A0A087WYW2_HUMAN Loading...

Ribosomal RNA processing 12 homolog

AlphaFold DB , UniProt , Accession A0A087WYW2, Species HUMAN (Homo sapiens, Human), Gene RRP12, Length 32 aa.

						>A0A087WYW2_HUMAN|A0A087WYW2|RRP12
MGRSGKLPSGVSAKLKRWKKGHSSDSNPAICR
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	48.4	Very low	70	Confident	245 Å²	245	125.7 Å²	125.7	100%	1.207	74%	0.737	S	S	*	*				0	119.5	0	-73.9	-77.8	-85	0	0	108.6
2	G	57.7	Low	70.9	Confident	76 Å²	76	119.6 Å²	119.6	78%	0.784	71%	0.706	S	S	*	*			trans	78.7	70.9	167.1	0	0	0	0	0	117.3	S4	G2-S4 PolarHBondContact O-N 2.89Å
3	R	61.6	Low	71.9	Confident	252 Å²	252	115.1 Å²	115.1	95%	0.951	69%	0.69	S	S	*	*			trans	-68.8	90.4	156.7	-65.7	177.5	90.7	-175.1	6.6	106.8	G5	R3-G5 PolarHBondContact O-N 3.35Å
4	S	65.3	Low	73	Confident	126 Å²	126	118.6 Å²	118.6	88%	0.881	69%	0.692	S	S	*	*			trans	-70.7	64.4	164.6	-166.6	0	0	0	0	108.3	G2	G2-S4 PolarHBondContact O-N 2.89Å
5	G	70.6	Confident	73.7	Confident	53 Å²	53	116.4 Å²	116.4	55%	0.546	68%	0.676	S	S	.	*	P	Polyproline II helix	trans	-76.1	130.4	167.7	0	0	0	0	0	107.2	R3 L7	R3-G5 PolarHBondContact O-N 3.35Å; G5-L7 PolarHBondContact O-N 3.22Å
6	K	74.7	Confident	74.4	Confident	209 Å²	209	118.1 Å²	118.1	91%	0.909	67%	0.673	S	S	*	*	P	Polyproline II helix	trans	-47.5	119.3	173.1	-64.8	177.2	-179.7	179.2	0	107.9
7	L	74.8	Confident	75.1	Confident	92 Å²	92	123.5 Å²	123.5	48%	0.482	68%	0.68	S	S	.	*	P	Polyproline II helix	trans	-56.6	142.2	-179.7	-70	174.1	0	0	0	108.9	G5 S9 V11 L15	G5-L7 PolarHBondContact O-N 3.22Å; L7-S9 PolarHBondContact O-N 3.39Å; L7-V11 HydrophobicContact CB-CG1 4.44Å; L7-V11 HydrophobicContact CD1-CG1 4.42Å; L7-V11 HydrophobicContact CD2-CG1 4.21Å; L7-V11 HydrophobicContact CB-CB 4.31Å; L7-L15 HydrophobicContact CD1-CD2 4.3Å
8	P	78.3	Confident	75.4	Confident	87 Å²	87	125.8 Å²	125.8	57%	0.565	68%	0.677	S	S	*	*	P	Polyproline II helix	trans	-49.7	139.6	172.7	-24.1	31.9	0	0	0	110.2	G10 V11	P8-G10 PolarHBondContact O-N 2.93Å; P8-V11 HydrophobicContact CB-CG2 3.88Å; P8-V11 HydrophobicContact CG-CG2 4.11Å; P8-V11 WeakPolarHBondContact O-CB 3.38Å; P8-V11 PolarHBondContact O-N 2.82Å
9	S	75	Confident	75.7	Confident	129 Å²	129	127.1 Å²	127.1	90%	0.902	68%	0.675	S	S	*	*	T	Hydrogen-bonded Turn	trans	-53.2	127.3	177.4	46.3	0	0	0	0	109	L7	L7-S9 PolarHBondContact O-N 3.39Å
10	G	78.6	Confident	76	Confident	45 Å²	45	129 Å²	129	46%	0.464	68%	0.677	S	S	.	*	T	Hydrogen-bonded Turn	trans	97.9	-29.8	-173.7	0	0	0	0	0	115.4	P8 A13 K14	P8-G10 PolarHBondContact O-N 2.93Å; G10-A13 PolarHBondContact O-N 2.91Å; G10-K14 WeakPolarHBondContact O-CB 3.42Å; G10-K14 PolarHBondContact O-N 3.34Å
11	V	84.7	Confident	75.9	Confident	69 Å²	69	125.2 Å²	125.2	42%	0.418	67%	0.67	S	S	.	*	H	α-helix	trans	-69.6	-40.9	176.2	177.4	0	0	0	0	110.8	L7 P8 A13 K14 L15	L7-V11 HydrophobicContact CB-CG1 4.44Å; L7-V11 HydrophobicContact CD1-CG1 4.42Å; L7-V11 HydrophobicContact CD2-CG1 4.21Å; L7-V11 HydrophobicContact CB-CB 4.31Å; P8-V11 HydrophobicContact CB-CG2 3.88Å; P8-V11 HydrophobicContact CG-CG2 4.11Å; P8-V11 WeakPolarHBondContact O-CB 3.38Å; P8-V11 PolarHBondContact O-N 2.82Å; V11-A13 VanDerWaalsContact C-N 3.31Å; V11-A13 PolarHBondContact O-N 3.4Å; V11-K14 PolarHBondContact O-N 3.33Å; V11-L15 VanDerWaalsContact O-CB 3.24Å; V11-L15 WeakPolarHBondContact O-CB 3.44Å; V11-L15 PolarHBondContact O-N 2.93Å
12	S	81.6	Confident	76.8	Confident	52 Å²	52	119.3 Å²	119.3	36%	0.364	64%	0.639	S	S	.	*	H	α-helix	trans	-61.2	-39.7	173.9	179.5	0	0	0	0	112.1	K16	S12-K16 PolarHBondContact O-N 3.38Å; S12-K16 WeakPolarHBondContact O-CE 3.39Å; S12-K16 WeakPolarHBondContact O-CB 3.27Å; S12-K16 WeakPolarHBondContact O-CG 3.45Å
13	A	84.2	Confident	76.8	Confident	61 Å²	61	118 Å²	118	50%	0.504	62%	0.618	S	S	.	*	H	α-helix	trans	-69.5	-44.5	177.8	0	0	0	0	0	111.7	G10 V11 L15 K16 R17	G10-A13 PolarHBondContact O-N 2.91Å; V11-A13 VanDerWaalsContact C-N 3.31Å; V11-A13 PolarHBondContact O-N 3.4Å; A13-L15 VanDerWaalsContact C-N 3.34Å; A13-L15 PolarHBondContact O-N 3.49Å; A13-K16 PolarHBondContact O-N 2.96Å; A13-R17 WeakPolarHBondContact O-CB 3.24Å; A13-R17 PolarHBondContact O-N 3.49Å
14	K	86.3	Confident	76.7	Confident	165 Å²	165	109.3 Å²	109.3	72%	0.717	60%	0.596	S	S	*	*	H	α-helix	trans	-60.9	-42.7	174.4	-173.6	173	179.7	176.4	0	111.4	G10 V11 R17 W18	G10-K14 WeakPolarHBondContact O-CB 3.42Å; G10-K14 PolarHBondContact O-N 3.34Å; V11-K14 PolarHBondContact O-N 3.33Å; K14-R17 PolarHBondContact O-N 2.83Å; K14-W18 PolarHBondContact O-N 3.04Å; K14-W18 WeakPolarHBondContact O-CB 3.44Å; K14-W18 VanDerWaalsContact O-CB 3.27Å
15	L	83.8	Confident	76.6	Confident	85 Å²	85	109.8 Å²	109.8	45%	0.445	59%	0.588	S	S	.	*	H	α-helix	trans	-64.3	-44.9	177.5	-177.9	63.1	0	0	0	112	L7 V11 A13 R17 W18 K19	L7-L15 HydrophobicContact CD1-CD2 4.3Å; V11-L15 VanDerWaalsContact O-CB 3.24Å; V11-L15 WeakPolarHBondContact O-CB 3.44Å; V11-L15 PolarHBondContact O-N 2.93Å; A13-L15 VanDerWaalsContact C-N 3.34Å; A13-L15 PolarHBondContact O-N 3.49Å; L15-R17 VanDerWaalsContact C-N 3.34Å; L15-R17 PolarHBondContact O-N 3.38Å; L15-W18 PolarHBondContact O-N 3.39Å; L15-K19 WeakPolarHBondContact O-CB 3.4Å; L15-K19 PolarHBondContact O-N 3.17Å
16	K	85.4	Confident	76	Confident	144 Å²	144	111.7 Å²	111.7	63%	0.626	59%	0.594	S	S	*	*	H	α-helix	trans	-59.9	-43.9	174.1	-79.3	-175.7	-76.2	-174.9	0	111.6	S12 A13 K19 K20	S12-K16 PolarHBondContact O-N 3.38Å; S12-K16 WeakPolarHBondContact O-CE 3.39Å; S12-K16 WeakPolarHBondContact O-CB 3.27Å; S12-K16 WeakPolarHBondContact O-CG 3.45Å; A13-K16 PolarHBondContact O-N 2.96Å; K16-K19 PolarHBondContact O-N 3.18Å; K16-K20 WeakPolarHBondContact O-CB 3.27Å; K16-K20 PolarHBondContact O-N 3.33Å
17	R	85.3	Confident	75	Confident	209 Å²	209	105.2 Å²	105.2	79%	0.789	57%	0.569	S	S	*	*	H	α-helix	trans	-66	-42.6	178.2	-169	171.9	-169.9	173.7	2.6	112.3	A13 K14 L15 K20 G21	A13-R17 WeakPolarHBondContact O-CB 3.24Å; A13-R17 PolarHBondContact O-N 3.49Å; K14-R17 PolarHBondContact O-N 2.83Å; L15-R17 VanDerWaalsContact C-N 3.34Å; L15-R17 PolarHBondContact O-N 3.38Å; R17-K20 PolarHBondContact O-N 3.42Å; R17-G21 PolarHBondContact O-N 2.95Å
18	W	81.6	Confident	74.4	Confident	166 Å²	166	106.5 Å²	106.5	63%	0.629	58%	0.583	S	S	*	*	H	α-helix	trans	-63	-48.1	176.5	-167.2	76.3	0	0	0	110.4	K14 L15 K20 G21 H22	K14-W18 PolarHBondContact O-N 3.04Å; K14-W18 WeakPolarHBondContact O-CB 3.44Å; K14-W18 VanDerWaalsContact O-CB 3.27Å; L15-W18 PolarHBondContact O-N 3.39Å; W18-K20 PolarHBondContact O-N 2.95Å; W18-K20 VanDerWaalsContact C-N 3.31Å; W18-G21 VanDerWaalsContact O-N 3.17Å; W18-G21 PolarHBondContact O-N 3.48Å; W18-H22 AromaticContact CG-NE2 3.8Å; W18-H22 VanDerWaalsContact O-N 3.15Å; W18-H22 PolarHBondContact O-N 2.88Å; W18-H22 PolarHBondContact O-CD2 3.48Å; W18-H22 PolarHBondContact NE1-NE2 3.15Å; W18-H22 AromaticContact NE1-NE2 2.95Å; W18-H22 AromaticContact NE1-CD2 3.66Å; W18-H22 AromaticContact CZ2-NE2 3.61Å; W18-H22 AromaticContact CZ2-CD2 3.92Å; W18-H22 AromaticContact CG-CD2 3.76Å; W18-H22 AromaticContact CE2-NE2 3.11Å; W18-H22 VanDerWaalsContact CE2-CD2 3.45Å; W18-H22 AromaticContact CE2-CD2 3.45Å; W18-H22 AromaticContact CD2-NE2 3.66Å; W18-H22 AromaticContact CD2-CD2 3.52Å; W18-H22 AromaticContact CD1-NE2 3.36Å; W18-H22 AromaticContact CD1-CD2 3.8Å
19	K	81.6	Confident	73.8	Confident	150 Å²	150	106.3 Å²	106.3	65%	0.652	59%	0.589	S	S	*	*	H	α-helix	trans	-59.9	-38.1	175.6	-173.9	169.2	-72.8	-70.2	0	112.9	L15 K16	L15-K19 WeakPolarHBondContact O-CB 3.4Å; L15-K19 PolarHBondContact O-N 3.17Å; K16-K19 PolarHBondContact O-N 3.18Å
20	K	81.1	Confident	73.1	Confident	164 Å²	164	104.7 Å²	104.7	71%	0.713	57%	0.569	S	S	*	*	H	α-helix	trans	-68.1	-39.1	174.9	-174.8	179.1	-179.5	-178.5	0	112.9	K16 R17 W18 H22 S23	K16-K20 WeakPolarHBondContact O-CB 3.27Å; K16-K20 PolarHBondContact O-N 3.33Å; R17-K20 PolarHBondContact O-N 3.42Å; W18-K20 PolarHBondContact O-N 2.95Å; W18-K20 VanDerWaalsContact C-N 3.31Å; K20-H22 PolarHBondContact O-N 2.79Å; K20-H22 VanDerWaalsContact C-N 3.29Å; K20-S23 WeakPolarHBondContact O-CB 3.46Å; K20-S23 PolarHBondContact O-N 2.91Å; K20-S23 PolarHBondContact O-OG 3Å
21	G	74.1	Confident	72.1	Confident	51 Å²	51	107.1 Å²	107.1	53%	0.526	58%	0.578	S	S	.	*	H	α-helix	trans	-76.4	-13.6	-178.4	0	0	0	0	0	114.6	R17 W18	R17-G21 PolarHBondContact O-N 2.95Å; W18-G21 VanDerWaalsContact O-N 3.17Å; W18-G21 PolarHBondContact O-N 3.48Å
22	H	66.5	Low	70.8	Confident	121 Å²	121	118.7 Å²	118.7	56%	0.56	61%	0.614	S	S	*	*	T	Hydrogen-bonded Turn	trans	-100.5	8.4	173.5	-68.4	-64.2	0	0	0	113	W18 K20 S24	W18-H22 AromaticContact CG-NE2 3.8Å; W18-H22 VanDerWaalsContact O-N 3.15Å; W18-H22 PolarHBondContact O-N 2.88Å; W18-H22 PolarHBondContact O-CD2 3.48Å; W18-H22 PolarHBondContact NE1-NE2 3.15Å; W18-H22 AromaticContact NE1-NE2 2.95Å; W18-H22 AromaticContact NE1-CD2 3.66Å; W18-H22 AromaticContact CZ2-NE2 3.61Å; W18-H22 AromaticContact CZ2-CD2 3.92Å; W18-H22 AromaticContact CG-CD2 3.76Å; W18-H22 AromaticContact CE2-NE2 3.11Å; W18-H22 VanDerWaalsContact CE2-CD2 3.45Å; W18-H22 AromaticContact CE2-CD2 3.45Å; W18-H22 AromaticContact CD2-NE2 3.66Å; W18-H22 AromaticContact CD2-CD2 3.52Å; W18-H22 AromaticContact CD1-NE2 3.36Å; W18-H22 AromaticContact CD1-CD2 3.8Å; K20-H22 PolarHBondContact O-N 2.79Å; K20-H22 VanDerWaalsContact C-N 3.29Å; H22-S24 PolarHBondContact O-N 3.22Å
23	S	59	Low	70.3	Confident	47 Å²	47	122.1 Å²	122.1	33%	0.329	63%	0.627	S	S	.	*	S	Bend	trans	-64.8	128.4	171.2	-61.3	0	0	0	0	109.3	K20 D25 S26	K20-S23 WeakPolarHBondContact O-CB 3.46Å; K20-S23 PolarHBondContact O-N 2.91Å; K20-S23 PolarHBondContact O-OG 3Å; S23-D25 PolarHBondContact O-N 3.05Å; S23-S26 PolarHBondContact O-N 2.89Å
24	S	59	Low	69.5	Low	70 Å²	70	125.3 Å²	125.3	49%	0.49	63%	0.633	S	S	.	*	G	3₁₀ helix	trans	-50.3	-15.9	176.6	-64.1	0	0	0	0	114.9	H22 S26 N27	H22-S24 PolarHBondContact O-N 3.22Å; S24-S26 PolarHBondContact O-N 3.03Å; S24-N27 WeakPolarHBondContact O-CB 3.36Å; S24-N27 PolarHBondContact O-N 2.98Å
25	D	63.2	Low	68.6	Low	136 Å²	136	123.1 Å²	123.1	73%	0.727	63%	0.628	S	S	*	*	G	3₁₀ helix	trans	-59.5	-20.6	171.8	-57.1	-74.6	0	0	0	114	S23	S23-D25 PolarHBondContact O-N 3.05Å
26	S	56.6	Low	67.7	Low	94 Å²	94	125.3 Å²	125.3	66%	0.657	64%	0.639	S	S	*	*	G	3₁₀ helix	trans	-95.6	1.9	174.4	-57.6	0	0	0	0	113.5	S23 S24 P28	S23-S26 PolarHBondContact O-N 2.89Å; S24-S26 PolarHBondContact O-N 3.03Å; S26-P28 WeakPolarHBondContact O-CD 3.23Å; S26-P28 VanDerWaalsContact O-CD 3.27Å
27	N	55.6	Low	66.6	Low	72 Å²	72	124.1 Å²	124.1	39%	0.385	64%	0.64	S	S	.	*			trans	-88.5	109.4	173.5	-171.8	-4.5	0	0	0	108.6	S24 A29 I30	S24-N27 WeakPolarHBondContact O-CB 3.36Å; S24-N27 PolarHBondContact O-N 2.98Å; N27-A29 PolarHBondContact O-N 3Å; N27-A29 VanDerWaalsContact OD1-CB 3.23Å; N27-A29 WeakPolarHBondContact OD1-CB 3.37Å; N27-A29 PolarHBondContact OD1-N 3.38Å; N27-I30 HydrophobicContact CB-CB 4.31Å; N27-I30 HydrophobicContact CB-CD1 3.85Å; N27-I30 HydrophobicContact CB-CG1 4.01Å; N27-I30 WeakPolarHBondContact ND2-CD1 3.45Å; N27-I30 PolarHBondContact O-N 2.91Å
28	P	61.9	Low	65.4	Low	119 Å²	119	118.5 Å²	118.5	77%	0.773	63%	0.63	S	S	*	*	T	Hydrogen-bonded Turn	trans	-62	-10.5	176.8	27.1	-34.8	0	0	0	112.9	S26	S26-P28 WeakPolarHBondContact O-CD 3.23Å; S26-P28 VanDerWaalsContact O-CD 3.27Å
29	A	65.1	Low	64.2	Low	84 Å²	84	115.1 Å²	115.1	69%	0.694	63%	0.63	S	S	*	*	T	Hydrogen-bonded Turn	trans	-80.2	-12	171.8	0	0	0	0	0	114.3	N27	N27-A29 PolarHBondContact O-N 3Å; N27-A29 VanDerWaalsContact OD1-CB 3.23Å; N27-A29 WeakPolarHBondContact OD1-CB 3.37Å; N27-A29 PolarHBondContact OD1-N 3.38Å
30	I	60.1	Low	62.9	Low	94 Å²	94	112.4 Å²	112.4	48%	0.482	63%	0.628	S	S	.	*	T	Hydrogen-bonded Turn	trans	-108.7	-19.1	-174.3	-61.7	175.9	0	0	0	112.2	N27 R32	N27-I30 HydrophobicContact CB-CB 4.31Å; N27-I30 HydrophobicContact CB-CD1 3.85Å; N27-I30 HydrophobicContact CB-CG1 4.01Å; N27-I30 WeakPolarHBondContact ND2-CD1 3.45Å; N27-I30 PolarHBondContact O-N 2.91Å; I30-R32 PolarHBondContact O-N 3.13Å; I30-R32 VanDerWaalsContact O-N 3.13Å
31	C	57	Low	61.4	Low	97 Å²	97	108.1 Å²	108.1	66%	0.655	62%	0.621	S	S	*	*			trans	-73.7	99.6	168.2	-68.5	0	0	0	0	109.9
32	R	58.3	Low	60.2	Low	312 Å²	312	113.3 Å²	113.3	100%	1.177	63%	0.63	S	S	*	*			trans	-125.5	0	171.8	-153.7	-176.1	-179	135.1	1.4	110.3	I30	I30-R32 PolarHBondContact O-N 3.13Å; I30-R32 VanDerWaalsContact O-N 3.13Å

Retrieved 32 of 32 residues in 294 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).