A0A087WYV4_HUMAN Loading...

Dehydrogenase/reductase 11

AlphaFold DB , UniProt , Accession A0A087WYV4, Species HUMAN (Homo sapiens, Human), Gene DHRS11, Length 50 aa.

						>A0A087WYV4_HUMAN|A0A087WYV4|DHRS11
MARPGMERWRDRLALVTGASGGIGAAVARALVQQGLKVVGCARTVGNIEM
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	57.9	Low	79.5	Confident	241 Å²	241	125.8 Å²	125.8	100%	1.187	62%	0.621	S	S	*	*				0	123.1	0	-173.1	146.2	149.9	0	0	107.8
2	A	62.8	Low	80.5	Confident	57 Å²	57	127.4 Å²	127.4	47%	0.471	62%	0.615	S	S	.	*	P	Polyproline II helix	trans	-62.8	141.2	-179	0	0	0	0	0	110.2	M6	A2-M6 HydrophobicContact CB-CE 4.48Å; A2-M6 HydrophobicContact CB-SD 4.17Å
3	R	71.2	Confident	81.7	Confident	164 Å²	164	126.2 Å²	126.2	62%	0.619	61%	0.613	S	S	*	*	P	Polyproline II helix	trans	-62.5	149.8	-177.7	-67.1	-170.4	173.1	142.2	-13.1	111.9	G5 M6 Q34	R3-G5 PolarHBondContact O-N 3.18Å; R3-M6 HydrophobicContact CB-CE 3.74Å; R3-M6 HydrophobicContact CG-CE 4.18Å; R3-M6 VanDerWaalsContact O-CB 3.27Å; R3-M6 WeakPolarHBondContact O-CB 3.25Å; R3-M6 PolarHBondContact O-N 2.98Å; R3-Q34 VanDerWaalsContact NH1-CD 3.28Å; R3-Q34 VanDerWaalsContact NH1-OE1 3.1Å
4	P	76.6	Confident	82.7	Confident	131 Å²	131	118.7 Å²	118.7	85%	0.851	58%	0.581	S	S	*	*	T	Hydrogen-bonded Turn	trans	-51.4	133.9	169.9	-22.3	31	0	0	0	110.9
5	G	80.6	Confident	83.6	Confident	52 Å²	52	118.4 Å²	118.4	54%	0.536	58%	0.582	S	S	.	*	T	Hydrogen-bonded Turn	trans	92.7	-1.4	-178.2	0	0	0	0	0	115.8	R3	R3-G5 PolarHBondContact O-N 3.18Å
6	M	86.5	Confident	84.4	Confident	24 Å²	24	112 Å²	112	12%	0.118	55%	0.552	C	S	.	*			trans	-94.1	-2.6	179.3	-144.7	-170.3	-64.7	0	0	114.3	A2 R3 R8 W9 R10 Q34 L36	A2-M6 HydrophobicContact CB-CE 4.48Å; A2-M6 HydrophobicContact CB-SD 4.17Å; R3-M6 HydrophobicContact CB-CE 3.74Å; R3-M6 HydrophobicContact CG-CE 4.18Å; R3-M6 VanDerWaalsContact O-CB 3.27Å; R3-M6 WeakPolarHBondContact O-CB 3.25Å; R3-M6 PolarHBondContact O-N 2.98Å; M6-R8 VanDerWaalsContact C-N 3.28Å; M6-R8 PolarHBondContact O-N 3.45Å; M6-W9 WeakPolarHBondContact O-CB 3.17Å; M6-W9 PolarHBondContact O-N 3.13Å; M6-R10 PolarHBondContact O-N 3.16Å; M6-Q34 HydrophobicContact CE-CB 3.37Å; M6-Q34 HydrophobicContact CE-CG 3.63Å; M6-Q34 WeakPolarHBondContact CE-O 3.48Å; M6-Q34 HydrophobicContact SD-CB 3.63Å; M6-Q34 HydrophobicContact SD-CG 4.44Å; M6-L36 HydrophobicContact CG-CD1 4.08Å; M6-L36 HydrophobicContact SD-CD1 3.48Å; M6-L36 WeakPolarHBondContact SD-CD1 3.27Å
7	E	87.8	Confident	85	Confident	143 Å²	143	111.6 Å²	111.6	67%	0.668	56%	0.557	S	S	*	*	G	3₁₀ helix	trans	-60	-37.4	-174.1	-53.3	-173.2	-172.1	0	0	112.6	W9 R10	E7-W9 PolarHBondContact O-N 3.45Å; E7-W9 VanDerWaalsContact O-N 3.16Å; E7-R10 VanDerWaalsContact O-CB 3.25Å; E7-R10 WeakPolarHBondContact O-CB 3.4Å; E7-R10 PolarHBondContact O-N 3.09Å; E7-R10 VanDerWaalsContact O-N 3.13Å
8	R	88.4	Confident	85.6	Confident	167 Å²	167	107.8 Å²	107.8	63%	0.63	55%	0.551	S	S	*	*	G	3₁₀ helix	trans	-64.4	-18.3	176.5	72.6	173.2	180	-104.4	0.5	114	M6 R12	M6-R8 VanDerWaalsContact C-N 3.28Å; M6-R8 PolarHBondContact O-N 3.45Å; R8-R12 WeakPolarHBondContact O-CD 3.31Å; R8-R12 PolarHBondContact O-NE 3.32Å; R8-R12 VanDerWaalsContact O-NE 3.09Å
9	W	89.6	Confident	86.1	Confident	104 Å²	104	102.7 Å²	102.7	39%	0.394	53%	0.527	S	S	.	.	G	3₁₀ helix	trans	-101.1	-1.3	-179.1	-54.9	116.3	0	0	0	112.7	M6 E7 D11 R12 L36	M6-W9 WeakPolarHBondContact O-CB 3.17Å; M6-W9 PolarHBondContact O-N 3.13Å; E7-W9 PolarHBondContact O-N 3.45Å; E7-W9 VanDerWaalsContact O-N 3.16Å; W9-D11 PolarHBondContact O-N 3.23Å; W9-R12 WeakPolarHBondContact O-CB 3.26Å; W9-R12 PolarHBondContact O-N 2.83Å; W9-L36 HydrophobicContact CB-CD2 3.91Å; W9-L36 HydrophobicContact CB-CG 4.44Å; W9-L36 HydrophobicContact CG-CD2 4.44Å
10	R	85.8	Confident	86.4	Confident	161 Å²	161	99.7 Å²	99.7	61%	0.608	52%	0.516	S	S	*	.	T	Hydrogen-bonded Turn	trans	-57.3	136.7	172.6	-167.7	-171.8	-60.2	-84.2	-0.3	109.6	M6 E7 R12	M6-R10 PolarHBondContact O-N 3.16Å; E7-R10 VanDerWaalsContact O-CB 3.25Å; E7-R10 WeakPolarHBondContact O-CB 3.4Å; E7-R10 PolarHBondContact O-N 3.09Å; E7-R10 VanDerWaalsContact O-N 3.13Å; R10-R12 PolarHBondContact O-N 3.08Å
11	D	87.9	Confident	86.7	Confident	140 Å²	140	96.5 Å²	96.5	75%	0.749	51%	0.507	S	S	*	.	T	Hydrogen-bonded Turn	trans	58.6	9.7	-178.5	-58.5	-53.5	0	0	0	115.8	W9	W9-D11 PolarHBondContact O-N 3.23Å
12	R	91.4	Very high	88.4	Confident	145 Å²	145	88.2 Å²	88.2	55%	0.547	48%	0.484	S	S	.	.			trans	-92.2	156.9	171.1	-61.3	-167.7	-178.9	-163	0.2	111	R8 W9 R10	R8-R12 WeakPolarHBondContact O-CD 3.31Å; R8-R12 PolarHBondContact O-NE 3.32Å; R8-R12 VanDerWaalsContact O-NE 3.09Å; W9-R12 WeakPolarHBondContact O-CB 3.26Å; W9-R12 PolarHBondContact O-N 2.83Å; R10-R12 PolarHBondContact O-N 3.08Å
13	L	95.1	Very high	90	Very high	112 Å²	112	92.3 Å²	92.3	59%	0.586	50%	0.496	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-107.8	133.4	175.8	-172.2	139.8	0	0	0	109.6	K37 V39	L13-K37 WeakPolarHBondContact CA-O 3.42Å; L13-V39 HydrophobicContact CD1-CG2 3.86Å; L13-V39 HydrophobicContact CD2-CB 4.18Å; L13-V39 HydrophobicContact CD2-CG2 3.74Å; L13-V39 HydrophobicContact CG-CG2 4.12Å
14	A	96.1	Very high	91.1	Very high	21 Å²	21	85.2 Å²	85.2	17%	0.174	47%	0.474	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.5	124.3	174.5	0	0	0	0	0	110.4	L31 K37 V38 V39	A14-L31 HydrophobicContact CB-CD1 4Å; A14-K37 PolarHBondContact N-O 2.81Å; A14-V38 HydrophobicContact CB-CG2 4.32Å; A14-V38 CarbonylContact O-C 3.5Å; A14-V38 VanDerWaalsContact O-CA 3.31Å; A14-V38 WeakPolarHBondContact O-CA 3.41Å; A14-V39 PolarHBondContact O-N 3.27Å
15	L	96.6	Very high	92	Very high	114 Å²	114	79.8 Å²	79.8	60%	0.597	44%	0.44	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-94.4	124.2	170.1	176.5	63.1	0	0	0	109.2	V39 C41	L15-V39 WeakPolarHBondContact CA-O 3.29Å; L15-V39 HydrophobicContact CD1-CB 4.21Å; L15-V39 HydrophobicContact CD1-CG1 3.94Å; L15-C41 HydrophobicContact CD1-CB 4.03Å
16	V	95.9	Very high	92.7	Very high	16 Å²	16	80 Å²	80	10%	0.097	44%	0.437	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.1	112.6	175.8	-176.8	0	0	0	0	109.2	A19 G24 V27 A28 L31 V38 V39 C41	V16-A19 HydrophobicContact CB-CB 4.4Å; V16-A19 HydrophobicContact CG1-CB 4.17Å; V16-G24 WeakPolarHBondContact CG1-O 3.48Å; V16-V27 HydrophobicContact CG2-CG1 4.5Å; V16-A28 HydrophobicContact CB-CB 4.3Å; V16-A28 HydrophobicContact CG1-CB 4.32Å; V16-A28 HydrophobicContact CG2-CB 4.21Å; V16-L31 HydrophobicContact CG2-CD1 4.02Å; V16-V38 HydrophobicContact CG2-CG1 3.86Å; V16-V39 PolarHBondContact N-O 3.1Å; V16-C41 PolarHBondContact O-N 3.49Å
17	T	95.6	Very high	93.2	Very high	105 Å²	105	81.9 Å²	81.9	64%	0.644	45%	0.449	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-83.9	148.2	172.2	60.1	0	0	0	0	110.3	A19 C41	T17-A19 VanDerWaalsContact C-N 3.31Å; T17-C41 CarbonylContact C-O 3.54Å
18	G	94.4	Very high	93.6	Very high	43 Å²	43	75.8 Å²	75.8	44%	0.443	42%	0.424	S	S	.	.	T	Hydrogen-bonded Turn	trans	70.5	26.4	-174.2	0	0	0	0	0	113.4	S20 C41	G18-S20 PolarHBondContact O-N 3.21Å; G18-S20 VanDerWaalsContact O-N 3.1Å; G18-C41 PolarHBondContact N-O 3.17Å
19	A	95.3	Very high	93.9	Very high	11 Å²	11	74.5 Å²	74.5	9%	0.091	42%	0.419	C	S	.	.	T	Hydrogen-bonded Turn	trans	-72.9	1.9	-176	0	0	0	0	0	114.9	V16 T17 G21 A25 C41 I48	V16-A19 HydrophobicContact CB-CB 4.4Å; V16-A19 HydrophobicContact CG1-CB 4.17Å; T17-A19 VanDerWaalsContact C-N 3.31Å; A19-G21 VanDerWaalsContact C-N 3.28Å; A19-G21 PolarHBondContact O-N 3.39Å; A19-A25 WeakPolarHBondContact O-CB 3.42Å; A19-C41 PolarHBondContact N-O 3.42Å; A19-I48 HydrophobicContact CB-CD1 4.24Å; A19-I48 HydrophobicContact CB-CG1 4.36Å
20	S	93.3	Very high	94.1	Very high	43 Å²	43	71.5 Å²	71.5	30%	0.301	42%	0.416	S	S	.	.	T	Hydrogen-bonded Turn	trans	-73.5	-13.2	-179.2	44.3	0	0	0	0	114.6	G18 A42 N47	G18-S20 PolarHBondContact O-N 3.21Å; G18-S20 VanDerWaalsContact O-N 3.1Å; S20-A42 VanDerWaalsContact CB-CB 3.46Å; S20-A42 WeakPolarHBondContact OG-CB 3.39Å; S20-N47 PolarHBondContact O-ND2 3.12Å
21	G	92.1	Very high	94.5	Very high	33 Å²	33	66.1 Å²	66.1	34%	0.34	40%	0.399	S	S	.	.	S	Bend	trans	178.3	-179.6	-179.2	0	0	0	0	0	113.6	A19 I23 G24 A25	A19-G21 VanDerWaalsContact C-N 3.28Å; A19-G21 PolarHBondContact O-N 3.39Å; G21-I23 PolarHBondContact O-N 2.88Å; G21-G24 PolarHBondContact O-N 2.92Å; G21-A25 PolarHBondContact O-N 3.27Å
22	G	93.8	Very high	94.7	Very high	67 Å²	67	63.5 Å²	63.5	69%	0.691	39%	0.388	S	S	*	.	H	α-helix	trans	51.1	-133.8	175.8	0	0	0	0	0	113.3	A25 A26	G22-A25 PolarHBondContact O-N 3.21Å; G22-A26 PolarHBondContact O-N 2.83Å; G22-A26 VanDerWaalsContact O-N 3.12Å
23	I	96.5	Very high	94.8	Very high	143 Å²	143	64.2 Å²	64.2	73%	0.733	40%	0.398	S	S	*	.	H	α-helix	trans	-64.9	-41.9	-175.9	-59.4	174.3	0	0	0	111.3	G21 A25 A26 V27	G21-I23 PolarHBondContact O-N 2.88Å; I23-A25 PolarHBondContact O-N 3.27Å; I23-A26 PolarHBondContact O-N 3.13Å; I23-V27 HydrophobicContact CG2-CG2 4.01Å; I23-V27 WeakPolarHBondContact O-CB 3.36Å; I23-V27 VanDerWaalsContact O-CG2 3.29Å; I23-V27 WeakPolarHBondContact O-CG2 3.27Å; I23-V27 PolarHBondContact O-N 3.28Å
24	G	94.8	Very high	94.5	Very high	15 Å²	15	60.8 Å²	60.8	16%	0.155	38%	0.379	C	S	.	.	H	α-helix	trans	-60.3	-45.2	-179	0	0	0	0	0	112.1	V16 G21 V27 A28	V16-G24 WeakPolarHBondContact CG1-O 3.48Å; G21-G24 PolarHBondContact O-N 2.92Å; G24-V27 PolarHBondContact O-N 2.96Å; G24-A28 WeakPolarHBondContact O-CB 3.47Å; G24-A28 PolarHBondContact O-N 2.96Å
25	A	94.6	Very high	94.2	Very high	17 Å²	17	63 Å²	63	14%	0.14	40%	0.404	C	S	.	.	H	α-helix	trans	-63.6	-43.1	174.9	0	0	0	0	0	112.4	A19 G21 G22 I23 A28 R29	A19-A25 WeakPolarHBondContact O-CB 3.42Å; G21-A25 PolarHBondContact O-N 3.27Å; G22-A25 PolarHBondContact O-N 3.21Å; I23-A25 PolarHBondContact O-N 3.27Å; A25-A28 PolarHBondContact O-N 2.98Å; A25-R29 WeakPolarHBondContact O-CG 3.5Å; A25-R29 PolarHBondContact O-N 2.92Å; A25-R29 VanDerWaalsContact O-N 3.07Å
26	A	96.3	Very high	94	Very high	56 Å²	56	58.8 Å²	58.8	46%	0.463	38%	0.381	S	S	.	.	H	α-helix	trans	-63.1	-42.1	178.6	0	0	0	0	0	112.2	G22 I23 R29 A30	G22-A26 PolarHBondContact O-N 2.83Å; G22-A26 VanDerWaalsContact O-N 3.12Å; I23-A26 PolarHBondContact O-N 3.13Å; A26-R29 PolarHBondContact O-N 2.87Å; A26-A30 WeakPolarHBondContact O-CB 3.45Å; A26-A30 PolarHBondContact O-N 3.44Å
27	V	96.2	Very high	93.9	Very high	64 Å²	64	64.6 Å²	64.6	39%	0.388	41%	0.406	S	S	.	.	H	α-helix	trans	-64.6	-46.6	176.6	170	0	0	0	0	110.9	V16 I23 G24 R29 A30 L31	V16-V27 HydrophobicContact CG2-CG1 4.5Å; I23-V27 HydrophobicContact CG2-CG2 4.01Å; I23-V27 WeakPolarHBondContact O-CB 3.36Å; I23-V27 VanDerWaalsContact O-CG2 3.29Å; I23-V27 WeakPolarHBondContact O-CG2 3.27Å; I23-V27 PolarHBondContact O-N 3.28Å; G24-V27 PolarHBondContact O-N 2.96Å; V27-R29 VanDerWaalsContact C-N 3.31Å; V27-R29 PolarHBondContact O-N 3.39Å; V27-A30 PolarHBondContact O-N 3.07Å; V27-L31 HydrophobicContact CG1-CD1 3.91Å; V27-L31 HydrophobicContact CG1-CG 4.28Å; V27-L31 WeakPolarHBondContact O-CG 3.4Å; V27-L31 PolarHBondContact O-N 3.43Å
28	A	95.4	Very high	93.9	Very high	15 Å²	15	61.3 Å²	61.3	12%	0.124	39%	0.385	C	S	.	.	H	α-helix	trans	-55.9	-47	177.4	0	0	0	0	0	111.4	V16 G24 A25 L31 V32 V38	V16-A28 HydrophobicContact CB-CB 4.3Å; V16-A28 HydrophobicContact CG1-CB 4.32Å; V16-A28 HydrophobicContact CG2-CB 4.21Å; G24-A28 WeakPolarHBondContact O-CB 3.47Å; G24-A28 PolarHBondContact O-N 2.96Å; A25-A28 PolarHBondContact O-N 2.98Å; A28-L31 PolarHBondContact O-N 3.24Å; A28-V32 WeakPolarHBondContact O-CG2 3.47Å; A28-V32 PolarHBondContact O-N 3.3Å; A28-V32 VanDerWaalsContact O-N 3.09Å; A28-V38 HydrophobicContact CB-CG1 4.15Å
29	R	94.8	Very high	94	Very high	139 Å²	139	62.5 Å²	62.5	53%	0.525	38%	0.384	S	S	.	.	H	α-helix	trans	-61	-46	176.1	-69.8	173.8	-178	-155.7	0.7	112.2	A25 A26 V27 L31 V32 Q33 M50	A25-R29 WeakPolarHBondContact O-CG 3.5Å; A25-R29 PolarHBondContact O-N 2.92Å; A25-R29 VanDerWaalsContact O-N 3.07Å; A26-R29 PolarHBondContact O-N 2.87Å; V27-R29 VanDerWaalsContact C-N 3.31Å; V27-R29 PolarHBondContact O-N 3.39Å; R29-L31 VanDerWaalsContact C-N 3.34Å; R29-L31 PolarHBondContact O-N 3.18Å; R29-V32 PolarHBondContact O-N 2.95Å; R29-Q33 WeakPolarHBondContact O-CG 3.48Å; R29-Q33 PolarHBondContact O-N 3.37Å; R29-M50 HydrophobicContact CG-CE 4.37Å; R29-M50 PolarHBondContact NH2-SD 3.2Å
30	A	94.6	Very high	93.9	Very high	42 Å²	42	63.7 Å²	63.7	35%	0.347	40%	0.397	S	S	.	.	H	α-helix	trans	-61.5	-42.1	179.9	0	0	0	0	0	111.9	A26 V27 Q33 Q34	A26-A30 WeakPolarHBondContact O-CB 3.45Å; A26-A30 PolarHBondContact O-N 3.44Å; V27-A30 PolarHBondContact O-N 3.07Å; A30-Q33 PolarHBondContact O-N 3.41Å; A30-Q34 WeakPolarHBondContact O-CB 3.48Å; A30-Q34 VanDerWaalsContact O-CG 3.27Å; A30-Q34 WeakPolarHBondContact O-CG 3.41Å; A30-Q34 PolarHBondContact O-N 3.01Å
31	L	93.1	Very high	94	Very high	48 Å²	48	64.7 Å²	64.7	25%	0.251	40%	0.403	S	S	.	.	H	α-helix	trans	-65.1	-39.1	177.5	-68.6	174.4	0	0	0	112.2	A14 V16 V27 A28 R29 Q34 G35 L36 V38	A14-L31 HydrophobicContact CB-CD1 4Å; V16-L31 HydrophobicContact CG2-CD1 4.02Å; V27-L31 HydrophobicContact CG1-CD1 3.91Å; V27-L31 HydrophobicContact CG1-CG 4.28Å; V27-L31 WeakPolarHBondContact O-CG 3.4Å; V27-L31 PolarHBondContact O-N 3.43Å; A28-L31 PolarHBondContact O-N 3.24Å; R29-L31 VanDerWaalsContact C-N 3.34Å; R29-L31 PolarHBondContact O-N 3.18Å; L31-Q34 WeakPolarHBondContact O-CB 3.33Å; L31-Q34 PolarHBondContact O-N 2.94Å; L31-G35 PolarHBondContact O-N 3.24Å; L31-L36 HydrophobicContact CD2-CD2 4.28Å; L31-L36 WeakPolarHBondContact O-CB 3.34Å; L31-L36 WeakPolarHBondContact O-CD1 3.49Å; L31-L36 PolarHBondContact O-N 2.82Å; L31-L36 VanDerWaalsContact O-N 3.08Å; L31-V38 HydrophobicContact CB-CG2 3.64Å
32	V	92.8	Very high	94	Very high	85 Å²	85	64.6 Å²	64.6	52%	0.515	40%	0.399	S	S	.	.	H	α-helix	trans	-63.5	-44.7	172.9	173	0	0	0	0	111.1	A28 R29 Q34 G35 V38	A28-V32 WeakPolarHBondContact O-CG2 3.47Å; A28-V32 PolarHBondContact O-N 3.3Å; A28-V32 VanDerWaalsContact O-N 3.09Å; R29-V32 PolarHBondContact O-N 2.95Å; V32-Q34 PolarHBondContact O-N 3.09Å; V32-G35 WeakPolarHBondContact O-CA 3.35Å; V32-G35 PolarHBondContact O-N 3.39Å; V32-V38 HydrophobicContact CG2-CB 3.86Å; V32-V38 HydrophobicContact CG2-CG2 3.63Å
33	Q	92.6	Very high	93.9	Very high	159 Å²	159	73.2 Å²	73.2	74%	0.743	41%	0.411	S	S	*	.	H	α-helix	trans	-62.4	-27	176.4	-71.5	175.2	-36.7	0	0	113.1	R29 A30	R29-Q33 WeakPolarHBondContact O-CG 3.48Å; R29-Q33 PolarHBondContact O-N 3.37Å; A30-Q33 PolarHBondContact O-N 3.41Å
34	Q	90.3	Very high	93.4	Very high	40 Å²	40	70.5 Å²	70.5	19%	0.187	40%	0.401	C	S	.	.	T	Hydrogen-bonded Turn	trans	-74.2	-14.1	172.1	-75.9	-28.4	-81.9	0	0	112.7	R3 M6 A30 L31 V32 L36	R3-Q34 VanDerWaalsContact NH1-CD 3.28Å; R3-Q34 VanDerWaalsContact NH1-OE1 3.1Å; M6-Q34 HydrophobicContact CE-CB 3.37Å; M6-Q34 HydrophobicContact CE-CG 3.63Å; M6-Q34 WeakPolarHBondContact CE-O 3.48Å; M6-Q34 HydrophobicContact SD-CB 3.63Å; M6-Q34 HydrophobicContact SD-CG 4.44Å; A30-Q34 WeakPolarHBondContact O-CB 3.48Å; A30-Q34 VanDerWaalsContact O-CG 3.27Å; A30-Q34 WeakPolarHBondContact O-CG 3.41Å; A30-Q34 PolarHBondContact O-N 3.01Å; L31-Q34 WeakPolarHBondContact O-CB 3.33Å; L31-Q34 PolarHBondContact O-N 2.94Å; V32-Q34 PolarHBondContact O-N 3.09Å; Q34-L36 HydrophobicContact CB-CD1 3.59Å
35	G	89.2	Confident	92.6	Very high	68 Å²	68	74.2 Å²	74.2	70%	0.701	42%	0.421	S	S	*	.	T	Hydrogen-bonded Turn	trans	97.5	14.5	178.6	0	0	0	0	0	114.1	L31 V32	L31-G35 PolarHBondContact O-N 3.24Å; V32-G35 WeakPolarHBondContact O-CA 3.35Å; V32-G35 PolarHBondContact O-N 3.39Å
36	L	93.2	Very high	91.7	Very high	25 Å²	25	76.4 Å²	76.4	13%	0.131	45%	0.445	C	S	.	.			trans	-84.5	150.5	175.6	-69.7	83.7	0	0	0	111.1	M6 W9 L31 Q34 V38	M6-L36 HydrophobicContact CG-CD1 4.08Å; M6-L36 HydrophobicContact SD-CD1 3.48Å; M6-L36 WeakPolarHBondContact SD-CD1 3.27Å; W9-L36 HydrophobicContact CB-CD2 3.91Å; W9-L36 HydrophobicContact CB-CG 4.44Å; W9-L36 HydrophobicContact CG-CD2 4.44Å; L31-L36 HydrophobicContact CD2-CD2 4.28Å; L31-L36 WeakPolarHBondContact O-CB 3.34Å; L31-L36 WeakPolarHBondContact O-CD1 3.49Å; L31-L36 PolarHBondContact O-N 2.82Å; L31-L36 VanDerWaalsContact O-N 3.08Å; Q34-L36 HydrophobicContact CB-CD1 3.59Å; L36-V38 HydrophobicContact CB-CG2 4.31Å
37	K	93.8	Very high	90.6	Very high	139 Å²	139	78.8 Å²	78.8	60%	0.604	45%	0.45	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-78.4	127.3	164	-63.8	177.6	-175.9	171.8	0	108.4	L13 A14	L13-K37 WeakPolarHBondContact CA-O 3.42Å; A14-K37 PolarHBondContact N-O 2.81Å
38	V	95.3	Very high	89.7	Confident	36 Å²	36	78.3 Å²	78.3	22%	0.218	45%	0.445	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.7	137	-174.1	-175.3	0	0	0	0	110.4	A14 V16 A28 L31 V32 L36	A14-V38 HydrophobicContact CB-CG2 4.32Å; A14-V38 CarbonylContact O-C 3.5Å; A14-V38 VanDerWaalsContact O-CA 3.31Å; A14-V38 WeakPolarHBondContact O-CA 3.41Å; V16-V38 HydrophobicContact CG2-CG1 3.86Å; A28-V38 HydrophobicContact CB-CG1 4.15Å; L31-V38 HydrophobicContact CB-CG2 3.64Å; V32-V38 HydrophobicContact CG2-CB 3.86Å; V32-V38 HydrophobicContact CG2-CG2 3.63Å; L36-V38 HydrophobicContact CB-CG2 4.31Å
39	V	95.7	Very high	88.2	Confident	67 Å²	67	84.6 Å²	84.6	41%	0.406	47%	0.472	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.8	120.7	168.3	174.3	0	0	0	0	108.2	L13 A14 L15 V16	L13-V39 HydrophobicContact CD1-CG2 3.86Å; L13-V39 HydrophobicContact CD2-CB 4.18Å; L13-V39 HydrophobicContact CD2-CG2 3.74Å; L13-V39 HydrophobicContact CG-CG2 4.12Å; A14-V39 PolarHBondContact O-N 3.27Å; L15-V39 WeakPolarHBondContact CA-O 3.29Å; L15-V39 HydrophobicContact CD1-CB 4.21Å; L15-V39 HydrophobicContact CD1-CG1 3.94Å; V16-V39 PolarHBondContact N-O 3.1Å
40	G	94.3	Very high	86.2	Confident	37 Å²	37	87.7 Å²	87.7	38%	0.381	49%	0.494	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-87.5	137.9	172	0	0	0	0	0	111.1
41	C	94.1	Very high	85.8	Confident	63 Å²	63	90 Å²	90	43%	0.426	50%	0.502	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.7	127.2	174.7	178.3	0	0	0	0	110.6	L15 V16 T17 G18 A19 I48	L15-C41 HydrophobicContact CD1-CB 4.03Å; V16-C41 PolarHBondContact O-N 3.49Å; T17-C41 CarbonylContact C-O 3.54Å; G18-C41 PolarHBondContact N-O 3.17Å; A19-C41 PolarHBondContact N-O 3.42Å; C41-I48 VanDerWaalsContact C-CD1 3.47Å
42	A	93	Very high	85.4	Confident	31 Å²	31	92.2 Å²	92.2	26%	0.256	52%	0.515	S	S	.	.			trans	-151	166.7	172.9	0	0	0	0	0	110.2	S20 I48	S20-A42 VanDerWaalsContact CB-CB 3.46Å; S20-A42 WeakPolarHBondContact OG-CB 3.39Å; A42-I48 HydrophobicContact CB-CD1 3.47Å; A42-I48 VanDerWaalsContact CB-CD1 3.47Å; A42-I48 HydrophobicContact CB-CG1 4.28Å
43	R	90.4	Very high	85	Confident	248 Å²	248	92.6 Å²	92.6	94%	0.936	52%	0.515	S	S	*	.	S	Bend	trans	-73	-31.3	-177.2	-64.1	174.2	-66.8	161	2	113.3
44	T	86.4	Confident	84.6	Confident	87 Å²	87	88.7 Å²	88.7	53%	0.534	50%	0.502	S	S	.	.			trans	-114.3	121.4	-174.2	-50.2	0	0	0	0	109.6
45	V	77.8	Confident	84.2	Confident	92 Å²	92	91.8 Å²	91.8	56%	0.558	52%	0.521	S	S	*	.	G	3₁₀ helix	trans	-62.9	-44.1	-176.4	-179.8	0	0	0	0	111.7	N47 I48 E49	V45-N47 PolarHBondContact O-N 3.37Å; V45-I48 PolarHBondContact O-N 3.46Å; V45-E49 VanDerWaalsContact CG1-CD 3.43Å; V45-E49 HydrophobicContact CG1-CG 3.56Å; V45-E49 VanDerWaalsContact CG1-OE1 3.26Å; V45-E49 WeakPolarHBondContact CG1-OE1 3.42Å; V45-E49 WeakPolarHBondContact O-CG 3.46Å; V45-E49 PolarHBondContact O-N 3.44Å
46	G	76.3	Confident	83.9	Confident	63 Å²	63	93.3 Å²	93.3	65%	0.649	51%	0.509	S	S	*	.	G	3₁₀ helix	trans	-59.9	-14.2	-175.4	0	0	0	0	0	116.3
47	N	74	Confident	83.2	Confident	106 Å²	106	98.2 Å²	98.2	57%	0.567	54%	0.536	S	S	*	.	G	3₁₀ helix	trans	-99.7	-4.7	175.8	-86.4	59.8	0	0	0	113.9	S20 V45	S20-N47 PolarHBondContact O-ND2 3.12Å; V45-N47 PolarHBondContact O-N 3.37Å
48	I	76.5	Confident	82.4	Confident	54 Å²	54	95.1 Å²	95.1	28%	0.277	53%	0.531	S	S	.	.	T	Hydrogen-bonded Turn	trans	-110.7	-22	-177.3	-119.7	170.6	0	0	0	112.7	A19 C41 A42 V45 M50	A19-I48 HydrophobicContact CB-CD1 4.24Å; A19-I48 HydrophobicContact CB-CG1 4.36Å; C41-I48 VanDerWaalsContact C-CD1 3.47Å; A42-I48 HydrophobicContact CB-CD1 3.47Å; A42-I48 VanDerWaalsContact CB-CD1 3.47Å; A42-I48 HydrophobicContact CB-CG1 4.28Å; V45-I48 PolarHBondContact O-N 3.46Å; I48-M50 PolarHBondContact O-N 2.85Å
49	E	64.7	Low	81.3	Confident	148 Å²	148	100 Å²	100	69%	0.692	56%	0.557	S	S	*	*			trans	-71.9	110	176.9	-45.3	-116.4	116.1	0	0	107.6	V45	V45-E49 VanDerWaalsContact CG1-CD 3.43Å; V45-E49 HydrophobicContact CG1-CG 3.56Å; V45-E49 VanDerWaalsContact CG1-OE1 3.26Å; V45-E49 WeakPolarHBondContact CG1-OE1 3.42Å; V45-E49 WeakPolarHBondContact O-CG 3.46Å; V45-E49 PolarHBondContact O-N 3.44Å
50	M	53	Low	80	Confident	204 Å²	204	103 Å²	103	100%	1.005	57%	0.571	S	S	*	*			trans	-125.7	0	173.6	-96.3	-159.1	-65.5	0	0	109.5	R29 I48	R29-M50 HydrophobicContact CG-CE 4.37Å; R29-M50 PolarHBondContact NH2-SD 3.2Å; I48-M50 PolarHBondContact O-N 2.85Å

Retrieved 50 of 50 residues in 303 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).