9 Å²	125.9	61%	0.61	67%	0.666	S	S	*	*			trans	-66.1	29.3	175.7	-69.3	100.3	0	0	0	111.2	E25 G29 D35	E25-W27 PolarHBondContact O-N 3.06Å; W27-G29 PolarHBondContact O-N 3.31Å; W27-D35 WeakPolarHBondContact CH2-OD2 3.42Å
28	A	52.3	Low	57.4	Low	86 Å²	86	122.2 Å²	122.2	71%	0.711	65%	0.649	S	S	*	*	S	Bend	trans	-71.4	66.5	172	0	0	0	0	0	109.4	D26	D26-A28 PolarHBondContact O-N 3.22Å
29	G	53.9	Low	57.1	Low	64 Å²	64	124 Å²	124	66%	0.66	65%	0.649	S	S	*	*	S	Bend	trans	87.3	40.2	163.4	0	0	0	0	0	116.1	W27	W27-G29 PolarHBondContact O-N 3.31Å
30	L	52.4	Low	56.9	Low	122 Å²	122	123.1 Å²	123.1	64%	0.639	65%	0.647	S	S	*	*	S	Bend	trans	-81.2	118.5	146.9	-78.9	165.6	0	0	0	105.9	E32	L30-E32 PolarHBondContact O-N 3.42Å
31	D	52.9	Low	56.7	Low	99 Å²	99	121.2 Å²	121.2	53%	0.529	64%	0.641	S	S	.	*			trans	-38.3	117.6	-165.3	-62.4	-81.5	0	0	0	113.1	D33 E34	D31-D33 HydrophobicContact CB-CB 4.4Å; D31-D33 PolarHBondContact O-N 2.79Å; D31-E34 PolarHBondContact O-N 2.93Å
32	E	54.6	Low	56.4	Low	182 Å²	182	117.1 Å²	117.1	85%	0.85	63%	0.626	S	S	*	*	H	α-helix	trans	-53.8	-12.1	170.5	-76.1	178.4	161.7	0	0	112.5	L30	L30-E32 PolarHBondContact O-N 3.42Å
33	D	54.3	Low	56.9	Low	107 Å²	107	120.4 Å²	120.4	57%	0.572	63%	0.634	S	S	*	*	H	α-helix	trans	-78.6	-34.8	178.5	-57.5	-41.6	0	0	0	112.7	D31 H37	D31-D33 HydrophobicContact CB-CB 4.4Å; D31-D33 PolarHBondContact O-N 2.79Å; D33-H37 PolarHBondContact O-CD2 3.38Å; D33-H37 VanDerWaalsContact O-CG 3.27Å; D33-H37 PolarHBondContact O-N 2.87Å
34	E	54.8	Low	56.6	Low	142 Å²	142	122 Å²	122	66%	0.664	64%	0.637	S	S	*	*	H	α-helix	trans	-74.5	-37.4	-174.3	-76.6	-161.1	148.2	0	0	113.5	D31	D31-E34 PolarHBondContact O-N 2.93Å
35	D	53.8	Low	56.5	Low	89 Å²	89	121.5 Å²	121.5	48%	0.476	62%	0.62	S	S	.	*	H	α-helix	trans	-71.2	-39.1	177.9	-99.4	-36.2	0	0	0	111.2	W27 H37 V38	W27-D35 WeakPolarHBondContact CH2-OD2 3.42Å; D35-H37 VanDerWaalsContact C-N 3.29Å; D35-H37 PolarHBondContact O-N 2.71Å; D35-V38 PolarHBondContact O-N 3.36Å
36	A	54.9	Low	56.5	Low	43 Å²	43	120.3 Å²	120.3	36%	0.355	62%	0.618	S	S	.	*	H	α-helix	trans	-62.4	-35.7	177.5	0	0	0	0	0	112.6	V38 W39 E40	A36-V38 VanDerWaalsContact C-N 3.28Å; A36-V38 PolarHBondContact O-N 3.27Å; A36-W39 PolarHBondContact O-N 2.99Å; A36-E40 PolarHBondContact O-N 3.12Å
37	H	57.2	Low	56.6	Low	99 Å²	99	119.6 Å²	119.6	46%	0.458	61%	0.614	S	S	.	*	H	α-helix	trans	-59.8	-34.9	177.7	-75.9	-45.6	0	0	0	113.2	D33 D35 W39 D41	D33-H37 PolarHBondContact O-CD2 3.38Å; D33-H37 VanDerWaalsContact O-CG 3.27Å; D33-H37 PolarHBondContact O-N 2.87Å; D35-H37 VanDerWaalsContact C-N 3.29Å; D35-H37 PolarHBondContact O-N 2.71Å; H37-W39 VanDerWaalsContact C-N 3.32Å; H37-W39 PolarHBondContact O-N 3.36Å; H37-D41 WeakPolarHBondContact O-CB 3.48Å; H37-D41 VanDerWaalsContact O-CG 3.25Å; H37-D41 PolarHBondContact O-N 3.01Å
38	V	59.1	Low	56.6	Low	77 Å²	77	116.3 Å²	116.3	47%	0.467	61%	0.612	S	S	.	*	H	α-helix	trans	-70.3	-29.5	-179.2	-177.3	0	0	0	0	112.3	D35 A36 N42	D35-V38 PolarHBondContact O-N 3.36Å; A36-V38 VanDerWaalsContact C-N 3.28Å; A36-V38 PolarHBondContact O-N 3.27Å; V38-N42 WeakPolarHBondContact O-CB 3.17Å; V38-N42 PolarHBondContact O-ND2 3.41Å
39	W	61.6	Low	56.8	Low	202 Å²	202	118.7 Å²	118.7	77%	0.765	61%	0.608	S	S	*	*	H	α-helix	trans	-89.5	-29.6	-179.9	-61.5	90.1	0	0	0	112.7	A36 H37 W43	A36-W39 PolarHBondContact O-N 2.99Å; H37-W39 VanDerWaalsContact C-N 3.32Å; H37-W39 PolarHBondContact O-N 3.36Å; W39-W43 WeakPolarHBondContact O-CB 3.48Å
40	E	56.3	Low	57.2	Low	132 Å²	132	119.7 Å²	119.7	62%	0.617	60%	0.599	S	S	*	*	H	α-helix	trans	-77.5	-43.4	174.1	-68.7	-171.1	171.1	0	0	111.9	A36 N42 W43 D44	A36-E40 PolarHBondContact O-N 3.12Å; E40-N42 PolarHBondContact O-N 3.18Å; E40-W43 PolarHBondContact O-N 2.84Å; E40-D44 PolarHBondContact O-N 3.43Å
41	D	60.4	Low	58.1	Low	111 Å²	111	118.8 Å²	118.8	59%	0.594	59%	0.594	S	S	*	*	H	α-helix	trans	-68	-33.1	-177.5	-74.9	-19.2	0	0	0	112.7	H37	H37-D41 WeakPolarHBondContact O-CB 3.48Å; H37-D41 VanDerWaalsContact O-CG 3.25Å; H37-D41 PolarHBondContact O-N 3.01Å
42	N	57.2	Low	58.7	Low	113 Å²	113	120.9 Å²	120.9	60%	0.604	60%	0.599	S	S	*	*	T	Hydrogen-bonded Turn	trans	-86.9	-7.9	-178.2	-69.7	-37.4	0	0	0	114	V38 E40	V38-N42 WeakPolarHBondContact O-CB 3.17Å; V38-N42 PolarHBondContact O-ND2 3.41Å; E40-N42 PolarHBondContact O-N 3.18Å
43	W	67.4	Low	59.6	Low	205 Å²	205	114.5 Å²	114.5	78%	0.777	58%	0.575	S	S	*	*	T	Hydrogen-bonded Turn	trans	-99.3	-29.2	177.6	-169.3	12.2	0	0	0	112.2	W39 E40 D45	W39-W43 WeakPolarHBondContact O-CB 3.48Å; E40-W43 PolarHBondContact O-N 2.84Å; W43-D45 VanDerWaalsContact C-N 3.31Å
44	D	58.4	Low	60.5	Low	144 Å²	144	112.7 Å²	112.7	77%	0.77	57%	0.565	S	S	*	*	G	3₁₀ helix	trans	-80.6	-9	168.7	-99.2	-33.7	0	0	0	113.3	E40 D46 N47	E40-D44 PolarHBondContact O-N 3.43Å; D44-D46 PolarHBondContact O-N 3Å; D44-N47 PolarHBondContact O-N 3.03Å
45	D	57.1	Low	61.5	Low	91 Å²	91	111.1 Å²	111.1	49%	0.487	56%	0.557	S	S	.	*	G	3₁₀ helix	trans	-72.3	-4.1	176.3	-153.7	31.8	0	0	0	113.7	W43 N47 V48	W43-D45 VanDerWaalsContact C-N 3.31Å; D45-N47 PolarHBondContact O-N 3.38Å; D45-V48 PolarHBondContact O-N 3.44Å; D45-V48 WeakPolarHBondContact OD1-CG2 2.95Å
46	D	56.7	Low	62.4	Low	112 Å²	112	112.2 Å²	112.2	60%	0.599	56%	0.563	S	S	*	*	G	3₁₀ helix	trans	-58.5	-13	166.9	-92.1	-26.8	0	0	0	112.5	D44 V48 E49	D44-D46 PolarHBondContact O-N 3Å; D46-V48 VanDerWaalsContact C-N 3.28Å; D46-V48 PolarHBondContact O-N 3.42Å; D46-E49 PolarHBondContact O-N 3.46Å
47	N	57.6	Low	63.3	Low	130 Å²	130	118.7 Å²	118.7	70%	0.695	58%	0.578	S	S	*	*	G	3₁₀ helix	trans	-70.6	-19.9	172.2	-165.8	26.4	0	0	0	113.4	D44 D45 E49 D50	D44-N47 PolarHBondContact O-N 3.03Å; D45-N47 PolarHBondContact O-N 3.38Å; N47-E49 VanDerWaalsContact C-N 3.26Å; N47-E49 PolarHBondContact O-N 3.24Å; N47-D50 PolarHBondContact O-N 3.47Å
48	V	56.3	Low	64	Low	93 Å²	93	119.2 Å²	119.2	56%	0.564	58%	0.584	S	S	*	*	H	α-helix	trans	-75.4	-18.5	177.1	-171.6	0	0	0	0	111.6	D45 D46 D50	D45-V48 PolarHBondContact O-N 3.44Å; D45-V48 WeakPolarHBondContact OD1-CG2 2.95Å; D46-V48 VanDerWaalsContact C-N 3.28Å; D46-V48 PolarHBondContact O-N 3.42Å; V48-D50 VanDerWaalsContact C-N 3.27Å; V48-D50 PolarHBondContact O-N 2.85Å
49	E	56.2	Low	64.3	Low	135 Å²	135	122.2 Å²	122.2	63%	0.631	60%	0.595	S	S	*	*	H	α-helix	trans	-73.5	-17.5	175.6	-146.3	-176.3	110.1	0	0	113	D46 N47 S53	D46-E49 PolarHBondContact O-N 3.46Å; N47-E49 VanDerWaalsContact C-N 3.26Å; N47-E49 PolarHBondContact O-N 3.24Å; E49-S53 WeakPolarHBondContact O-CB 3.33Å; E49-S53 PolarHBondContact O-N 3.41Å; E49-S53 PolarHBondContact O-OG 3.33Å
50	D	62.7	Low	64.6	Low	86 Å²	86	114 Å²	114	46%	0.46	57%	0.573	S	S	.	*	H	α-helix	trans	-75.5	-36.2	180	-157.6	53.8	0	0	0	112.2	N47 V48 S53 N54	N47-D50 PolarHBondContact O-N 3.47Å; V48-D50 VanDerWaalsContact C-N 3.27Å; V48-D50 PolarHBondContact O-N 2.85Å; D50-S53 PolarHBondContact O-N 3.25Å; D50-N54 VanDerWaalsContact O-CB 3.23Å; D50-N54 WeakPolarHBondContact O-CB 3.28Å; D50-N54 PolarHBondContact O-N 2.85Å; D50-N54 PolarHBondContact O-ND2 3.48Å; D50-N54 PolarHBondContact OD2-ND2 3Å
51	D	69.7	Low	65	Low	103 Å²	103	112.6 Å²	112.6	55%	0.551	57%	0.57	S	S	*	*	H	α-helix	trans	-69.7	-36.7	-179.3	-162.5	41.1	0	0	0	112.2	N54 Q55	D51-N54 PolarHBondContact O-N 3.32Å; D51-Q55 VanDerWaalsContact O-CG 3.28Å; D51-Q55 WeakPolarHBondContact O-CG 3.44Å; D51-Q55 PolarHBondContact O-N 3.47Å; D51-Q55 PolarHBondContact OD2-NE2 2.93Å
52	F	66.3	Low	65	Low	143 Å²	143	112.3 Å²	112.3	63%	0.627	57%	0.572	S	S	*	*	H	α-helix	trans	-67.9	-40	173.9	-148.8	-93.2	0	0	0	111.5	Q55 L56	F52-Q55 PolarHBondContact O-N 3.17Å; F52-L56 HydrophobicContact CD1-CD1 4.13Å; F52-L56 HydrophobicContact CE1-CD1 4.34Å; F52-L56 WeakPolarHBondContact O-CG 3.23Å; F52-L56 PolarHBondContact O-N 2.79Å; F52-L56 VanDerWaalsContact O-N 3.17Å
53	S	73.8	Confident	65.1	Low	48 Å²	48	111.1 Å²	111.1	34%	0.336	57%	0.572	S	S	.	*	H	α-helix	trans	-66.8	-39.2	175.8	-65.7	0	0	0	0	112.4	E49 D50 L56 R57	E49-S53 WeakPolarHBondContact O-CB 3.33Å; E49-S53 PolarHBondContact O-N 3.41Å; E49-S53 PolarHBondContact O-OG 3.33Å; D50-S53 PolarHBondContact O-N 3.25Å; S53-L56 PolarHBondContact O-N 2.94Å; S53-R57 WeakPolarHBondContact O-CG 3.35Å; S53-R57 PolarHBondContact O-N 3.31Å
54	N	72.9	Confident	64.8	Low	68 Å²	68	108 Å²	108	36%	0.364	57%	0.57	S	S	.	*	H	α-helix	trans	-66.3	-42.3	176.1	-74	-37	0	0	0	111.3	D50 D51 L56 R57 D58	D50-N54 VanDerWaalsContact O-CB 3.23Å; D50-N54 WeakPolarHBondContact O-CB 3.28Å; D50-N54 PolarHBondContact O-N 2.85Å; D50-N54 PolarHBondContact O-ND2 3.48Å; D50-N54 PolarHBondContact OD2-ND2 3Å; D51-N54 PolarHBondContact O-N 3.32Å; N54-L56 PolarHBondContact O-N 3.43Å; N54-R57 PolarHBondContact O-N 3.06Å; N54-D58 WeakPolarHBondContact O-CB 3.28Å; N54-D58 PolarHBondContact O-N 3.01Å
55	Q	76	Confident	64.7	Low	109 Å²	109	106.4 Å²	106.4	51%	0.509	57%	0.569	S	S	.	*	H	α-helix	trans	-61.3	-42	174.8	-74	175.2	35.8	0	0	112.8	D51 F52 D58 M59	D51-Q55 VanDerWaalsContact O-CG 3.28Å; D51-Q55 WeakPolarHBondContact O-CG 3.44Å; D51-Q55 PolarHBondContact O-N 3.47Å; D51-Q55 PolarHBondContact OD2-NE2 2.93Å; F52-Q55 PolarHBondContact O-N 3.17Å; Q55-D58 PolarHBondContact O-N 3.47Å; Q55-M59 VanDerWaalsContact O-CB 3.28Å; Q55-M59 WeakPolarHBondContact O-CB 3.46Å; Q55-M59 PolarHBondContact O-N 3.25Å
56	L	71.9	Confident	64.3	Low	112 Å²	112	111.3 Å²	111.3	59%	0.586	60%	0.602	S	S	*	*	H	α-helix	trans	-66.4	-38.9	176.9	-73.2	171.8	0	0	0	112.5	F52 S53 N54 G60	F52-L56 HydrophobicContact CD1-CD1 4.13Å; F52-L56 HydrophobicContact CE1-CD1 4.34Å; F52-L56 WeakPolarHBondContact O-CG 3.23Å; F52-L56 PolarHBondContact O-N 2.79Å; F52-L56 VanDerWaalsContact O-N 3.17Å; S53-L56 PolarHBondContact O-N 2.94Å; N54-L56 PolarHBondContact O-N 3.43Å; L56-G60 PolarHBondContact O-N 2.92Å
57	R	74.8	Confident	64.7	Low	180 Å²	180	111.3 Å²	111.3	68%	0.679	60%	0.602	S	S	*	*	H	α-helix	trans	-64.8	-43.8	174.7	-77.9	176.7	136.3	-177	-1.6	111.9	S53 N54 G60 N61	S53-R57 WeakPolarHBondContact O-CG 3.35Å; S53-R57 PolarHBondContact O-N 3.31Å; N54-R57 PolarHBondContact O-N 3.06Å; R57-G60 PolarHBondContact O-N 3.42Å; R57-N61 PolarHBondContact O-N 3.4Å; R57-N61 PolarHBondContact O-OD1 3.34Å
58	D	72.7	Confident	65.1	Low	110 Å²	110	110.3 Å²	110.3	59%	0.588	60%	0.597	S	S	*	*	H	α-helix	trans	-67.8	-42.1	180	-146.7	40.9	0	0	0	111.1	N54 Q55 G60 N61 V62	N54-D58 WeakPolarHBondContact O-CB 3.28Å; N54-D58 PolarHBondContact O-N 3.01Å; Q55-D58 PolarHBondContact O-N 3.47Å; D58-G60 VanDerWaalsContact C-N 3.32Å; D58-G60 PolarHBondContact O-N 3.47Å; D58-N61 PolarHBondContact O-N 3.08Å; D58-V62 VanDerWaalsContact O-CG2 3.3Å; D58-V62 WeakPolarHBondContact O-CG2 3.41Å; D58-V62 PolarHBondContact O-N 3.02Å; D58-V62 VanDerWaalsContact O-N 3.08Å
59	M	64.6	Low	65.6	Low	139 Å²	139	111.2 Å²	111.2	69%	0.685	60%	0.599	S	S	*	*	H	α-helix	trans	-60.2	-38.6	173.5	-168.2	93.9	109.6	0	0	112.7	Q55 S63	Q55-M59 VanDerWaalsContact O-CB 3.28Å; Q55-M59 WeakPolarHBondContact O-CB 3.46Å; Q55-M59 PolarHBondContact O-N 3.25Å; M59-S63 PolarHBondContact O-N 3.37Å; M59-S63 PolarHBondContact O-OG 3.35Å
60	G	68.3	Low	66.1	Low	30 Å²	30	109.8 Å²	109.8	31%	0.309	60%	0.597	S	S	.	*	H	α-helix	trans	-66.8	-40.6	176.2	0	0	0	0	0	113.3	L56 R57 D58 S63 I64	L56-G60 PolarHBondContact O-N 2.92Å; R57-G60 PolarHBondContact O-N 3.42Å; D58-G60 VanDerWaalsContact C-N 3.32Å; D58-G60 PolarHBondContact O-N 3.47Å; G60-S63 PolarHBondContact O-N 3.07Å; G60-I64 WeakPolarHBondContact O-CD1 3.39Å; G60-I64 WeakPolarHBondContact O-CG1 3.3Å; G60-I64 PolarHBondContact O-N 3.45Å
61	N	63.8	Low	66.3	Low	103 Å²	103	111.3 Å²	111.3	55%	0.551	61%	0.606	S	S	*	*	H	α-helix	trans	-70.3	-34.9	179.6	-67.8	-10.2	0	0	0	112.6	R57 D58 S63 S65	R57-N61 PolarHBondContact O-N 3.4Å; R57-N61 PolarHBondContact O-OD1 3.34Å; D58-N61 PolarHBondContact O-N 3.08Å; N61-S63 VanDerWaalsContact C-N 3.34Å; N61-S65 PolarHBondContact O-OG 3.33Å
62	V	60.9	Low	66.1	Low	104 Å²	104	111.9 Å²	111.9	63%	0.63	61%	0.61	S	S	*	*	H	α-helix	trans	-66.3	-35.6	175.7	173.5	0	0	0	0	111.6	D58	D58-V62 VanDerWaalsContact O-CG2 3.3Å; D58-V62 WeakPolarHBondContact O-CG2 3.41Å; D58-V62 PolarHBondContact O-N 3.02Å; D58-V62 VanDerWaalsContact O-N 3.08Å
63	S	59.1	Low	66.1	Low	89 Å²	89	109.6 Å²	109.6	62%	0.622	61%	0.608	S	S	*	*	H	α-helix	trans	-77	-20	-177.7	-58.3	0	0	0	0	114.3	M59 G60 N61	M59-S63 PolarHBondContact O-N 3.37Å; M59-S63 PolarHBondContact O-OG 3.35Å; G60-S63 PolarHBondContact O-N 3.07Å; N61-S63 VanDerWaalsContact C-N 3.34Å
64	I	60.6	Low	65.5	Low	140 Å²	140	114.4 Å²	114.4	72%	0.718	63%	0.629	S	S	*	*	H	α-helix	trans	-89.6	-14.4	-179.8	-66.3	163	0	0	0	111.9	G60 V66	G60-I64 WeakPolarHBondContact O-CD1 3.39Å; G60-I64 WeakPolarHBondContact O-CG1 3.3Å; G60-I64 PolarHBondContact O-N 3.45Å; I64-V66 VanDerWaalsContact C-N 3.3Å; I64-V66 PolarHBondContact O-N 3.31Å
65	S	56.8	Low	64.9	Low	109 Å²	109	118.3 Å²	118.3	76%	0.762	65%	0.651	S	S	*	*			trans	-87.3	23.4	-178.7	-63.2	0	0	0	0	114.9	N61	N61-S65 PolarHBondContact O-OG 3.33Å
66	V	49.1	Very low	63.9	Low	194 Å²	194	119.1 Å²	119.1	100%	1.176	66%	0.664	S	S	*	*			trans	-110.5	0	175.6	86.5	0	0	0	0	112.8	I64	I64-V66 VanDerWaalsContact C-N 3.3Å; I64-V66 PolarHBondContact O-N 3.31Å

Retrieved 66 of 66 residues in 80.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).