A0A087WYV6_HUMAN Loading...

Tetraspanin-6

AlphaFold DB , UniProt , Accession A0A087WYV6, Species HUMAN (Homo sapiens, Human), Gene TSPAN6, Length 129 aa.

						>A0A087WYV6_HUMAN|A0A087WYV6|TSPAN6
MLKLYAMFLTLVFLVELVAAIVGFVFRHEIKNSFKNNYEKALKQYNSTGDYRSHAVDKIQNTLHCCGVTDYRDWTDTNYYSEKGFPKSCCKLEDCTPQRDADKVNNELIGIFLAYCLSRAITNNQYEIV
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	79.6	Confident	94	Very high	201 Å²	201	122.7 Å²	122.7	99%	0.99	61%	0.611	S	S	*	*				0	-56.5	0	-59.4	-45	-145	0	0	113.2	K3 L4 Y5	M1-K3 PolarHBondContact O-N 2.92Å; M1-L4 PolarHBondContact O-N 2.92Å; M1-Y5 PolarHBondContact O-N 3.47Å
2	L	91	Very high	94.3	Very high	143 Å²	143	118.8 Å²	118.8	75%	0.749	60%	0.598	S	S	*	*	H	α-helix	trans	-60.1	-39.3	-176	-159.2	78.8	0	0	0	115	L4 Y5 A6	L2-L4 PolarHBondContact O-N 3.28Å; L2-Y5 PolarHBondContact O-N 3.25Å; L2-A6 WeakPolarHBondContact O-CB 3.29Å; L2-A6 PolarHBondContact O-N 3.3Å
3	K	91.9	Very high	94.6	Very high	190 Å²	190	119.5 Å²	119.5	83%	0.826	60%	0.595	S	S	*	*	H	α-helix	trans	-63.8	-39.9	179.2	-65.4	-169.8	178.5	-173.8	0	113.3	M1 M7	M1-K3 PolarHBondContact O-N 2.92Å; K3-M7 WeakPolarHBondContact O-CB 3.45Å; K3-M7 PolarHBondContact O-N 3.45Å
4	L	94.5	Very high	94.8	Very high	96 Å²	96	117.4 Å²	117.4	50%	0.503	59%	0.587	S	S	.	*	H	α-helix	trans	-68.3	-42.9	176.8	-72.4	171.7	0	0	0	110.5	M1 L2 A6 M7 F8	M1-L4 PolarHBondContact O-N 2.92Å; L2-L4 PolarHBondContact O-N 3.28Å; L4-A6 PolarHBondContact O-N 3.38Å; L4-M7 WeakPolarHBondContact O-CB 3.33Å; L4-M7 PolarHBondContact O-N 3.32Å; L4-F8 WeakPolarHBondContact O-CD2 3.32Å; L4-F8 PolarHBondContact O-N 2.9Å
5	Y	95.7	Very high	95	Very high	146 Å²	146	115.8 Å²	115.8	57%	0.573	59%	0.585	S	S	*	*	H	α-helix	trans	-58.2	-48.5	174.8	178.7	-105.5	0	0	0	112.1	M1 L2 M7 F8 L9	M1-Y5 PolarHBondContact O-N 3.47Å; L2-Y5 PolarHBondContact O-N 3.25Å; Y5-M7 VanDerWaalsContact C-N 3.32Å; Y5-M7 PolarHBondContact O-N 3.06Å; Y5-F8 PolarHBondContact O-N 3.39Å; Y5-L9 HydrophobicContact CD1-CD1 3.97Å; Y5-L9 HydrophobicContact CD1-CG 4.43Å; Y5-L9 HydrophobicContact CE1-CD1 3.32Å; Y5-L9 HydrophobicContact CE1-CG 4.05Å; Y5-L9 HydrophobicContact CE2-CD1 4.31Å; Y5-L9 HydrophobicContact CE2-CD2 4.36Å; Y5-L9 HydrophobicContact CE2-CG 4.24Å; Y5-L9 WeakPolarHBondContact O-CG 3.32Å; Y5-L9 PolarHBondContact O-N 3.08Å
6	A	95.6	Very high	95.1	Very high	49 Å²	49	116.1 Å²	116.1	41%	0.405	58%	0.584	S	S	.	*	H	α-helix	trans	-61.4	-38.3	176.8	0	0	0	0	0	112.8	L2 L4 L9 T10	L2-A6 WeakPolarHBondContact O-CB 3.29Å; L2-A6 PolarHBondContact O-N 3.3Å; L4-A6 PolarHBondContact O-N 3.38Å; A6-L9 PolarHBondContact O-N 2.95Å; A6-T10 WeakPolarHBondContact O-CB 3.44Å; A6-T10 PolarHBondContact O-N 3.06Å; A6-T10 PolarHBondContact O-OG1 3.37Å
7	M	96.9	Very high	95.2	Very high	126 Å²	126	114.2 Å²	114.2	62%	0.621	58%	0.575	S	S	*	*	H	α-helix	trans	-62.1	-47.8	174.8	-179.5	-168.2	-76.3	0	0	111.4	K3 L4 Y5 T10 L11	K3-M7 WeakPolarHBondContact O-CB 3.45Å; K3-M7 PolarHBondContact O-N 3.45Å; L4-M7 WeakPolarHBondContact O-CB 3.33Å; L4-M7 PolarHBondContact O-N 3.32Å; Y5-M7 VanDerWaalsContact C-N 3.32Å; Y5-M7 PolarHBondContact O-N 3.06Å; M7-T10 PolarHBondContact O-N 3.41Å; M7-L11 PolarHBondContact O-N 3.4Å
8	F	97.4	Very high	95.3	Very high	128 Å²	128	112.9 Å²	112.9	56%	0.561	57%	0.574	S	S	*	*	H	α-helix	trans	-63.1	-43	177.7	-78.9	-66	0	0	0	112.2	L4 Y5 T10 L11 V12	L4-F8 WeakPolarHBondContact O-CD2 3.32Å; L4-F8 PolarHBondContact O-N 2.9Å; Y5-F8 PolarHBondContact O-N 3.39Å; F8-T10 VanDerWaalsContact C-N 3.33Å; F8-T10 PolarHBondContact O-N 3.02Å; F8-L11 WeakPolarHBondContact O-CB 3.33Å; F8-L11 PolarHBondContact O-N 2.81Å; F8-V12 WeakPolarHBondContact O-CG2 3.29Å; F8-V12 PolarHBondContact O-N 3.23Å
9	L	96.8	Very high	95.3	Very high	86 Å²	86	110.2 Å²	110.2	45%	0.45	57%	0.57	S	S	.	*	H	α-helix	trans	-61.3	-42	176.6	-73.9	-173.5	0	0	0	112.3	Y5 A6 L11 V12 F13	Y5-L9 HydrophobicContact CD1-CD1 3.97Å; Y5-L9 HydrophobicContact CD1-CG 4.43Å; Y5-L9 HydrophobicContact CE1-CD1 3.32Å; Y5-L9 HydrophobicContact CE1-CG 4.05Å; Y5-L9 HydrophobicContact CE2-CD1 4.31Å; Y5-L9 HydrophobicContact CE2-CD2 4.36Å; Y5-L9 HydrophobicContact CE2-CG 4.24Å; Y5-L9 WeakPolarHBondContact O-CG 3.32Å; Y5-L9 PolarHBondContact O-N 3.08Å; A6-L9 PolarHBondContact O-N 2.95Å; L9-L11 VanDerWaalsContact C-N 3.31Å; L9-L11 PolarHBondContact O-N 3.36Å; L9-V12 PolarHBondContact O-N 3.16Å; L9-F13 WeakPolarHBondContact O-CB 3.47Å; L9-F13 PolarHBondContact O-N 3.02Å
10	T	97.2	Very high	95.1	Very high	82 Å²	82	107.8 Å²	107.8	50%	0.503	57%	0.568	S	S	.	*	H	α-helix	trans	-63.7	-41	177.4	-54.6	0	0	0	0	110.8	A6 M7 F8 F13 L14	A6-T10 WeakPolarHBondContact O-CB 3.44Å; A6-T10 PolarHBondContact O-N 3.06Å; A6-T10 PolarHBondContact O-OG1 3.37Å; M7-T10 PolarHBondContact O-N 3.41Å; F8-T10 VanDerWaalsContact C-N 3.33Å; F8-T10 PolarHBondContact O-N 3.02Å; T10-F13 PolarHBondContact O-N 3.31Å; T10-L14 HydrophobicContact CG2-CD1 4.43Å; T10-L14 VanDerWaalsContact O-CG 3.31Å; T10-L14 WeakPolarHBondContact O-CG 3.38Å; T10-L14 PolarHBondContact O-N 2.92Å
11	L	97.8	Very high	95.2	Very high	103 Å²	103	107.3 Å²	107.3	54%	0.539	56%	0.564	S	S	.	*	H	α-helix	trans	-63.2	-46.1	176.8	-175.3	68.5	0	0	0	111.8	M7 F8 L9 F13 L14 V15	M7-L11 PolarHBondContact O-N 3.4Å; F8-L11 WeakPolarHBondContact O-CB 3.33Å; F8-L11 PolarHBondContact O-N 2.81Å; L9-L11 VanDerWaalsContact C-N 3.31Å; L9-L11 PolarHBondContact O-N 3.36Å; L11-F13 VanDerWaalsContact C-N 3.34Å; L11-F13 PolarHBondContact O-N 3.03Å; L11-L14 PolarHBondContact O-N 3.31Å; L11-V15 WeakPolarHBondContact O-CG2 3.31Å; L11-V15 PolarHBondContact O-N 3.15Å
12	V	97.6	Very high	95.9	Very high	76 Å²	76	101.2 Å²	101.2	46%	0.461	54%	0.538	S	S	.	.	H	α-helix	trans	-60.9	-44.7	176.8	171.8	0	0	0	0	110.6	F8 L9 L14 V15 E16	F8-V12 WeakPolarHBondContact O-CG2 3.29Å; F8-V12 PolarHBondContact O-N 3.23Å; L9-V12 PolarHBondContact O-N 3.16Å; V12-L14 VanDerWaalsContact C-N 3.33Å; V12-L14 PolarHBondContact O-N 3.15Å; V12-V15 PolarHBondContact O-N 3.04Å; V12-V15 VanDerWaalsContact O-N 3.16Å; V12-E16 HydrophobicContact CG1-CG 4.35Å; V12-E16 WeakPolarHBondContact O-CG 3.48Å; V12-E16 PolarHBondContact O-N 3.1Å
13	F	97.4	Very high	95.7	Very high	127 Å²	127	95.9 Å²	95.9	56%	0.557	52%	0.518	S	S	*	.	H	α-helix	trans	-59	-42.2	177.4	178.6	-102.5	0	0	0	112.7	L9 T10 L11 E16 L17	L9-F13 WeakPolarHBondContact O-CB 3.47Å; L9-F13 PolarHBondContact O-N 3.02Å; T10-F13 PolarHBondContact O-N 3.31Å; L11-F13 VanDerWaalsContact C-N 3.34Å; L11-F13 PolarHBondContact O-N 3.03Å; F13-E16 PolarHBondContact O-N 2.96Å; F13-L17 WeakPolarHBondContact O-CB 3.41Å; F13-L17 PolarHBondContact O-N 3.35Å
14	L	98.3	Very high	95.5	Very high	91 Å²	91	93.3 Å²	93.3	48%	0.476	51%	0.507	S	S	.	.	H	α-helix	trans	-65.3	-40.4	176.5	-69.4	173.5	0	0	0	112	T10 L11 V12 L17 V18	T10-L14 HydrophobicContact CG2-CD1 4.43Å; T10-L14 VanDerWaalsContact O-CG 3.31Å; T10-L14 WeakPolarHBondContact O-CG 3.38Å; T10-L14 PolarHBondContact O-N 2.92Å; L11-L14 PolarHBondContact O-N 3.31Å; V12-L14 VanDerWaalsContact C-N 3.33Å; V12-L14 PolarHBondContact O-N 3.15Å; L14-L17 PolarHBondContact O-N 3.38Å; L14-V18 WeakPolarHBondContact O-CG2 3.5Å; L14-V18 PolarHBondContact O-N 3.27Å; L14-V18 VanDerWaalsContact O-N 3.08Å
15	V	98	Very high	95.5	Very high	93 Å²	93	93.1 Å²	93.1	56%	0.564	51%	0.51	S	S	*	.	H	α-helix	trans	-63.9	-44.1	175.7	171.8	0	0	0	0	110.9	L11 V12 L17 V18 A19	L11-V15 WeakPolarHBondContact O-CG2 3.31Å; L11-V15 PolarHBondContact O-N 3.15Å; V12-V15 PolarHBondContact O-N 3.04Å; V12-V15 VanDerWaalsContact O-N 3.16Å; V15-L17 PolarHBondContact O-N 2.91Å; V15-V18 PolarHBondContact O-N 2.83Å; V15-A19 WeakPolarHBondContact O-CB 3.46Å; V15-A19 PolarHBondContact O-N 2.83Å
16	E	95.9	Very high	95.3	Very high	120 Å²	120	91.4 Å²	91.4	56%	0.561	51%	0.505	S	S	*	.	H	α-helix	trans	-62.1	-41.5	176.4	-73.8	180	171.4	0	0	112.1	V12 F13 A19 A20	V12-E16 HydrophobicContact CG1-CG 4.35Å; V12-E16 WeakPolarHBondContact O-CG 3.48Å; V12-E16 PolarHBondContact O-N 3.1Å; F13-E16 PolarHBondContact O-N 2.96Å; E16-A19 PolarHBondContact O-N 2.83Å; E16-A20 WeakPolarHBondContact O-CB 3.43Å; E16-A20 PolarHBondContact O-N 3.49Å
17	L	96.6	Very high	94.7	Very high	85 Å²	85	94.9 Å²	94.9	45%	0.445	51%	0.508	S	S	.	.	H	α-helix	trans	-61.1	-46.2	176.7	-179.5	64.4	0	0	0	111.5	F13 L14 V15 A20 I21	F13-L17 WeakPolarHBondContact O-CB 3.41Å; F13-L17 PolarHBondContact O-N 3.35Å; L14-L17 PolarHBondContact O-N 3.38Å; V15-L17 PolarHBondContact O-N 2.91Å; L17-A20 PolarHBondContact O-N 3.46Å; L17-I21 HydrophobicContact CD1-CD1 4.33Å; L17-I21 HydrophobicContact CG-CD1 4.19Å; L17-I21 WeakPolarHBondContact O-CG1 3.38Å; L17-I21 PolarHBondContact O-N 3.4Å
18	V	97.9	Very high	94.1	Very high	91 Å²	91	94 Å²	94	55%	0.552	50%	0.502	S	S	*	.	H	α-helix	trans	-63.6	-45.9	176.8	173.1	0	0	0	0	110.5	L14 V15 A20 I21 V22	L14-V18 WeakPolarHBondContact O-CG2 3.5Å; L14-V18 PolarHBondContact O-N 3.27Å; L14-V18 VanDerWaalsContact O-N 3.08Å; V15-V18 PolarHBondContact O-N 2.83Å; V18-A20 VanDerWaalsContact C-N 3.3Å; V18-A20 PolarHBondContact O-N 3.47Å; V18-I21 PolarHBondContact O-N 2.88Å; V18-V22 HydrophobicContact CG1-CG2 4.3Å; V18-V22 WeakPolarHBondContact O-CB 3.44Å; V18-V22 VanDerWaalsContact O-CG2 3.29Å; V18-V22 WeakPolarHBondContact O-CG2 3.3Å; V18-V22 PolarHBondContact O-N 3.49Å
19	A	94.3	Very high	93.7	Very high	61 Å²	61	93.9 Å²	93.9	50%	0.504	50%	0.503	S	S	.	.	H	α-helix	trans	-60.4	-39.6	177.8	0	0	0	0	0	112.1	V15 E16 G23	V15-A19 WeakPolarHBondContact O-CB 3.46Å; V15-A19 PolarHBondContact O-N 2.83Å; E16-A19 PolarHBondContact O-N 2.83Å; A19-G23 PolarHBondContact O-N 3.37Å
20	A	92.3	Very high	93.1	Very high	62 Å²	62	94.6 Å²	94.6	51%	0.512	51%	0.506	S	S	.	.	H	α-helix	trans	-64.7	-45.5	176.9	0	0	0	0	0	112.1	E16 L17 V18 G23 F24	E16-A20 WeakPolarHBondContact O-CB 3.43Å; E16-A20 PolarHBondContact O-N 3.49Å; L17-A20 PolarHBondContact O-N 3.46Å; V18-A20 VanDerWaalsContact C-N 3.3Å; V18-A20 PolarHBondContact O-N 3.47Å; A20-G23 PolarHBondContact O-N 2.93Å; A20-F24 WeakPolarHBondContact O-CB 3.44Å; A20-F24 PolarHBondContact O-N 3.47Å
21	I	96.2	Very high	92.3	Very high	98 Å²	98	97.8 Å²	97.8	50%	0.503	51%	0.513	S	S	.	.	H	α-helix	trans	-62.5	-48.5	177.1	-65.8	165.6	0	0	0	110.3	L17 V18 F24 V25	L17-I21 HydrophobicContact CD1-CD1 4.33Å; L17-I21 HydrophobicContact CG-CD1 4.19Å; L17-I21 WeakPolarHBondContact O-CG1 3.38Å; L17-I21 PolarHBondContact O-N 3.4Å; V18-I21 PolarHBondContact O-N 2.88Å; I21-F24 PolarHBondContact O-N 2.9Å; I21-V25 HydrophobicContact CG2-CG2 4.39Å; I21-V25 WeakPolarHBondContact O-CG2 3.32Å; I21-V25 PolarHBondContact O-N 3.44Å
22	V	94.8	Very high	91.7	Very high	72 Å²	72	96.7 Å²	96.7	44%	0.436	51%	0.508	S	S	.	.	H	α-helix	trans	-60.2	-48.4	178.3	171.2	0	0	0	0	110.5	V18 F24 V25 F26	V18-V22 HydrophobicContact CG1-CG2 4.3Å; V18-V22 WeakPolarHBondContact O-CB 3.44Å; V18-V22 VanDerWaalsContact O-CG2 3.29Å; V18-V22 WeakPolarHBondContact O-CG2 3.3Å; V18-V22 PolarHBondContact O-N 3.49Å; V22-F24 VanDerWaalsContact C-N 3.28Å; V22-F24 PolarHBondContact O-N 2.99Å; V22-V25 PolarHBondContact O-N 3.49Å; V22-F26 HydrophobicContact CG1-CD2 3.81Å; V22-F26 HydrophobicContact CG1-CE2 4.24Å; V22-F26 WeakPolarHBondContact O-CD2 3.36Å; V22-F26 PolarHBondContact O-N 2.93Å
23	G	87.1	Confident	91.2	Very high	31 Å²	31	96.1 Å²	96.1	32%	0.32	51%	0.507	S	S	.	.	H	α-helix	trans	-59.8	-38.1	177.9	0	0	0	0	0	112.7	A19 A20 R27	A19-G23 PolarHBondContact O-N 3.37Å; A20-G23 PolarHBondContact O-N 2.93Å; G23-R27 WeakPolarHBondContact O-CA 3.44Å; G23-R27 WeakPolarHBondContact O-CB 3.35Å; G23-R27 PolarHBondContact O-N 3.24Å; G23-R27 VanDerWaalsContact O-N 3.1Å
24	F	87.4	Confident	90.8	Very high	137 Å²	137	95.4 Å²	95.4	60%	0.601	50%	0.504	S	S	*	.	H	α-helix	trans	-68.6	-45.8	176.2	-177.1	-95.9	0	0	0	112.4	A20 I21 V22 R27	A20-F24 WeakPolarHBondContact O-CB 3.44Å; A20-F24 PolarHBondContact O-N 3.47Å; I21-F24 PolarHBondContact O-N 2.9Å; V22-F24 VanDerWaalsContact C-N 3.28Å; V22-F24 PolarHBondContact O-N 2.99Å; F24-R27 WeakPolarHBondContact O-CB 3.4Å; F24-R27 WeakPolarHBondContact O-CD 3.47Å; F24-R27 VanDerWaalsContact O-CG 3.29Å; F24-R27 WeakPolarHBondContact O-CG 3.39Å; F24-R27 PolarHBondContact O-N 3.34Å
25	V	94.8	Very high	90.2	Very high	92 Å²	92	95.4 Å²	95.4	56%	0.558	50%	0.5	S	S	*	.	H	α-helix	trans	-63.6	-46.3	179.5	170.4	0	0	0	0	111	I21 V22 R27	I21-V25 HydrophobicContact CG2-CG2 4.39Å; I21-V25 WeakPolarHBondContact O-CG2 3.32Å; I21-V25 PolarHBondContact O-N 3.44Å; V22-V25 PolarHBondContact O-N 3.49Å; V25-R27 VanDerWaalsContact C-N 3.34Å; V25-R27 PolarHBondContact O-N 3.32Å
26	F	90.5	Very high	90	Very high	109 Å²	109	95 Å²	95	48%	0.478	50%	0.495	S	S	.	.	T	Hydrogen-bonded Turn	trans	-91.8	14.7	-177.3	-65.2	-74.9	0	0	0	114.1	V22 H28 E29 I30	V22-F26 HydrophobicContact CG1-CD2 3.81Å; V22-F26 HydrophobicContact CG1-CE2 4.24Å; V22-F26 WeakPolarHBondContact O-CD2 3.36Å; V22-F26 PolarHBondContact O-N 2.93Å; F26-H28 PolarHBondContact O-N 3.39Å; F26-H28 VanDerWaalsContact O-N 3.15Å; F26-E29 PolarHBondContact O-N 3.49Å; F26-E29 VanDerWaalsContact O-N 3.15Å; F26-I30 HydrophobicContact CB-CD1 4.34Å; F26-I30 WeakPolarHBondContact O-CG1 3.25Å; F26-I30 PolarHBondContact O-N 2.95Å
27	R	84.4	Confident	89.7	Confident	123 Å²	123	93.7 Å²	93.7	46%	0.464	49%	0.492	S	S	.	.	H	α-helix	trans	-54.8	-37.6	-176.6	71.7	-173.6	-175.6	-153.4	-1.2	113.6	G23 F24 V25 K31	G23-R27 WeakPolarHBondContact O-CA 3.44Å; G23-R27 WeakPolarHBondContact O-CB 3.35Å; G23-R27 PolarHBondContact O-N 3.24Å; G23-R27 VanDerWaalsContact O-N 3.1Å; F24-R27 WeakPolarHBondContact O-CB 3.4Å; F24-R27 WeakPolarHBondContact O-CD 3.47Å; F24-R27 VanDerWaalsContact O-CG 3.29Å; F24-R27 WeakPolarHBondContact O-CG 3.39Å; F24-R27 PolarHBondContact O-N 3.34Å; V25-R27 VanDerWaalsContact C-N 3.34Å; V25-R27 PolarHBondContact O-N 3.32Å; R27-K31 VanDerWaalsContact O-CB 3.3Å; R27-K31 WeakPolarHBondContact O-CB 3.48Å; R27-K31 PolarHBondContact O-N 2.97Å
28	H	83.8	Confident	89.5	Confident	108 Å²	108	90.3 Å²	90.3	50%	0.5	47%	0.473	S	S	.	.	H	α-helix	trans	-72.8	-41.7	-178.1	-70.4	-74.2	0	0	0	111.3	F26 K31 N32	F26-H28 PolarHBondContact O-N 3.39Å; F26-H28 VanDerWaalsContact O-N 3.15Å; H28-K31 PolarHBondContact O-N 3.25Å; H28-N32 WeakPolarHBondContact O-CB 3.37Å; H28-N32 VanDerWaalsContact O-CG 3.26Å; H28-N32 PolarHBondContact O-N 3.48Å
29	E	87.9	Confident	89.3	Confident	124 Å²	124	89.2 Å²	89.2	58%	0.579	46%	0.462	S	S	*	.	H	α-helix	trans	-66.3	-43.8	176.8	-65.4	-57.4	154.2	0	0	111.7	F26 K31 N32 S33	F26-E29 PolarHBondContact O-N 3.49Å; F26-E29 VanDerWaalsContact O-N 3.15Å; E29-K31 VanDerWaalsContact C-N 3.33Å; E29-K31 PolarHBondContact O-N 2.92Å; E29-N32 PolarHBondContact O-N 3.3Å; E29-S33 VanDerWaalsContact O-CB 3.25Å; E29-S33 WeakPolarHBondContact O-CB 3.11Å; E29-S33 PolarHBondContact O-N 2.9Å
30	I	84.3	Confident	89.3	Confident	102 Å²	102	92.4 Å²	92.4	52%	0.523	47%	0.465	S	S	.	.	H	α-helix	trans	-60.2	-45.6	175.5	-66.6	167.9	0	0	0	110.1	F26 S33 F34	F26-I30 HydrophobicContact CB-CD1 4.34Å; F26-I30 WeakPolarHBondContact O-CG1 3.25Å; F26-I30 PolarHBondContact O-N 2.95Å; I30-S33 PolarHBondContact O-N 3.46Å; I30-F34 VanDerWaalsContact O-CB 3.31Å; I30-F34 WeakPolarHBondContact O-CB 3.14Å; I30-F34 PolarHBondContact O-N 3.38Å
31	K	81.5	Confident	89.3	Confident	149 Å²	149	90.4 Å²	90.4	65%	0.648	45%	0.448	S	S	*	.	H	α-helix	trans	-59.8	-48.1	177.1	-178.4	179.6	178.8	179.9	0	111.6	R27 H28 E29 F34 K35	R27-K31 VanDerWaalsContact O-CB 3.3Å; R27-K31 WeakPolarHBondContact O-CB 3.48Å; R27-K31 PolarHBondContact O-N 2.97Å; H28-K31 PolarHBondContact O-N 3.25Å; E29-K31 VanDerWaalsContact C-N 3.33Å; E29-K31 PolarHBondContact O-N 2.92Å; K31-F34 PolarHBondContact O-N 3.34Å; K31-K35 WeakPolarHBondContact O-CB 3.36Å; K31-K35 PolarHBondContact O-N 3.18Å
32	N	85.6	Confident	89.2	Confident	79 Å²	79	85.9 Å²	85.9	42%	0.422	43%	0.425	S	S	.	.	H	α-helix	trans	-66.2	-43.5	-178.9	-72.7	-5.8	0	0	0	111.6	H28 E29 K35 N36	H28-N32 WeakPolarHBondContact O-CB 3.37Å; H28-N32 VanDerWaalsContact O-CG 3.26Å; H28-N32 PolarHBondContact O-N 3.48Å; E29-N32 PolarHBondContact O-N 3.3Å; N32-K35 WeakPolarHBondContact O-CB 3.13Å; N32-K35 PolarHBondContact O-N 3.33Å; N32-N36 WeakPolarHBondContact O-CB 3.47Å; N32-N36 PolarHBondContact O-N 2.98Å; N32-N36 PolarHBondContact O-ND2 2.93Å; N32-N36 PolarHBondContact O-OD1 3.49Å
33	S	86.6	Confident	89.1	Confident	64 Å²	64	87 Å²	87	45%	0.448	42%	0.424	S	S	.	.	H	α-helix	trans	-61.5	-46.7	176.1	-176	0	0	0	0	111.4	E29 I30 K35 N36 N37	E29-S33 VanDerWaalsContact O-CB 3.25Å; E29-S33 WeakPolarHBondContact O-CB 3.11Å; E29-S33 PolarHBondContact O-N 2.9Å; I30-S33 PolarHBondContact O-N 3.46Å; S33-K35 PolarHBondContact O-N 3.49Å; S33-N36 PolarHBondContact O-N 3.18Å; S33-N37 WeakPolarHBondContact O-CB 3.36Å; S33-N37 PolarHBondContact O-N 3.44Å; S33-N37 PolarHBondContact O-ND2 3.47Å; S33-N37 PolarHBondContact OG-ND2 2.94Å
34	F	87.9	Confident	89.4	Confident	113 Å²	113	90.3 Å²	90.3	50%	0.496	43%	0.431	S	S	.	.	H	α-helix	trans	-59.6	-47.8	175.5	-178.6	-95.5	0	0	0	111.3	I30 K31 N36 N37 Y38 I59	I30-F34 VanDerWaalsContact O-CB 3.31Å; I30-F34 WeakPolarHBondContact O-CB 3.14Å; I30-F34 PolarHBondContact O-N 3.38Å; K31-F34 PolarHBondContact O-N 3.34Å; F34-N36 VanDerWaalsContact C-N 3.34Å; F34-N36 PolarHBondContact O-N 3.14Å; F34-N37 PolarHBondContact O-N 3.36Å; F34-Y38 VanDerWaalsContact O-CB 3.25Å; F34-Y38 WeakPolarHBondContact O-CB 3.44Å; F34-Y38 PolarHBondContact O-N 3.33Å; F34-I59 HydrophobicContact CZ-CD1 4.41Å
35	K	87.1	Confident	89.8	Confident	91 Å²	91	84.3 Å²	84.3	40%	0.396	40%	0.404	S	S	.	.	H	α-helix	trans	-52.8	-52	176.9	-167.6	-171.7	177.1	-178.6	0	111.2	K31 N32 S33 N37 Y38 E39 V68	K31-K35 WeakPolarHBondContact O-CB 3.36Å; K31-K35 PolarHBondContact O-N 3.18Å; N32-K35 WeakPolarHBondContact O-CB 3.13Å; N32-K35 PolarHBondContact O-N 3.33Å; S33-K35 PolarHBondContact O-N 3.49Å; K35-N37 PolarHBondContact O-N 2.88Å; K35-Y38 PolarHBondContact O-N 2.8Å; K35-E39 WeakPolarHBondContact O-CB 3.34Å; K35-E39 PolarHBondContact O-N 3.36Å; K35-V68 HydrophobicContact CB-CG1 4.39Å; K35-V68 HydrophobicContact CD-CG1 4.1Å; K35-V68 HydrophobicContact CG-CG1 3.27Å
36	N	92.4	Very high	89.6	Confident	84 Å²	84	83.4 Å²	83.4	45%	0.449	40%	0.396	S	S	.	.	H	α-helix	trans	-65.9	-40.2	-176.9	-66.7	-17.1	0	0	0	112.5	N32 S33 F34 K40	N32-N36 WeakPolarHBondContact O-CB 3.47Å; N32-N36 PolarHBondContact O-N 2.98Å; N32-N36 PolarHBondContact O-ND2 2.93Å; N32-N36 PolarHBondContact O-OD1 3.49Å; S33-N36 PolarHBondContact O-N 3.18Å; F34-N36 VanDerWaalsContact C-N 3.34Å; F34-N36 PolarHBondContact O-N 3.14Å; N36-K40 WeakPolarHBondContact O-CG 3.32Å; N36-K40 PolarHBondContact O-N 2.65Å
37	N	90.2	Very high	89.4	Confident	93 Å²	93	80.9 Å²	80.9	50%	0.497	39%	0.392	S	S	.	.	H	α-helix	trans	-70	-39.2	177.9	-74.1	-56.3	0	0	0	111.6	S33 F34 K35 K40 A41	S33-N37 WeakPolarHBondContact O-CB 3.36Å; S33-N37 PolarHBondContact O-N 3.44Å; S33-N37 PolarHBondContact O-ND2 3.47Å; S33-N37 PolarHBondContact OG-ND2 2.94Å; F34-N37 PolarHBondContact O-N 3.36Å; K35-N37 PolarHBondContact O-N 2.88Å; N37-K40 PolarHBondContact O-N 2.67Å; N37-A41 PolarHBondContact O-N 3.36Å
38	Y	91.6	Very high	89.4	Confident	14 Å²	14	79.8 Å²	79.8	6%	0.055	40%	0.399	C	S	.	.	H	α-helix	trans	-68.3	-40.2	177.4	-171.3	-122.5	0	0	0	111.9	F34 K35 K40 A41 L42 V56 I59 Q60 G67 V68	F34-Y38 VanDerWaalsContact O-CB 3.25Å; F34-Y38 WeakPolarHBondContact O-CB 3.44Å; F34-Y38 PolarHBondContact O-N 3.33Å; K35-Y38 PolarHBondContact O-N 2.8Å; Y38-K40 VanDerWaalsContact C-N 3.31Å; Y38-K40 PolarHBondContact O-N 2.65Å; Y38-A41 WeakPolarHBondContact O-CB 3.31Å; Y38-A41 PolarHBondContact O-N 3.47Å; Y38-A41 VanDerWaalsContact O-N 3.12Å; Y38-L42 HydrophobicContact CD1-CD1 3.8Å; Y38-L42 HydrophobicContact CE1-CD1 3.6Å; Y38-L42 HydrophobicContact CE1-CG 4.4Å; Y38-L42 HydrophobicContact CG-CD1 4.4Å; Y38-L42 PolarHBondContact O-N 2.93Å; Y38-V56 HydrophobicContact CE2-CG1 4.5Å; Y38-V56 HydrophobicContact CE2-CG2 4.12Å; Y38-I59 HydrophobicContact CD2-CD1 3.86Å; Y38-I59 HydrophobicContact CE2-CB 4.17Å; Y38-I59 HydrophobicContact CE2-CD1 3.7Å; Y38-I59 HydrophobicContact CE2-CG2 3.9Å; Y38-Q60 VanDerWaalsContact OH-CG 3.23Å; Y38-Q60 WeakPolarHBondContact OH-CG 3.45Å; Y38-Q60 PolarHBondContact OH-NE2 3.46Å; Y38-Q60 VanDerWaalsContact OH-NE2 3.12Å; Y38-G67 WeakPolarHBondContact CE1-O 3.48Å; Y38-V68 HydrophobicContact CD1-CB 4.36Å; Y38-V68 HydrophobicContact CD1-CG2 3.95Å; Y38-V68 HydrophobicContact CE1-CG2 4.48Å
39	E	93.9	Very high	89.2	Confident	67 Å²	67	76.5 Å²	76.5	31%	0.313	40%	0.395	S	S	.	.	H	α-helix	trans	-59.2	-41.2	173.1	-166.8	-171.3	145.2	0	0	112.1	K35 L42 K43 V68	K35-E39 WeakPolarHBondContact O-CB 3.34Å; K35-E39 PolarHBondContact O-N 3.36Å; E39-L42 WeakPolarHBondContact O-CB 3.37Å; E39-L42 PolarHBondContact O-N 2.78Å; E39-K43 WeakPolarHBondContact O-CG 3.38Å; E39-K43 PolarHBondContact O-N 2.96Å; E39-K43 IonicContact OE1-NZ 2.7Å; E39-K43 PolarHBondContact OE1-NZ 2.92Å; E39-V68 HydrophobicContact CB-CG2 3.89Å; E39-V68 HydrophobicContact CG-CG2 4.2Å
40	K	94.1	Very high	89.3	Confident	129 Å²	129	72.7 Å²	72.7	56%	0.561	38%	0.378	S	S	*	.	H	α-helix	trans	-63.6	-41.3	173.9	-72.3	172.4	-176	177.7	0	112	N36 N37 Y38 L42 K43 Q44	N36-K40 WeakPolarHBondContact O-CG 3.32Å; N36-K40 PolarHBondContact O-N 2.65Å; N37-K40 PolarHBondContact O-N 2.67Å; Y38-K40 VanDerWaalsContact C-N 3.31Å; Y38-K40 PolarHBondContact O-N 2.65Å; K40-L42 VanDerWaalsContact C-N 3.34Å; K40-K43 PolarHBondContact O-N 2.91Å; K40-Q44 WeakPolarHBondContact O-CB 3.29Å; K40-Q44 WeakPolarHBondContact O-CG 3.13Å; K40-Q44 PolarHBondContact O-N 3.47Å; K40-Q44 VanDerWaalsContact O-N 3.13Å
41	A	93.4	Very high	89.6	Confident	19 Å²	19	75.9 Å²	75.9	16%	0.157	39%	0.385	C	S	.	.	H	α-helix	trans	-64	-40.4	177.1	0	0	0	0	0	111.6	N37 Y38 Q44 Y45 V56	N37-A41 PolarHBondContact O-N 3.36Å; Y38-A41 WeakPolarHBondContact O-CB 3.31Å; Y38-A41 PolarHBondContact O-N 3.47Å; Y38-A41 VanDerWaalsContact O-N 3.12Å; A41-Q44 CarbonylContact O-C 3Å; A41-Q44 PolarHBondContact O-N 2.88Å; A41-Y45 PolarHBondContact O-N 2.7Å; A41-V56 HydrophobicContact CB-CG2 3.88Å
42	L	93.7	Very high	90	Very high	3 Å²	3	73 Å²	73	2%	0.016	37%	0.37	C	S	.	.	H	α-helix	trans	-60.3	-49	173.2	-84.2	155.2	0	0	0	112.2	Y38 E39 K40 Q44 Y45 V56 V68 W74 T77	Y38-L42 HydrophobicContact CD1-CD1 3.8Å; Y38-L42 HydrophobicContact CE1-CD1 3.6Å; Y38-L42 HydrophobicContact CE1-CG 4.4Å; Y38-L42 HydrophobicContact CG-CD1 4.4Å; Y38-L42 PolarHBondContact O-N 2.93Å; E39-L42 WeakPolarHBondContact O-CB 3.37Å; E39-L42 PolarHBondContact O-N 2.78Å; K40-L42 VanDerWaalsContact C-N 3.34Å; L42-Q44 PolarHBondContact O-N 2.67Å; L42-Y45 WeakPolarHBondContact O-CB 3.39Å; L42-Y45 PolarHBondContact O-N 2.89Å; L42-Y45 VanDerWaalsContact O-N 3.08Å; L42-V56 HydrophobicContact CD2-CG1 4.21Å; L42-V68 HydrophobicContact CD1-CB 4.38Å; L42-V68 HydrophobicContact CD1-CG2 3.25Å; L42-W74 HydrophobicContact CD2-CD2 3.86Å; L42-W74 HydrophobicContact CD2-CE3 4.08Å; L42-W74 HydrophobicContact CD2-CH2 3.46Å; L42-W74 VanDerWaalsContact CD2-CH2 3.46Å; L42-W74 HydrophobicContact CD2-CZ2 3.17Å; L42-W74 HydrophobicContact CD2-CZ3 3.9Å; L42-T77 HydrophobicContact CB-CG2 4.44Å; L42-T77 WeakPolarHBondContact O-CG2 3.33Å
43	K	93.6	Very high	90.3	Very high	96 Å²	96	69.2 Å²	69.2	42%	0.417	35%	0.35	S	S	.	.	H	α-helix	trans	-62.3	-27	178.7	-76.2	173.8	171.9	166.8	0	113.7	E39 K40	E39-K43 WeakPolarHBondContact O-CG 3.38Å; E39-K43 PolarHBondContact O-N 2.96Å; E39-K43 IonicContact OE1-NZ 2.7Å; E39-K43 PolarHBondContact OE1-NZ 2.92Å; K40-K43 PolarHBondContact O-N 2.91Å
44	Q	93.4	Very high	90.7	Very high	100 Å²	100	71.5 Å²	71.5	47%	0.467	35%	0.353	S	S	.	.	T	Hydrogen-bonded Turn	trans	-96.5	0.3	179.1	-67.4	177.2	-21.1	0	0	113.3	K40 A41 L42 N46	K40-Q44 WeakPolarHBondContact O-CB 3.29Å; K40-Q44 WeakPolarHBondContact O-CG 3.13Å; K40-Q44 PolarHBondContact O-N 3.47Å; K40-Q44 VanDerWaalsContact O-N 3.13Å; A41-Q44 CarbonylContact O-C 3Å; A41-Q44 PolarHBondContact O-N 2.88Å; L42-Q44 PolarHBondContact O-N 2.67Å; Q44-N46 PolarHBondContact O-N 3.42Å
45	Y	94.4	Very high	90.8	Very high	12 Å²	12	68.3 Å²	68.3	5%	0.047	35%	0.347	C	S	.	.			trans	-63.2	132.2	179.5	-174.2	-88.4	0	0	0	110.6	A41 L42 V56 D57 W74 Y79 P86	A41-Y45 PolarHBondContact O-N 2.7Å; L42-Y45 WeakPolarHBondContact O-CB 3.39Å; L42-Y45 PolarHBondContact O-N 2.89Å; L42-Y45 VanDerWaalsContact O-N 3.08Å; Y45-V56 HydrophobicContact CD2-CB 3.87Å; Y45-V56 HydrophobicContact CD2-CG1 3.91Å; Y45-V56 HydrophobicContact CD2-CG2 4.25Å; Y45-V56 HydrophobicContact CE2-CB 4.15Å; Y45-V56 HydrophobicContact CE2-CG1 4.14Å; Y45-D57 WeakPolarHBondContact CE2-OD1 3.32Å; Y45-D57 PolarHBondContact OH-OD1 2.81Å; Y45-D57 PolarHBondContact OH-OD2 2.89Å; Y45-W74 AromaticContact CD1-CH2 3.85Å; Y45-W74 HydrophobicContact CD1-CH2 3.85Å; Y45-W74 AromaticContact CD1-CZ3 3.73Å; Y45-W74 HydrophobicContact CD1-CZ3 3.73Å; Y45-W74 HydrophobicContact CD2-CH2 4.01Å; Y45-W74 HydrophobicContact CE1-CH2 4.25Å; Y45-W74 HydrophobicContact CE1-CZ3 4.4Å; Y45-W74 HydrophobicContact CE2-CH2 4.4Å; Y45-W74 AromaticContact CG-CH2 3.72Å; Y45-W74 HydrophobicContact CG-CH2 3.72Å; Y45-W74 AromaticContact CG-CZ3 3.85Å; Y45-W74 HydrophobicContact CG-CZ3 3.85Å; Y45-Y79 HydrophobicContact CD1-CD1 4.02Å; Y45-Y79 AromaticContact CD1-CD2 3.74Å; Y45-Y79 HydrophobicContact CD1-CD2 3.74Å; Y45-Y79 HydrophobicContact CD1-CE1 4.37Å; Y45-Y79 HydrophobicContact CD1-CE2 4.08Å; Y45-Y79 AromaticContact CD1-CG 3.7Å; Y45-Y79 HydrophobicContact CD1-CG 3.7Å; Y45-Y79 HydrophobicContact CE1-CD1 4.09Å; Y45-Y79 AromaticContact CE1-CD2 3.85Å; Y45-Y79 HydrophobicContact CE1-CD2 3.85Å; Y45-Y79 AromaticContact CE1-CE1 3.96Å; Y45-Y79 HydrophobicContact CE1-CE1 3.96Å; Y45-Y79 AromaticContact CE1-CE2 3.68Å; Y45-Y79 HydrophobicContact CE1-CE2 3.68Å; Y45-Y79 HydrophobicContact CE1-CG 4.04Å; Y45-Y79 AromaticContact CE1-CZ 3.74Å; Y45-P86 HydrophobicContact CE1-CB 3.95Å; Y45-P86 WeakPolarHBondContact OH-CB 2.96Å
46	N	91.6	Very high	91.1	Very high	72 Å²	72	64 Å²	64	39%	0.385	33%	0.329	S	S	.	.			trans	-139	3.2	-179	63.6	15	0	0	0	113.3	Q44 T48 S53	Q44-N46 PolarHBondContact O-N 3.42Å; N46-T48 HydrophobicContact CB-CG2 4.2Å; N46-T48 VanDerWaalsContact CG-OG1 3.24Å; N46-T48 PolarHBondContact ND2-OG1 3.36Å; N46-T48 PolarHBondContact O-N 3.4Å; N46-T48 VanDerWaalsContact O-N 3.13Å; N46-T48 WeakPolarHBondContact OD1-CB 3.2Å; N46-T48 WeakPolarHBondContact OD1-CG2 3.25Å; N46-T48 PolarHBondContact OD1-N 3.49Å; N46-T48 PolarHBondContact OD1-OG1 2.86Å; N46-S53 PolarHBondContact N-OG 3.12Å; N46-S53 PolarHBondContact OD1-OG 2.68Å
47	S	86.9	Confident	91.2	Very high	56 Å²	56	61.7 Å²	61.7	39%	0.392	32%	0.316	S	S	.	.	S	Bend	trans	58.9	19.7	-178.9	-177.5	0	0	0	0	114.2	G49 S53	S47-G49 VanDerWaalsContact C-N 3.26Å; S47-G49 PolarHBondContact O-N 3.3Å; S47-S53 PolarHBondContact N-OG 3.39Å
48	T	84.4	Confident	91.2	Very high	101 Å²	101	64.4 Å²	64.4	62%	0.62	32%	0.324	S	S	*	.	S	Bend	trans	-82.1	-0.2	179.8	61.1	0	0	0	0	114	N46 D50	N46-T48 HydrophobicContact CB-CG2 4.2Å; N46-T48 VanDerWaalsContact CG-OG1 3.24Å; N46-T48 PolarHBondContact ND2-OG1 3.36Å; N46-T48 PolarHBondContact O-N 3.4Å; N46-T48 VanDerWaalsContact O-N 3.13Å; N46-T48 WeakPolarHBondContact OD1-CB 3.2Å; N46-T48 WeakPolarHBondContact OD1-CG2 3.25Å; N46-T48 PolarHBondContact OD1-N 3.49Å; N46-T48 PolarHBondContact OD1-OG1 2.86Å; T48-D50 VanDerWaalsContact C-N 3.33Å
49	G	77.8	Confident	91.1	Very high	39 Å²	39	65.8 Å²	65.8	40%	0.402	33%	0.332	S	S	.	.			trans	75.7	21.1	-175.6	0	0	0	0	0	113.4	S47 H54	S47-G49 VanDerWaalsContact C-N 3.26Å; S47-G49 PolarHBondContact O-N 3.3Å; G49-H54 VanDerWaalsContact C-CD2 3.49Å; G49-H54 WeakPolarHBondContact CA-NE2 3.32Å; G49-H54 PolarHBondContact O-CD2 2.92Å; G49-H54 PolarHBondContact O-NE2 3.34Å
50	D	90.9	Very high	90.8	Very high	43 Å²	43	62.6 Å²	62.6	23%	0.23	32%	0.317	C	S	.	.			trans	-68.8	163.9	168.4	80.7	-42.6	0	0	0	110.9	T48 R52 S53 H54	T48-D50 VanDerWaalsContact C-N 3.33Å; D50-R52 PolarHBondContact O-N 3.4Å; D50-R52 VanDerWaalsContact O-N 3.09Å; D50-R52 WeakPolarHBondContact OD2-CB 3.45Å; D50-R52 PolarHBondContact OD2-N 3.13Å; D50-S53 PolarHBondContact O-N 3.04Å; D50-S53 WeakPolarHBondContact OD1-CB 3.36Å; D50-S53 PolarHBondContact OD1-N 3.38Å; D50-S53 PolarHBondContact OD1-OG 2.95Å; D50-H54 PolarHBondContact O-CD2 2.83Å; D50-H54 PolarHBondContact O-N 3.25Å
51	Y	89.8	Confident	90.3	Very high	170 Å²	170	60.5 Å²	60.5	67%	0.667	31%	0.312	S	S	*	.	H	α-helix	trans	-59.2	-27.2	-177.3	72.1	-88.7	0	0	0	112.7	A55	Y51-A55 VanDerWaalsContact O-CB 3.26Å; Y51-A55 WeakPolarHBondContact O-CB 3.39Å; Y51-A55 PolarHBondContact O-N 3.15Å
52	R	89.8	Confident	89.8	Confident	87 Å²	87	62.9 Å²	62.9	33%	0.328	33%	0.325	S	S	.	.	H	α-helix	trans	-74.7	-47.9	177.8	-56.8	177.8	-178.4	160.2	3.7	111.1	D50 H54 A55 V56	D50-R52 PolarHBondContact O-N 3.4Å; D50-R52 VanDerWaalsContact O-N 3.09Å; D50-R52 WeakPolarHBondContact OD2-CB 3.45Å; D50-R52 PolarHBondContact OD2-N 3.13Å; R52-H54 VanDerWaalsContact C-N 3.32Å; R52-H54 PolarHBondContact O-N 2.99Å; R52-A55 PolarHBondContact O-N 3.37Å; R52-A55 VanDerWaalsContact O-N 3.16Å; R52-V56 WeakPolarHBondContact O-CG2 3.44Å; R52-V56 PolarHBondContact O-N 3.19Å
53	S	93.6	Very high	89.2	Confident	1 Å²	1	66.7 Å²	66.7	1%	0.007	35%	0.345	C	S	.	.	H	α-helix	trans	-60.7	-43.9	176.3	-58.9	0	0	0	0	111	N46 S47 D50 A55 V56 D57	N46-S53 PolarHBondContact N-OG 3.12Å; N46-S53 PolarHBondContact OD1-OG 2.68Å; S47-S53 PolarHBondContact N-OG 3.39Å; D50-S53 PolarHBondContact O-N 3.04Å; D50-S53 WeakPolarHBondContact OD1-CB 3.36Å; D50-S53 PolarHBondContact OD1-N 3.38Å; D50-S53 PolarHBondContact OD1-OG 2.95Å; S53-A55 VanDerWaalsContact C-N 3.34Å; S53-A55 PolarHBondContact O-N 2.72Å; S53-V56 PolarHBondContact O-N 2.83Å; S53-D57 PolarHBondContact O-N 3.18Å
54	H	93.7	Very high	88.4	Confident	112 Å²	112	67 Å²	67	52%	0.519	35%	0.347	S	S	.	.	H	α-helix	trans	-61.7	-39.4	174.2	-81	-55	0	0	0	113.3	G49 D50 R52 K58	G49-H54 VanDerWaalsContact C-CD2 3.49Å; G49-H54 WeakPolarHBondContact CA-NE2 3.32Å; G49-H54 PolarHBondContact O-CD2 2.92Å; G49-H54 PolarHBondContact O-NE2 3.34Å; D50-H54 PolarHBondContact O-CD2 2.83Å; D50-H54 PolarHBondContact O-N 3.25Å; R52-H54 VanDerWaalsContact C-N 3.32Å; R52-H54 PolarHBondContact O-N 2.99Å; H54-K58 WeakPolarHBondContact O-CB 3.36Å; H54-K58 PolarHBondContact O-N 3.04Å
55	A	91.6	Very high	87.9	Confident	45 Å²	45	63.9 Å²	63.9	37%	0.372	34%	0.336	S	S	.	.	H	α-helix	trans	-64.5	-43.9	176.2	0	0	0	0	0	111.4	Y51 R52 S53 K58 I59	Y51-A55 VanDerWaalsContact O-CB 3.26Å; Y51-A55 WeakPolarHBondContact O-CB 3.39Å; Y51-A55 PolarHBondContact O-N 3.15Å; R52-A55 PolarHBondContact O-N 3.37Å; R52-A55 VanDerWaalsContact O-N 3.16Å; S53-A55 VanDerWaalsContact C-N 3.34Å; S53-A55 PolarHBondContact O-N 2.72Å; A55-K58 PolarHBondContact O-N 3.23Å; A55-I59 WeakPolarHBondContact O-CB 3.48Å; A55-I59 WeakPolarHBondContact O-CD1 3.48Å; A55-I59 WeakPolarHBondContact O-CG1 3.35Å; A55-I59 PolarHBondContact O-N 2.93Å
56	V	93.4	Very high	87.5	Confident	1 Å²	1	63.8 Å²	63.8	1%	0.006	34%	0.337	C	S	.	.	H	α-helix	trans	-60.3	-51.4	176.2	172.9	0	0	0	0	110.6	Y38 A41 L42 Y45 R52 S53 K58 I59 Q60 W74	Y38-V56 HydrophobicContact CE2-CG1 4.5Å; Y38-V56 HydrophobicContact CE2-CG2 4.12Å; A41-V56 HydrophobicContact CB-CG2 3.88Å; L42-V56 HydrophobicContact CD2-CG1 4.21Å; Y45-V56 HydrophobicContact CD2-CB 3.87Å; Y45-V56 HydrophobicContact CD2-CG1 3.91Å; Y45-V56 HydrophobicContact CD2-CG2 4.25Å; Y45-V56 HydrophobicContact CE2-CB 4.15Å; Y45-V56 HydrophobicContact CE2-CG1 4.14Å; R52-V56 WeakPolarHBondContact O-CG2 3.44Å; R52-V56 PolarHBondContact O-N 3.19Å; S53-V56 PolarHBondContact O-N 2.83Å; V56-K58 VanDerWaalsContact C-N 3.32Å; V56-K58 PolarHBondContact O-N 3.06Å; V56-I59 PolarHBondContact O-N 3.05Å; V56-Q60 WeakPolarHBondContact O-CG 2.82Å; V56-Q60 PolarHBondContact O-N 3.03Å; V56-W74 HydrophobicContact CG1-CH2 3.93Å; V56-W74 HydrophobicContact CG1-CZ2 3.93Å
57	D	92.7	Very high	87.4	Confident	35 Å²	35	60.5 Å²	60.5	19%	0.187	32%	0.32	C	S	.	.	H	α-helix	trans	-62.5	-40.3	-179.3	-68.8	-29.1	0	0	0	111.8	Y45 S53 Q60 N61 S88	Y45-D57 WeakPolarHBondContact CE2-OD1 3.32Å; Y45-D57 PolarHBondContact OH-OD1 2.81Å; Y45-D57 PolarHBondContact OH-OD2 2.89Å; S53-D57 PolarHBondContact O-N 3.18Å; D57-Q60 PolarHBondContact O-N 3.12Å; D57-N61 VanDerWaalsContact O-CB 3.31Å; D57-N61 WeakPolarHBondContact O-CB 3.25Å; D57-N61 VanDerWaalsContact O-CG 3.27Å; D57-N61 PolarHBondContact O-N 2.98Å; D57-N61 PolarHBondContact O-ND2 2.93Å; D57-S88 VanDerWaalsContact OD1-CB 3.31Å; D57-S88 WeakPolarHBondContact OD1-CB 3.22Å; D57-S88 PolarHBondContact OD1-OG 2.89Å
58	K	90.3	Very high	87.4	Confident	151 Å²	151	59.5 Å²	59.5	66%	0.657	31%	0.312	S	S	*	.	H	α-helix	trans	-65.1	-44.5	177.2	-174.2	173.4	-176.5	178.3	0	111.5	H54 A55 V56 T62	H54-K58 WeakPolarHBondContact O-CB 3.36Å; H54-K58 PolarHBondContact O-N 3.04Å; A55-K58 PolarHBondContact O-N 3.23Å; V56-K58 VanDerWaalsContact C-N 3.32Å; V56-K58 PolarHBondContact O-N 3.06Å; K58-T62 WeakPolarHBondContact O-CB 3.28Å; K58-T62 PolarHBondContact O-N 3.35Å; K58-T62 PolarHBondContact O-OG1 3.26Å
59	I	89.2	Confident	87.4	Confident	42 Å²	42	59 Å²	59	22%	0.215	31%	0.309	C	S	.	.	H	α-helix	trans	-59.4	-48.7	177.3	-73.9	166.3	0	0	0	109.9	F34 Y38 A55 V56 T62 L63	F34-I59 HydrophobicContact CZ-CD1 4.41Å; Y38-I59 HydrophobicContact CD2-CD1 3.86Å; Y38-I59 HydrophobicContact CE2-CB 4.17Å; Y38-I59 HydrophobicContact CE2-CD1 3.7Å; Y38-I59 HydrophobicContact CE2-CG2 3.9Å; A55-I59 WeakPolarHBondContact O-CB 3.48Å; A55-I59 WeakPolarHBondContact O-CD1 3.48Å; A55-I59 WeakPolarHBondContact O-CG1 3.35Å; A55-I59 PolarHBondContact O-N 2.93Å; V56-I59 PolarHBondContact O-N 3.05Å; I59-T62 PolarHBondContact O-N 2.93Å; I59-L63 HydrophobicContact CG2-CD1 4.01Å; I59-L63 VanDerWaalsContact O-CB 3.29Å; I59-L63 WeakPolarHBondContact O-CB 3.36Å; I59-L63 WeakPolarHBondContact O-CG 3.15Å; I59-L63 PolarHBondContact O-N 3.44Å
60	Q	88.3	Confident	87.6	Confident	1 Å²	1	58.1 Å²	58.1	1%	0.005	30%	0.295	C	S	.	.	H	α-helix	trans	-65.9	-43.1	-177	-69.4	-177.7	-18.5	0	0	112.3	Y38 V56 D57 H64 C65 W74 S88 C89	Y38-Q60 VanDerWaalsContact OH-CG 3.23Å; Y38-Q60 WeakPolarHBondContact OH-CG 3.45Å; Y38-Q60 PolarHBondContact OH-NE2 3.46Å; Y38-Q60 VanDerWaalsContact OH-NE2 3.12Å; V56-Q60 WeakPolarHBondContact O-CG 2.82Å; V56-Q60 PolarHBondContact O-N 3.03Å; D57-Q60 PolarHBondContact O-N 3.12Å; Q60-H64 WeakPolarHBondContact O-CA 3.41Å; Q60-H64 PolarHBondContact O-N 3.16Å; Q60-C65 WeakPolarHBondContact CA-O 3.38Å; Q60-C65 VanDerWaalsContact CB-O 3.22Å; Q60-C65 WeakPolarHBondContact CB-O 3.42Å; Q60-C65 VanDerWaalsContact CG-O 3.3Å; Q60-C65 WeakPolarHBondContact CG-O 3.49Å; Q60-C65 PolarHBondContact O-N 3.45Å; Q60-W74 VanDerWaalsContact NE2-CZ2 3.31Å; Q60-S88 PolarHBondContact OE1-OG 3.08Å; Q60-C89 PolarHBondContact OE1-SG 2.91Å
61	N	84.7	Confident	87.3	Confident	84 Å²	84	57.6 Å²	57.6	45%	0.449	29%	0.29	S	S	.	.	H	α-helix	trans	-68.2	-38.5	176.2	-73.1	-46.3	0	0	0	112.9	D57 H64 S88	D57-N61 VanDerWaalsContact O-CB 3.31Å; D57-N61 WeakPolarHBondContact O-CB 3.25Å; D57-N61 VanDerWaalsContact O-CG 3.27Å; D57-N61 PolarHBondContact O-N 2.98Å; D57-N61 PolarHBondContact O-ND2 2.93Å; N61-H64 PolarHBondContact O-CE1 3.22Å; N61-H64 VanDerWaalsContact O-CE1 3.22Å; N61-H64 PolarHBondContact O-ND1 3.07Å; N61-S88 PolarHBondContact OD1-O 3Å
62	T	82.5	Confident	87.1	Confident	70 Å²	70	56.4 Å²	56.4	43%	0.429	28%	0.284	S	S	.	.	H	α-helix	trans	-79.2	-38.8	-175.1	-53.2	0	0	0	0	112	K58 I59	K58-T62 WeakPolarHBondContact O-CB 3.28Å; K58-T62 PolarHBondContact O-N 3.35Å; K58-T62 PolarHBondContact O-OG1 3.26Å; I59-T62 PolarHBondContact O-N 2.93Å
63	L	80.6	Confident	87	Confident	83 Å²	83	54.5 Å²	54.5	44%	0.435	28%	0.28	S	S	.	.	H	α-helix	trans	-96.2	-0.9	-178.6	-56.5	-175.2	0	0	0	112.5	I59 C65 F112	I59-L63 HydrophobicContact CG2-CD1 4.01Å; I59-L63 VanDerWaalsContact O-CB 3.29Å; I59-L63 WeakPolarHBondContact O-CB 3.36Å; I59-L63 WeakPolarHBondContact O-CG 3.15Å; I59-L63 PolarHBondContact O-N 3.44Å; L63-C65 PolarHBondContact O-N 3.5Å; L63-C65 VanDerWaalsContact O-N 3.17Å; L63-F112 HydrophobicContact CD2-CD2 4.19Å; L63-F112 HydrophobicContact CD2-CE2 4.49Å
64	H	77.3	Confident	86.9	Confident	102 Å²	102	54.4 Å²	54.4	47%	0.472	28%	0.28	S	S	.	.	T	Hydrogen-bonded Turn	trans	52.6	34.9	-179.2	-61.2	-58.6	0	0	0	113.5	Q60 N61 K91	Q60-H64 WeakPolarHBondContact O-CA 3.41Å; Q60-H64 PolarHBondContact O-N 3.16Å; N61-H64 PolarHBondContact O-CE1 3.22Å; N61-H64 VanDerWaalsContact O-CE1 3.22Å; N61-H64 PolarHBondContact O-ND1 3.07Å; H64-K91 PolarHBondContact O-NZ 3.45Å
65	C	81.9	Confident	86.8	Confident	35 Å²	35	52.4 Å²	52.4	24%	0.236	28%	0.276	C	S	.	.			trans	-112.6	164.2	-178.8	68	0	0	0	0	111.5	Q60 L63	Q60-C65 WeakPolarHBondContact CA-O 3.38Å; Q60-C65 VanDerWaalsContact CB-O 3.22Å; Q60-C65 WeakPolarHBondContact CB-O 3.42Å; Q60-C65 VanDerWaalsContact CG-O 3.3Å; Q60-C65 WeakPolarHBondContact CG-O 3.49Å; Q60-C65 PolarHBondContact O-N 3.45Å; L63-C65 PolarHBondContact O-N 3.5Å; L63-C65 VanDerWaalsContact O-N 3.17Å
66	C	87	Confident	86.7	Confident	9 Å²	9	55.9 Å²	55.9	6%	0.061	29%	0.288	C	S	.	.			trans	-139.1	126.6	173.8	-171.8	0	0	0	0	110.6	D70 Y71 W74 C89 V104	C66-D70 CarbonylContact O-C 3.6Å; C66-Y71 PolarHBondContact O-N 3.43Å; C66-Y71 VanDerWaalsContact O-N 3.14Å; C66-W74 VanDerWaalsContact SG-CD1 3.54Å; C66-W74 PolarHBondContact SG-NE1 3.09Å; C66-C89 VanDerWaalsContact CA-SG 3.56Å; C66-C89 HydrophobicContact CB-CB 3.66Å; C66-C89 WeakPolarHBondContact CB-SG 3.16Å; C66-C89 WeakPolarHBondContact SG-CB 3.44Å; C66-C89 CovalentContact SG-SG 2.03Å; C66-C89 PolarHBondContact SG-SG 3.41Å; C66-V104 HydrophobicContact CB-CG1 3.17Å
67	G	88.5	Confident	86.7	Confident	4 Å²	4	56.2 Å²	56.2	4%	0.041	29%	0.29	C	S	.	.	S	Bend	trans	72.9	-177.8	-172.6	0	0	0	0	0	113.4	Y38 D70	Y38-G67 WeakPolarHBondContact CE1-O 3.48Å; G67-D70 WeakPolarHBondContact CA-O 3.43Å
68	V	88.3	Confident	86.6	Confident	35 Å²	35	61 Å²	61	21%	0.212	32%	0.315	C	S	.	.	S	Bend	trans	-74.6	-41.8	-178.4	-175.9	0	0	0	0	111.2	K35 Y38 E39 L42 D73	K35-V68 HydrophobicContact CB-CG1 4.39Å; K35-V68 HydrophobicContact CD-CG1 4.1Å; K35-V68 HydrophobicContact CG-CG1 3.27Å; Y38-V68 HydrophobicContact CD1-CB 4.36Å; Y38-V68 HydrophobicContact CD1-CG2 3.95Å; Y38-V68 HydrophobicContact CE1-CG2 4.48Å; E39-V68 HydrophobicContact CB-CG2 3.89Å; E39-V68 HydrophobicContact CG-CG2 4.2Å; L42-V68 HydrophobicContact CD1-CB 4.38Å; L42-V68 HydrophobicContact CD1-CG2 3.25Å; V68-D73 WeakPolarHBondContact CA-OD2 3.29Å; V68-D73 WeakPolarHBondContact CB-OD2 3.5Å; V68-D73 PolarHBondContact N-OD2 2.87Å
69	T	83.3	Confident	86.6	Confident	90 Å²	90	55.1 Å²	55.1	55%	0.552	29%	0.289	S	S	*	.	S	Bend	trans	-124	-41	-176.3	-43.9	0	0	0	0	109.4	D73	T69-D73 PolarHBondContact N-OD2 3.27Å
70	D	82.1	Confident	86.7	Confident	20 Å²	20	55.9 Å²	55.9	11%	0.107	29%	0.29	C	S	.	.	S	Bend	trans	-157.2	159.8	-173.8	-167.5	-40.5	0	0	0	109.5	C66 G67 R72 D73 N105	C66-D70 CarbonylContact O-C 3.6Å; G67-D70 WeakPolarHBondContact CA-O 3.43Å; D70-R72 PolarHBondContact O-N 2.87Å; D70-R72 PolarHBondContact OD1-N 3.48Å; D70-R72 IonicContact OD1-NE 3.71Å; D70-R72 IonicContact OD2-CZ 3.22Å; D70-R72 VanDerWaalsContact OD2-CZ 3.22Å; D70-R72 IonicContact OD2-NE 2.95Å; D70-R72 PolarHBondContact OD2-NE 3.3Å; D70-R72 IonicContact OD2-NH2 2.68Å; D70-R72 PolarHBondContact OD2-NH2 3.17Å; D70-D73 PolarHBondContact N-OD2 3.14Å; D70-D73 VanDerWaalsContact N-OD2 3.15Å; D70-D73 WeakPolarHBondContact O-CB 3.34Å; D70-D73 PolarHBondContact O-N 3.27Å; D70-N105 VanDerWaalsContact CG-ND2 3.31Å; D70-N105 VanDerWaalsContact OD1-CG 3.28Å; D70-N105 PolarHBondContact OD1-ND2 3.37Å; D70-N105 PolarHBondContact OD1-OD1 3.46Å; D70-N105 PolarHBondContact OD2-ND2 2.03Å
71	Y	83.9	Confident	86.5	Confident	32 Å²	32	60.6 Å²	60.6	13%	0.125	32%	0.323	C	S	.	.	G	3₁₀ helix	trans	-53.6	-28.1	173.5	82.5	-95.8	0	0	0	112	C66 D73 W74 F85 A101 N105	C66-Y71 PolarHBondContact O-N 3.43Å; C66-Y71 VanDerWaalsContact O-N 3.14Å; Y71-D73 PolarHBondContact O-N 2.9Å; Y71-W74 WeakPolarHBondContact O-CB 3.48Å; Y71-W74 VanDerWaalsContact O-CD1 3.28Å; Y71-W74 PolarHBondContact O-N 3.22Å; Y71-F85 HydrophobicContact CD2-CD1 4.49Å; Y71-A101 VanDerWaalsContact CD1-O 3.28Å; Y71-A101 WeakPolarHBondContact CD1-O 3.45Å; Y71-A101 HydrophobicContact CD2-CB 3.8Å; Y71-A101 HydrophobicContact CE1-CB 4.09Å; Y71-A101 WeakPolarHBondContact CE1-O 3.19Å; Y71-A101 HydrophobicContact CE2-CB 3.3Å; Y71-A101 HydrophobicContact CG-CB 4.41Å; Y71-A101 VanDerWaalsContact CZ-CB 3.46Å; Y71-N105 VanDerWaalsContact CD1-ND2 3.28Å; Y71-N105 WeakPolarHBondContact CD1-ND2 3.39Å; Y71-N105 WeakPolarHBondContact CD1-OD1 3.23Å; Y71-N105 VanDerWaalsContact CE1-ND2 3.33Å; Y71-N105 WeakPolarHBondContact CE1-ND2 3.16Å
72	R	85.8	Confident	86.6	Confident	145 Å²	145	64 Å²	64	55%	0.547	34%	0.336	S	S	.	.	G	3₁₀ helix	trans	-60.1	-22.7	178.2	-67.5	178.2	-73.7	171	-1.2	113	D70 W74 T75	D70-R72 PolarHBondContact O-N 2.87Å; D70-R72 PolarHBondContact OD1-N 3.48Å; D70-R72 IonicContact OD1-NE 3.71Å; D70-R72 IonicContact OD2-CZ 3.22Å; D70-R72 VanDerWaalsContact OD2-CZ 3.22Å; D70-R72 IonicContact OD2-NE 2.95Å; D70-R72 PolarHBondContact OD2-NE 3.3Å; D70-R72 IonicContact OD2-NH2 2.68Å; D70-R72 PolarHBondContact OD2-NH2 3.17Å; R72-W74 PolarHBondContact O-N 3.26Å; R72-T75 WeakPolarHBondContact O-CB 3.42Å; R72-T75 WeakPolarHBondContact O-CG2 3.26Å; R72-T75 PolarHBondContact O-N 3.29Å; R72-T75 PolarHBondContact O-OG1 3.18Å
73	D	89.3	Confident	86.7	Confident	47 Å²	47	65.7 Å²	65.7	25%	0.251	34%	0.338	S	S	.	.	G	3₁₀ helix	trans	-61.4	-20	175	-62.4	-36.2	0	0	0	112.7	V68 T69 D70 Y71 T75	V68-D73 WeakPolarHBondContact CA-OD2 3.29Å; V68-D73 WeakPolarHBondContact CB-OD2 3.5Å; V68-D73 PolarHBondContact N-OD2 2.87Å; T69-D73 PolarHBondContact N-OD2 3.27Å; D70-D73 PolarHBondContact N-OD2 3.14Å; D70-D73 VanDerWaalsContact N-OD2 3.15Å; D70-D73 WeakPolarHBondContact O-CB 3.34Å; D70-D73 PolarHBondContact O-N 3.27Å; Y71-D73 PolarHBondContact O-N 2.9Å; D73-T75 VanDerWaalsContact C-N 3.27Å; D73-T75 PolarHBondContact O-N 3.46Å
74	W	91.6	Very high	87.1	Confident	0 Å²	0	61.8 Å²	61.8	0%	0	32%	0.317	C	S	.	.	G	3₁₀ helix	trans	-67.3	-27.5	173.3	-73.1	103.2	0	0	0	112.7	L42 Y45 V56 Q60 C66 Y71 R72 D76 T77 Y79 Y80 F85 P86 C89	L42-W74 HydrophobicContact CD2-CD2 3.86Å; L42-W74 HydrophobicContact CD2-CE3 4.08Å; L42-W74 HydrophobicContact CD2-CH2 3.46Å; L42-W74 VanDerWaalsContact CD2-CH2 3.46Å; L42-W74 HydrophobicContact CD2-CZ2 3.17Å; L42-W74 HydrophobicContact CD2-CZ3 3.9Å; Y45-W74 AromaticContact CD1-CH2 3.85Å; Y45-W74 HydrophobicContact CD1-CH2 3.85Å; Y45-W74 AromaticContact CD1-CZ3 3.73Å; Y45-W74 HydrophobicContact CD1-CZ3 3.73Å; Y45-W74 HydrophobicContact CD2-CH2 4.01Å; Y45-W74 HydrophobicContact CE1-CH2 4.25Å; Y45-W74 HydrophobicContact CE1-CZ3 4.4Å; Y45-W74 HydrophobicContact CE2-CH2 4.4Å; Y45-W74 AromaticContact CG-CH2 3.72Å; Y45-W74 HydrophobicContact CG-CH2 3.72Å; Y45-W74 AromaticContact CG-CZ3 3.85Å; Y45-W74 HydrophobicContact CG-CZ3 3.85Å; V56-W74 HydrophobicContact CG1-CH2 3.93Å; V56-W74 HydrophobicContact CG1-CZ2 3.93Å; Q60-W74 VanDerWaalsContact NE2-CZ2 3.31Å; C66-W74 VanDerWaalsContact SG-CD1 3.54Å; C66-W74 PolarHBondContact SG-NE1 3.09Å; Y71-W74 WeakPolarHBondContact O-CB 3.48Å; Y71-W74 VanDerWaalsContact O-CD1 3.28Å; Y71-W74 PolarHBondContact O-N 3.22Å; R72-W74 PolarHBondContact O-N 3.26Å; W74-D76 PolarHBondContact O-N 3.4Å; W74-T77 HydrophobicContact CE3-CG2 4.06Å; W74-T77 WeakPolarHBondContact O-CB 3.33Å; W74-T77 PolarHBondContact O-N 3.22Å; W74-T77 PolarHBondContact O-OG1 2.98Å; W74-Y79 HydrophobicContact CE3-CD1 4.44Å; W74-Y79 HydrophobicContact CZ3-CD1 4.22Å; W74-Y80 HydrophobicContact CB-CD2 3.58Å; W74-Y80 HydrophobicContact CB-CE2 4.24Å; W74-Y80 HydrophobicContact CB-CG 4.31Å; W74-Y80 WeakPolarHBondContact O-CB 3.43Å; W74-F85 HydrophobicContact CB-CB 4.12Å; W74-F85 HydrophobicContact CD2-CB 4.23Å; W74-F85 HydrophobicContact CG-CB 3.73Å; W74-P86 HydrophobicContact CH2-CB 4.38Å; W74-P86 HydrophobicContact CH2-CG 3.4Å; W74-P86 HydrophobicContact CZ2-CB 4.47Å; W74-P86 HydrophobicContact CZ2-CG 3.13Å; W74-P86 HydrophobicContact CZ3-CG 4.21Å; W74-C89 PolarHBondContact NE1-SG 3.01Å; W74-C89 VanDerWaalsContact NE1-SG 3.43Å
75	T	90.5	Very high	87.6	Confident	70 Å²	70	57 Å²	57	43%	0.429	30%	0.295	S	S	.	.	G	3₁₀ helix	trans	-58.6	-24.8	-179	64.4	0	0	0	0	112.9	R72 D73 T77 Y80	R72-T75 WeakPolarHBondContact O-CB 3.42Å; R72-T75 WeakPolarHBondContact O-CG2 3.26Å; R72-T75 PolarHBondContact O-N 3.29Å; R72-T75 PolarHBondContact O-OG1 3.18Å; D73-T75 VanDerWaalsContact C-N 3.27Å; D73-T75 PolarHBondContact O-N 3.46Å; T75-T77 VanDerWaalsContact C-N 3.32Å; T75-Y80 HydrophobicContact CG2-CD1 4.27Å; T75-Y80 HydrophobicContact CG2-CE1 3.75Å; T75-Y80 HydrophobicContact CG2-CE2 4.27Å
76	D	90.2	Very high	88	Confident	118 Å²	118	55.3 Å²	55.3	63%	0.631	28%	0.284	S	S	*	.	G	3₁₀ helix	trans	-91.2	8.6	-179	-65.9	-3	0	0	0	113	W74	W74-D76 PolarHBondContact O-N 3.4Å
77	T	91.9	Very high	88	Confident	8 Å²	8	63.4 Å²	63.4	5%	0.049	32%	0.318	C	S	.	.	S	Bend	trans	-107.2	147	179.8	72.3	0	0	0	0	111.6	L42 W74 T75 Y79 Y80	L42-T77 HydrophobicContact CB-CG2 4.44Å; L42-T77 WeakPolarHBondContact O-CG2 3.33Å; W74-T77 HydrophobicContact CE3-CG2 4.06Å; W74-T77 WeakPolarHBondContact O-CB 3.33Å; W74-T77 PolarHBondContact O-N 3.22Å; W74-T77 PolarHBondContact O-OG1 2.98Å; T75-T77 VanDerWaalsContact C-N 3.32Å; T77-Y79 PolarHBondContact O-N 2.72Å; T77-Y80 PolarHBondContact O-N 3.47Å; T77-Y80 PolarHBondContact OG1-N 2.97Å
78	N	91.9	Very high	87.9	Confident	134 Å²	134	63.6 Å²	63.6	72%	0.717	32%	0.319	S	S	*	.	H	α-helix	trans	-62.5	-26.4	175.6	-65.1	-24.4	0	0	0	112.6	Y80 S81	N78-Y80 VanDerWaalsContact C-N 3.32Å; N78-S81 PolarHBondContact O-OG 3.39Å
79	Y	90.7	Very high	87.8	Confident	28 Å²	28	62.3 Å²	62.3	11%	0.11	31%	0.311	C	S	.	.	H	α-helix	trans	-66.6	-35.8	178.4	-176.7	-95.8	0	0	0	112.1	Y45 W74 T77 S81 E82 K83 G84 P86	Y45-Y79 HydrophobicContact CD1-CD1 4.02Å; Y45-Y79 AromaticContact CD1-CD2 3.74Å; Y45-Y79 HydrophobicContact CD1-CD2 3.74Å; Y45-Y79 HydrophobicContact CD1-CE1 4.37Å; Y45-Y79 HydrophobicContact CD1-CE2 4.08Å; Y45-Y79 AromaticContact CD1-CG 3.7Å; Y45-Y79 HydrophobicContact CD1-CG 3.7Å; Y45-Y79 HydrophobicContact CE1-CD1 4.09Å; Y45-Y79 AromaticContact CE1-CD2 3.85Å; Y45-Y79 HydrophobicContact CE1-CD2 3.85Å; Y45-Y79 AromaticContact CE1-CE1 3.96Å; Y45-Y79 HydrophobicContact CE1-CE1 3.96Å; Y45-Y79 AromaticContact CE1-CE2 3.68Å; Y45-Y79 HydrophobicContact CE1-CE2 3.68Å; Y45-Y79 HydrophobicContact CE1-CG 4.04Å; Y45-Y79 AromaticContact CE1-CZ 3.74Å; W74-Y79 HydrophobicContact CE3-CD1 4.44Å; W74-Y79 HydrophobicContact CZ3-CD1 4.22Å; T77-Y79 PolarHBondContact O-N 2.72Å; Y79-S81 PolarHBondContact O-N 2.95Å; Y79-E82 PolarHBondContact O-N 3.25Å; Y79-K83 HydrophobicContact CD1-CB 4.3Å; Y79-K83 HydrophobicContact CD2-CD 4.21Å; Y79-K83 HydrophobicContact CE1-CB 3.74Å; Y79-K83 HydrophobicContact CE2-CB 4.12Å; Y79-K83 HydrophobicContact CE2-CD 3.45Å; Y79-K83 VanDerWaalsContact CE2-CD 3.45Å; Y79-K83 HydrophobicContact CE2-CG 4.36Å; Y79-K83 PolarHBondContact O-N 3.37Å; Y79-G84 WeakPolarHBondContact CD1-O 3.33Å; Y79-G84 VanDerWaalsContact CE1-O 3.32Å; Y79-G84 WeakPolarHBondContact CE1-O 3.01Å; Y79-P86 HydrophobicContact CE1-CB 4.27Å
80	Y	89.8	Confident	87.7	Confident	58 Å²	58	59.2 Å²	59.2	23%	0.227	29%	0.293	C	S	.	.	H	α-helix	trans	-68.7	-36	-172.5	-176.2	-88.9	0	0	0	114	W74 T75 T77 N78 E82 G84	W74-Y80 HydrophobicContact CB-CD2 3.58Å; W74-Y80 HydrophobicContact CB-CE2 4.24Å; W74-Y80 HydrophobicContact CB-CG 4.31Å; W74-Y80 WeakPolarHBondContact O-CB 3.43Å; T75-Y80 HydrophobicContact CG2-CD1 4.27Å; T75-Y80 HydrophobicContact CG2-CE1 3.75Å; T75-Y80 HydrophobicContact CG2-CE2 4.27Å; T77-Y80 PolarHBondContact O-N 3.47Å; T77-Y80 PolarHBondContact OG1-N 2.97Å; N78-Y80 VanDerWaalsContact C-N 3.32Å; Y80-E82 PolarHBondContact O-N 2.65Å; Y80-G84 WeakPolarHBondContact CA-O 3.28Å; Y80-G84 WeakPolarHBondContact O-CA 3.28Å; Y80-G84 PolarHBondContact O-N 2.88Å
81	S	85.6	Confident	87.1	Confident	100 Å²	100	63.2 Å²	63.2	70%	0.699	31%	0.309	S	S	*	.	H	α-helix	trans	-60.9	-28.3	177.8	49.6	0	0	0	0	113.2	N78 Y79	N78-S81 PolarHBondContact O-OG 3.39Å; Y79-S81 PolarHBondContact O-N 2.95Å
82	E	85.1	Confident	86.3	Confident	157 Å²	157	66.6 Å²	66.6	73%	0.734	33%	0.329	S	S	*	.	H	α-helix	trans	-98.1	-38.7	-178.6	-63.4	-178	-176.5	0	0	112.9	Y79 Y80	Y79-E82 PolarHBondContact O-N 3.25Å; Y80-E82 PolarHBondContact O-N 2.65Å
83	K	86.5	Confident	85.2	Confident	105 Å²	105	69.3 Å²	69.3	46%	0.457	35%	0.348	S	S	.	.	H	α-helix	trans	-128.9	-6.9	-166.4	-67.6	176.7	-179.2	175.2	0	114.5	Y79	Y79-K83 HydrophobicContact CD1-CB 4.3Å; Y79-K83 HydrophobicContact CD2-CD 4.21Å; Y79-K83 HydrophobicContact CE1-CB 3.74Å; Y79-K83 HydrophobicContact CE2-CB 4.12Å; Y79-K83 HydrophobicContact CE2-CD 3.45Å; Y79-K83 VanDerWaalsContact CE2-CD 3.45Å; Y79-K83 HydrophobicContact CE2-CG 4.36Å; Y79-K83 PolarHBondContact O-N 3.37Å
84	G	87.3	Confident	84.3	Confident	0 Å²	0	73.9 Å²	73.9	0%	0	37%	0.372	C	S	.	.			trans	74.7	-150.5	-170.9	0	0	0	0	0	112.1	Y79 Y80 Q98	Y79-G84 WeakPolarHBondContact CD1-O 3.33Å; Y79-G84 VanDerWaalsContact CE1-O 3.32Å; Y79-G84 WeakPolarHBondContact CE1-O 3.01Å; Y80-G84 WeakPolarHBondContact CA-O 3.28Å; Y80-G84 WeakPolarHBondContact O-CA 3.28Å; Y80-G84 PolarHBondContact O-N 2.88Å; G84-Q98 VanDerWaalsContact N-NE2 3.16Å
85	F	89.1	Confident	83.4	Confident	1 Å²	1	75.1 Å²	75.1	0%	0.004	38%	0.381	C	S	.	.	S	Bend	trans	-79.8	155.7	173	59.4	-105.4	0	0	0	111	Y71 W74 C89 P97 A101 V104	Y71-F85 HydrophobicContact CD2-CD1 4.49Å; W74-F85 HydrophobicContact CB-CB 4.12Å; W74-F85 HydrophobicContact CD2-CB 4.23Å; W74-F85 HydrophobicContact CG-CB 3.73Å; F85-C89 HydrophobicContact CD2-CB 3.55Å; F85-C89 HydrophobicContact CE2-CB 3.97Å; F85-C89 HydrophobicContact CG-CB 4.33Å; F85-P97 HydrophobicContact CD1-CB 4.41Å; F85-P97 WeakPolarHBondContact CD1-O 3.16Å; F85-P97 HydrophobicContact CD2-CB 4.14Å; F85-P97 HydrophobicContact CE1-CB 4.42Å; F85-P97 VanDerWaalsContact CE1-O 3.29Å; F85-P97 WeakPolarHBondContact CE1-O 3.46Å; F85-P97 HydrophobicContact CE2-CB 4.18Å; F85-P97 HydrophobicContact CG-CB 4.3Å; F85-P97 HydrophobicContact CZ-CB 4.32Å; F85-P97 VanDerWaalsContact O-CB 3.32Å; F85-P97 WeakPolarHBondContact O-CB 3.31Å; F85-A101 HydrophobicContact CE1-CB 4.13Å; F85-V104 HydrophobicContact CE1-CG2 4.22Å; F85-V104 HydrophobicContact CE2-CG2 4.04Å; F85-V104 HydrophobicContact CZ-CG2 3.65Å
86	P	90.4	Very high	82.7	Confident	0 Å²	0	74.8 Å²	74.8	0%	0	38%	0.379	C	S	.	.			trans	-72.1	160.2	-177	32.9	-39.3	0	0	0	112.2	Y45 W74 Y79 S88 C89	Y45-P86 HydrophobicContact CE1-CB 3.95Å; Y45-P86 WeakPolarHBondContact OH-CB 2.96Å; W74-P86 HydrophobicContact CH2-CB 4.38Å; W74-P86 HydrophobicContact CH2-CG 3.4Å; W74-P86 HydrophobicContact CZ2-CB 4.47Å; W74-P86 HydrophobicContact CZ2-CG 3.13Å; W74-P86 HydrophobicContact CZ3-CG 4.21Å; Y79-P86 HydrophobicContact CE1-CB 4.27Å; P86-S88 VanDerWaalsContact CG-OG 3.3Å; P86-S88 WeakPolarHBondContact CG-OG 3.3Å; P86-S88 PolarHBondContact O-N 2.9Å; P86-S88 VanDerWaalsContact O-N 3.09Å; P86-C89 WeakPolarHBondContact O-CB 3.35Å; P86-C89 PolarHBondContact O-N 2.93Å
87	K	87	Confident	81.7	Confident	179 Å²	179	70.3 Å²	70.3	78%	0.778	36%	0.356	S	S	*	.	G	3₁₀ helix	trans	-59.5	-21.8	177	-66.3	-172.7	177.6	-173.1	0	113.7	C89 C90	K87-C89 PolarHBondContact O-N 2.94Å; K87-C90 VanDerWaalsContact O-CB 3.24Å; K87-C90 WeakPolarHBondContact O-CB 2.89Å; K87-C90 PolarHBondContact O-N 3.26Å
88	S	86.6	Confident	80.5	Confident	9 Å²	9	75 Å²	75	6%	0.063	38%	0.377	C	S	.	.	G	3₁₀ helix	trans	-64.9	-16.1	174.3	46.9	0	0	0	0	113.7	D57 Q60 N61 P86	D57-S88 VanDerWaalsContact OD1-CB 3.31Å; D57-S88 WeakPolarHBondContact OD1-CB 3.22Å; D57-S88 PolarHBondContact OD1-OG 2.89Å; Q60-S88 PolarHBondContact OE1-OG 3.08Å; N61-S88 PolarHBondContact OD1-O 3Å; P86-S88 VanDerWaalsContact CG-OG 3.3Å; P86-S88 WeakPolarHBondContact CG-OG 3.3Å; P86-S88 PolarHBondContact O-N 2.9Å; P86-S88 VanDerWaalsContact O-N 3.09Å
89	C	85.9	Confident	79.3	Confident	7 Å²	7	77 Å²	77	5%	0.047	38%	0.375	C	S	.	.	G	3₁₀ helix	trans	-85.7	-10	168.5	-68.8	0	0	0	0	113.8	Q60 C66 W74 F85 P86 K87 V104	Q60-C89 PolarHBondContact OE1-SG 2.91Å; C66-C89 VanDerWaalsContact CA-SG 3.56Å; C66-C89 HydrophobicContact CB-CB 3.66Å; C66-C89 WeakPolarHBondContact CB-SG 3.16Å; C66-C89 WeakPolarHBondContact SG-CB 3.44Å; C66-C89 CovalentContact SG-SG 2.03Å; C66-C89 PolarHBondContact SG-SG 3.41Å; W74-C89 PolarHBondContact NE1-SG 3.01Å; W74-C89 VanDerWaalsContact NE1-SG 3.43Å; F85-C89 HydrophobicContact CD2-CB 3.55Å; F85-C89 HydrophobicContact CE2-CB 3.97Å; F85-C89 HydrophobicContact CG-CB 4.33Å; P86-C89 WeakPolarHBondContact O-CB 3.35Å; P86-C89 PolarHBondContact O-N 2.93Å; K87-C89 PolarHBondContact O-N 2.94Å; C89-V104 HydrophobicContact CB-CG1 4.14Å
90	C	81.3	Confident	78.3	Confident	26 Å²	26	75.9 Å²	75.9	18%	0.176	37%	0.371	C	S	.	.			trans	-88.2	119.8	-177	-72.4	0	0	0	0	111.2	K87 C95	K87-C90 VanDerWaalsContact O-CB 3.24Å; K87-C90 WeakPolarHBondContact O-CB 2.89Å; K87-C90 PolarHBondContact O-N 3.26Å; C90-C95 VanDerWaalsContact CA-SG 3.55Å; C90-C95 HydrophobicContact CB-CB 3.24Å; C90-C95 WeakPolarHBondContact CB-SG 3.35Å; C90-C95 WeakPolarHBondContact SG-CB 3.33Å; C90-C95 CovalentContact SG-SG 2.03Å; C90-C95 PolarHBondContact SG-SG 3.39Å
91	K	69.6	Low	77.1	Confident	103 Å²	103	73.5 Å²	73.5	45%	0.448	36%	0.363	S	S	.	.			trans	-90.7	-14.6	172.8	-63.5	-175.5	-177.8	-175.9	0	113.7	H64 N106 E107	H64-K91 PolarHBondContact O-NZ 3.45Å; K91-N106 PolarHBondContact NZ-O 3.19Å; K91-E107 IonicContact NZ-OE2 2.78Å
92	L	66.1	Low	76	Confident	103 Å²	103	75 Å²	75	54%	0.539	36%	0.364	S	S	.	.	S	Bend	trans	-108.5	144.6	-174.6	-64	167.1	0	0	0	110.9	D94 C95 K103	L92-D94 PolarHBondContact O-N 3.48Å; L92-C95 HydrophobicContact CB-CB 4.46Å; L92-C95 WeakPolarHBondContact O-CB 3.3Å; L92-C95 PolarHBondContact O-N 2.6Å; L92-K103 HydrophobicContact CD1-CD 4.19Å
93	E	63.6	Low	74.9	Confident	203 Å²	203	74 Å²	74	95%	0.949	36%	0.357	S	S	*	.	T	Hydrogen-bonded Turn	trans	-58	-33.4	178.8	-73.7	-176.9	151.9	0	0	112.7
94	D	69	Low	73.9	Confident	142 Å²	142	69.6 Å²	69.6	76%	0.759	34%	0.339	S	S	*	.	T	Hydrogen-bonded Turn	trans	-108.2	37.5	179.8	-66.8	-39.3	0	0	0	113.7	L92 T96	L92-D94 PolarHBondContact O-N 3.48Å; D94-T96 PolarHBondContact O-N 3.28Å
95	C	73.2	Confident	72.4	Confident	26 Å²	26	72.7 Å²	72.7	18%	0.176	36%	0.355	C	S	.	.			trans	-73.1	124.5	177.9	175.1	0	0	0	0	111.9	C90 L92	C90-C95 VanDerWaalsContact CA-SG 3.55Å; C90-C95 HydrophobicContact CB-CB 3.24Å; C90-C95 WeakPolarHBondContact CB-SG 3.35Å; C90-C95 WeakPolarHBondContact SG-CB 3.33Å; C90-C95 CovalentContact SG-SG 2.03Å; C90-C95 PolarHBondContact SG-SG 3.39Å; L92-C95 HydrophobicContact CB-CB 4.46Å; L92-C95 WeakPolarHBondContact O-CB 3.3Å; L92-C95 PolarHBondContact O-N 2.6Å
96	T	75.6	Confident	70.7	Confident	63 Å²	63	79.1 Å²	79.1	39%	0.387	39%	0.39	S	S	.	.			trans	-107.4	118.6	173.6	-50.1	0	0	0	0	110.3	D94 Q98 R99 D100	D94-T96 PolarHBondContact O-N 3.28Å; T96-Q98 PolarHBondContact O-N 2.87Å; T96-R99 PolarHBondContact O-N 3.19Å; T96-D100 PolarHBondContact N-OD2 2.61Å; T96-D100 PolarHBondContact O-N 2.98Å
97	P	69.4	Low	68.6	Low	25 Å²	25	84.7 Å²	84.7	16%	0.162	42%	0.416	C	S	.	.	T	Hydrogen-bonded Turn	trans	-59	16.5	-171.2	-30.2	37.5	0	0	0	120.9	F85	F85-P97 HydrophobicContact CD1-CB 4.41Å; F85-P97 WeakPolarHBondContact CD1-O 3.16Å; F85-P97 HydrophobicContact CD2-CB 4.14Å; F85-P97 HydrophobicContact CE1-CB 4.42Å; F85-P97 VanDerWaalsContact CE1-O 3.29Å; F85-P97 WeakPolarHBondContact CE1-O 3.46Å; F85-P97 HydrophobicContact CE2-CB 4.18Å; F85-P97 HydrophobicContact CG-CB 4.3Å; F85-P97 HydrophobicContact CZ-CB 4.32Å; F85-P97 VanDerWaalsContact O-CB 3.32Å; F85-P97 WeakPolarHBondContact O-CB 3.31Å
98	Q	66.1	Low	66.6	Low	106 Å²	106	83.5 Å²	83.5	50%	0.495	42%	0.417	S	S	.	.	T	Hydrogen-bonded Turn	trans	-139.9	-30.4	177	-74.7	80.6	8	0	0	112.2	G84 T96	G84-Q98 VanDerWaalsContact N-NE2 3.16Å; T96-Q98 PolarHBondContact O-N 2.87Å
99	R	66.4	Low	64.6	Low	175 Å²	175	88 Å²	88	66%	0.66	44%	0.44	S	S	*	.	T	Hydrogen-bonded Turn	trans	-86	-31.9	-178.6	-172.7	-174.7	66.7	178.3	-3	112.4	T96	T96-R99 PolarHBondContact O-N 3.19Å
100	D	69.7	Low	62.6	Low	6 Å²	6	90.7 Å²	90.7	3%	0.032	47%	0.468	C	S	.	.	S	Bend	trans	-102.6	17.4	-170.7	-64.4	-64.8	0	0	0	113	T96 D102 K103	T96-D100 PolarHBondContact N-OD2 2.61Å; T96-D100 PolarHBondContact O-N 2.98Å; D100-D102 VanDerWaalsContact C-N 3.28Å; D100-D102 PolarHBondContact O-N 3.43Å; D100-K103 HydrophobicContact CB-CD 4.33Å; D100-K103 WeakPolarHBondContact O-CB 3.16Å; D100-K103 PolarHBondContact O-N 3.04Å; D100-K103 IonicContact OD1-NZ 3.59Å; D100-K103 PolarHBondContact OD1-NZ 3.22Å
101	A	65.4	Low	61.2	Low	8 Å²	8	92.7 Å²	92.7	7%	0.066	48%	0.476	C	S	.	.	G	3₁₀ helix	trans	-57.4	-39.6	-176.1	0	0	0	0	0	112.7	Y71 F85 K103 V104	Y71-A101 VanDerWaalsContact CD1-O 3.28Å; Y71-A101 WeakPolarHBondContact CD1-O 3.45Å; Y71-A101 HydrophobicContact CD2-CB 3.8Å; Y71-A101 HydrophobicContact CE1-CB 4.09Å; Y71-A101 WeakPolarHBondContact CE1-O 3.19Å; Y71-A101 HydrophobicContact CE2-CB 3.3Å; Y71-A101 HydrophobicContact CG-CB 4.41Å; Y71-A101 VanDerWaalsContact CZ-CB 3.46Å; F85-A101 HydrophobicContact CE1-CB 4.13Å; A101-K103 PolarHBondContact O-N 2.98Å; A101-V104 WeakPolarHBondContact O-CB 3.07Å; A101-V104 PolarHBondContact O-N 2.96Å
102	D	62.6	Low	60.3	Low	132 Å²	132	94.1 Å²	94.1	71%	0.706	48%	0.483	S	S	*	.	G	3₁₀ helix	trans	-65.8	-21.4	177.3	-58.3	-39.3	0	0	0	113.6	D100	D100-D102 VanDerWaalsContact C-N 3.28Å; D100-D102 PolarHBondContact O-N 3.43Å
103	K	62.1	Low	59.3	Low	134 Å²	134	95.9 Å²	95.9	58%	0.583	49%	0.492	S	S	*	.	G	3₁₀ helix	trans	-87.8	-8.9	179.9	-60.8	177.5	-173.6	159.6	0	113.1	L92 D100 A101	L92-K103 HydrophobicContact CD1-CD 4.19Å; D100-K103 HydrophobicContact CB-CD 4.33Å; D100-K103 WeakPolarHBondContact O-CB 3.16Å; D100-K103 PolarHBondContact O-N 3.04Å; D100-K103 IonicContact OD1-NZ 3.59Å; D100-K103 PolarHBondContact OD1-NZ 3.22Å; A101-K103 PolarHBondContact O-N 2.98Å
104	V	65.9	Low	58.6	Low	13 Å²	13	89 Å²	89	8%	0.079	47%	0.469	C	S	.	.	S	Bend	trans	-79.7	-22.7	-178.9	-178.6	0	0	0	0	111.7	C66 F85 C89 A101 N106	C66-V104 HydrophobicContact CB-CG1 3.17Å; F85-V104 HydrophobicContact CE1-CG2 4.22Å; F85-V104 HydrophobicContact CE2-CG2 4.04Å; F85-V104 HydrophobicContact CZ-CG2 3.65Å; C89-V104 HydrophobicContact CB-CG1 4.14Å; A101-V104 WeakPolarHBondContact O-CB 3.07Å; A101-V104 PolarHBondContact O-N 2.96Å; V104-N106 PolarHBondContact O-N 3.27Å
105	N	56.3	Low	57.6	Low	65 Å²	65	87.6 Å²	87.6	35%	0.348	46%	0.455	S	S	.	.			trans	-85.3	11.4	-165.8	-84.5	-12.5	0	0	0	117.8	D70 Y71	D70-N105 VanDerWaalsContact CG-ND2 3.31Å; D70-N105 VanDerWaalsContact OD1-CG 3.28Å; D70-N105 PolarHBondContact OD1-ND2 3.37Å; D70-N105 PolarHBondContact OD1-OD1 3.46Å; D70-N105 PolarHBondContact OD2-ND2 2.03Å; Y71-N105 VanDerWaalsContact CD1-ND2 3.28Å; Y71-N105 WeakPolarHBondContact CD1-ND2 3.39Å; Y71-N105 WeakPolarHBondContact CD1-OD1 3.23Å; Y71-N105 VanDerWaalsContact CE1-ND2 3.33Å; Y71-N105 WeakPolarHBondContact CE1-ND2 3.16Å
106	N	53.4	Low	56.6	Low	136 Å²	136	90 Å²	90	73%	0.727	47%	0.471	S	S	*	.			trans	-115.1	96.6	174.9	-79.3	-29	0	0	0	111.4	K91 V104	K91-N106 PolarHBondContact NZ-O 3.19Å; V104-N106 PolarHBondContact O-N 3.27Å
107	E	45.1	Very low	55.4	Low	118 Å²	118	92 Å²	92	55%	0.551	48%	0.478	S	S	*	.				166.4	76.1	127.3	-88.6	-178	163.6	0	0	108.7	K91 I109	K91-E107 IonicContact NZ-OE2 2.78Å; E107-I109 PolarHBondContact O-N 2.92Å
108	L	45.3	Very low	54.5	Low	154 Å²	154	93.6 Å²	93.6	81%	0.806	49%	0.49	S	S	*	.			trans	-85	93.5	170.3	-143.2	147.6	0	0	0	106.7
109	I	45.3	Very low	53.7	Low	104 Å²	104	96.1 Å²	96.1	53%	0.533	50%	0.495	S	S	.	.			trans	-126.2	124.1	169.4	-38	173.7	0	0	0	110	E107 I111	E107-I109 PolarHBondContact O-N 2.92Å; I109-I111 HydrophobicContact CB-CB 3.97Å; I109-I111 HydrophobicContact CB-CD1 3.57Å; I109-I111 HydrophobicContact CB-CG1 3.56Å; I109-I111 HydrophobicContact CD1-CD1 3.32Å; I109-I111 HydrophobicContact CD1-CG1 4.12Å; I109-I111 HydrophobicContact CG1-CD1 3.92Å; I109-I111 HydrophobicContact CG1-CG1 4.39Å; I109-I111 HydrophobicContact CG2-CB 4.02Å; I109-I111 HydrophobicContact CG2-CD1 3.9Å; I109-I111 HydrophobicContact CG2-CG1 3.41Å; I109-I111 VanDerWaalsContact CG2-CG1 3.41Å; I109-I111 PolarHBondContact O-N 2.98Å
110	G	44.3	Very low	52.7	Low	63 Å²	63	90.8 Å²	90.8	65%	0.649	49%	0.489	S	S	*	.			trans	-60.6	50.3	152.5	0	0	0	0	0	111.6	A114	G110-A114 WeakPolarHBondContact O-CB 3.43Å; G110-A114 PolarHBondContact O-N 2.92Å
111	I	51.3	Low	51.7	Low	68 Å²	68	96 Å²	96	35%	0.349	52%	0.515	S	S	.	.	H	α-helix	trans	-71.8	-40	-177.3	-103.5	163.1	0	0	0	108.8	I109 L113 A114 Y115	I109-I111 HydrophobicContact CB-CB 3.97Å; I109-I111 HydrophobicContact CB-CD1 3.57Å; I109-I111 HydrophobicContact CB-CG1 3.56Å; I109-I111 HydrophobicContact CD1-CD1 3.32Å; I109-I111 HydrophobicContact CD1-CG1 4.12Å; I109-I111 HydrophobicContact CG1-CD1 3.92Å; I109-I111 HydrophobicContact CG1-CG1 4.39Å; I109-I111 HydrophobicContact CG2-CB 4.02Å; I109-I111 HydrophobicContact CG2-CD1 3.9Å; I109-I111 HydrophobicContact CG2-CG1 3.41Å; I109-I111 VanDerWaalsContact CG2-CG1 3.41Å; I109-I111 PolarHBondContact O-N 2.98Å; I111-L113 PolarHBondContact O-N 3.21Å; I111-A114 PolarHBondContact O-N 2.99Å; I111-Y115 HydrophobicContact CG2-CG 4.33Å; I111-Y115 VanDerWaalsContact O-CA 3.28Å; I111-Y115 WeakPolarHBondContact O-CA 3.33Å; I111-Y115 WeakPolarHBondContact O-CB 3.39Å; I111-Y115 PolarHBondContact O-N 3.09Å
112	F	49.7	Very low	51.1	Low	132 Å²	132	100.1 Å²	100.1	58%	0.579	54%	0.54	S	S	*	.	H	α-helix	trans	-65.1	-36.1	-167.5	-90.9	-80.9	0	0	0	114.8	L63 C116	L63-F112 HydrophobicContact CD2-CD2 4.19Å; L63-F112 HydrophobicContact CD2-CE2 4.49Å; F112-C116 WeakPolarHBondContact O-CB 3.29Å; F112-C116 PolarHBondContact O-SG 3.29Å; F112-C116 VanDerWaalsContact O-SG 3.42Å
113	L	45.7	Very low	50.3	Low	141 Å²	141	100.7 Å²	100.7	74%	0.738	54%	0.543	S	S	*	.	H	α-helix	trans	-85.5	-42.5	174.5	-74.1	166.5	0	0	0	112.1	I111 L117	I111-L113 PolarHBondContact O-N 3.21Å; L113-L117 WeakPolarHBondContact O-CB 3.32Å; L113-L117 WeakPolarHBondContact O-CD1 3.4Å; L113-L117 WeakPolarHBondContact O-CG 3.32Å; L113-L117 PolarHBondContact O-N 2.63Å
114	A	48.3	Very low	49.3	Very low	57 Å²	57	99.2 Å²	99.2	47%	0.471	54%	0.541	S	S	.	.	H	α-helix	trans	-72.5	-33.6	-179.6	0	0	0	0	0	113.5	G110 I111 S118	G110-A114 WeakPolarHBondContact O-CB 3.43Å; G110-A114 PolarHBondContact O-N 2.92Å; I111-A114 PolarHBondContact O-N 2.99Å; A114-S118 WeakPolarHBondContact O-CB 3.39Å; A114-S118 PolarHBondContact O-N 3.36Å; A114-S118 PolarHBondContact O-OG 3.13Å
115	Y	47.8	Very low	48.5	Very low	114 Å²	114	105.8 Å²	105.8	45%	0.447	57%	0.571	S	S	.	*	H	α-helix	trans	-72	-43.6	176.3	-171.5	-96.1	0	0	0	111.6	I111 S118 R119	I111-Y115 HydrophobicContact CG2-CG 4.33Å; I111-Y115 VanDerWaalsContact O-CA 3.28Å; I111-Y115 WeakPolarHBondContact O-CA 3.33Å; I111-Y115 WeakPolarHBondContact O-CB 3.39Å; I111-Y115 PolarHBondContact O-N 3.09Å; Y115-S118 VanDerWaalsContact CA-OG 3.29Å; Y115-S118 WeakPolarHBondContact CA-OG 3.12Å; Y115-S118 PolarHBondContact O-OG 3.42Å; Y115-S118 VanDerWaalsContact O-OG 3.14Å; Y115-R119 HydrophobicContact CE1-CG 4.45Å; Y115-R119 WeakPolarHBondContact O-CB 3.42Å; Y115-R119 PolarHBondContact O-N 3.19Å; Y115-R119 PolarHBondContact OH-NE 3.24Å
116	C	52.2	Low	48.1	Very low	77 Å²	77	113 Å²	113	52%	0.52	60%	0.595	S	S	.	*	H	α-helix	trans	-66.8	-41.7	173.3	-76.8	0	0	0	0	111.6	F112 A120	F112-C116 WeakPolarHBondContact O-CB 3.29Å; F112-C116 PolarHBondContact O-SG 3.29Å; F112-C116 VanDerWaalsContact O-SG 3.42Å; C116-A120 VanDerWaalsContact O-CB 3.25Å; C116-A120 WeakPolarHBondContact O-CB 3.31Å; C116-A120 PolarHBondContact O-N 2.78Å
117	L	50.9	Low	47.5	Very low	104 Å²	104	115 Å²	115	55%	0.545	60%	0.6	S	S	.	*	H	α-helix	trans	-67.2	-41.6	175.5	-71.9	168.6	0	0	0	112	L113 A120 I121	L113-L117 WeakPolarHBondContact O-CB 3.32Å; L113-L117 WeakPolarHBondContact O-CD1 3.4Å; L113-L117 WeakPolarHBondContact O-CG 3.32Å; L113-L117 PolarHBondContact O-N 2.63Å; L117-A120 PolarHBondContact O-N 3.29Å; L117-I121 WeakPolarHBondContact O-CB 3.5Å; L117-I121 WeakPolarHBondContact O-CD1 2.92Å; L117-I121 WeakPolarHBondContact O-CG1 2.98Å; L117-I121 PolarHBondContact O-N 3.18Å
118	S	51.3	Low	47.3	Very low	58 Å²	58	116.2 Å²	116.2	41%	0.406	61%	0.609	S	S	.	*	H	α-helix	trans	-69.2	-38.2	177.2	54.5	0	0	0	0	112.8	A114 Y115 T122	A114-S118 WeakPolarHBondContact O-CB 3.39Å; A114-S118 PolarHBondContact O-N 3.36Å; A114-S118 PolarHBondContact O-OG 3.13Å; Y115-S118 VanDerWaalsContact CA-OG 3.29Å; Y115-S118 WeakPolarHBondContact CA-OG 3.12Å; Y115-S118 PolarHBondContact O-OG 3.42Å; Y115-S118 VanDerWaalsContact O-OG 3.14Å; S118-T122 WeakPolarHBondContact O-CB 3.32Å; S118-T122 WeakPolarHBondContact O-CG2 3.37Å; S118-T122 PolarHBondContact O-N 2.74Å; S118-T122 PolarHBondContact O-OG1 3.16Å
119	R	48.4	Very low	47.1	Very low	160 Å²	160	119.1 Å²	119.1	60%	0.604	63%	0.632	S	S	*	*	H	α-helix	trans	-64	-43	169.6	-97.9	-168.4	177.3	-149.5	-0.1	112	Y115 I121 T122 N123	Y115-R119 HydrophobicContact CE1-CG 4.45Å; Y115-R119 WeakPolarHBondContact O-CB 3.42Å; Y115-R119 PolarHBondContact O-N 3.19Å; Y115-R119 PolarHBondContact OH-NE 3.24Å; R119-I121 VanDerWaalsContact C-N 3.34Å; R119-I121 PolarHBondContact O-N 3.02Å; R119-T122 PolarHBondContact O-N 3.46Å; R119-T122 PolarHBondContact O-OG1 2.03Å; R119-N123 WeakPolarHBondContact O-CB 3.41Å; R119-N123 PolarHBondContact O-N 3.26Å
120	A	45.3	Very low	47.2	Very low	63 Å²	63	119.9 Å²	119.9	52%	0.521	64%	0.637	S	S	.	*	H	α-helix	trans	-64.4	-38.5	178.3	0	0	0	0	0	112.4	C116 L117 N124	C116-A120 VanDerWaalsContact O-CB 3.25Å; C116-A120 WeakPolarHBondContact O-CB 3.31Å; C116-A120 PolarHBondContact O-N 2.78Å; L117-A120 PolarHBondContact O-N 3.29Å; A120-N124 WeakPolarHBondContact O-CB 3.24Å
121	I	50.1	Low	47.3	Very low	115 Å²	115	122.8 Å²	122.8	59%	0.59	64%	0.636	S	S	*	*	H	α-helix	trans	-73	-40.6	178.2	-66.1	164	0	0	0	111.5	L117 R119	L117-I121 WeakPolarHBondContact O-CB 3.5Å; L117-I121 WeakPolarHBondContact O-CD1 2.92Å; L117-I121 WeakPolarHBondContact O-CG1 2.98Å; L117-I121 PolarHBondContact O-N 3.18Å; R119-I121 VanDerWaalsContact C-N 3.34Å; R119-I121 PolarHBondContact O-N 3.02Å
122	T	50.9	Low	47.1	Very low	95 Å²	95	125.9 Å²	125.9	58%	0.583	65%	0.652	S	S	*	*	H	α-helix	trans	-76.6	-31.4	-179.4	49.2	0	0	0	0	113.4	S118 R119 N124	S118-T122 WeakPolarHBondContact O-CB 3.32Å; S118-T122 WeakPolarHBondContact O-CG2 3.37Å; S118-T122 PolarHBondContact O-N 2.74Å; S118-T122 PolarHBondContact O-OG1 3.16Å; R119-T122 PolarHBondContact O-N 3.46Å; R119-T122 PolarHBondContact O-OG1 2.03Å; T122-N124 VanDerWaalsContact C-N 3.3Å; T122-N124 PolarHBondContact O-N 3.28Å
123	N	45.8	Very low	47	Very low	143 Å²	143	125.5 Å²	125.5	77%	0.765	66%	0.657	S	S	*	*	H	α-helix	trans	-80.2	-10.7	179.9	-143.9	29.3	0	0	0	113.2	R119	R119-N123 WeakPolarHBondContact O-CB 3.41Å; R119-N123 PolarHBondContact O-N 3.26Å
124	N	42.7	Very low	47	Very low	103 Å²	103	124.6 Å²	124.6	55%	0.551	65%	0.652	S	S	*	*	T	Hydrogen-bonded Turn	trans	-105.6	12.1	178.8	-160.4	56.7	0	0	0	113.9	A120 T122	A120-N124 WeakPolarHBondContact O-CB 3.24Å; T122-N124 VanDerWaalsContact C-N 3.3Å; T122-N124 PolarHBondContact O-N 3.28Å
125	Q	47.4	Very low	47	Very low	151 Å²	151	129.1 Å²	129.1	71%	0.706	66%	0.664	S	S	*	*	S	Bend	trans	-110.5	7.2	174.8	-67.9	-68	-86.6	0	0	113.4
126	Y	47.8	Very low	46.9	Very low	217 Å²	217	130.1 Å²	130.1	85%	0.851	68%	0.679	S	S	*	*	S	Bend	trans	-120.9	8.9	177.3	-91.5	-79.7	0	0	0	115.6
127	E	41.8	Very low	46.5	Very low	177 Å²	177	134.2 Å²	134.2	83%	0.827	69%	0.691	S	S	*	*	S	Bend	trans	-123.6	23.6	170.9	-76.9	-157.4	168.9	0	0	114.3
128	I	40.5	Very low	46.1	Very low	145 Å²	145	136.8 Å²	136.8	74%	0.744	70%	0.704	S	S	*	*			trans	-134.4	63.7	164.4	-45.4	-176.7	0	0	0	110.3
129	V	41.3	Very low	45.6	Very low	214 Å²	214	143.9 Å²	143.9	100%	1.297	73%	0.731	S	S	*	*			trans	-152.6	0	134.4	178.5	0	0	0	0	107

Retrieved 129 of 129 residues in 856.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).