A0A087WYX7_HUMAN Loading...

Latent transforming growth factor beta binding protein 4

AlphaFold DB , UniProt , Accession A0A087WYX7, Species HUMAN (Homo sapiens, Human), Gene LTBP4, Length 44 aa.

						>A0A087WYX7_HUMAN|A0A087WYX7|LTBP4
MLQPQALLFVAAARARRLGGAAASEPSAGSEAASPKSVQAPSGA
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	66.8	Low	81.6	Confident	242 Å²	242	122 Å²	122	100%	1.192	65%	0.652	S	S	*	*				0	120.6	0	-69.8	176	162.1	0	0	107.6	Q3	M1-Q3 PolarHBondContact O-N 3.45Å
2	L	71.2	Confident	81.8	Confident	142 Å²	142	115.9 Å²	115.9	74%	0.743	63%	0.632	S	S	*	*			trans	-71.1	126.1	179.9	-86.9	140.4	0	0	0	109.4
3	Q	80.9	Confident	82.1	Confident	141 Å²	141	110.8 Å²	110.8	66%	0.659	62%	0.615	S	S	*	*			trans	-65.8	134.7	179.5	-67.9	-179.9	-49.4	0	0	109.5	M1 Q5 A6	M1-Q3 PolarHBondContact O-N 3.45Å; Q3-Q5 PolarHBondContact O-N 3.45Å; Q3-A6 PolarHBondContact O-N 3.14Å; Q3-A6 WeakPolarHBondContact O-CB 3.32Å
4	P	80.9	Confident	82.4	Confident	103 Å²	103	115.3 Å²	115.3	67%	0.669	62%	0.617	S	S	*	*	H	α-helix	trans	-53.1	-32.7	-178.7	-27.4	33.3	0	0	0	113.8	A6 L7 L8	P4-A6 PolarHBondContact O-N 3.26Å; P4-A6 VanDerWaalsContact C-N 3.34Å; P4-L7 WeakPolarHBondContact O-CB 3.49Å; P4-L7 PolarHBondContact O-N 3.17Å; P4-L8 PolarHBondContact O-N 3.33Å
5	Q	76.8	Confident	82.4	Confident	133 Å²	133	111.5 Å²	111.5	62%	0.621	61%	0.608	S	S	*	*	H	α-helix	trans	-63.1	-38.6	177.6	-59.2	179.8	37.2	0	0	112.2	Q3 L7 L8 F9	Q3-Q5 PolarHBondContact O-N 3.45Å; Q5-L7 PolarHBondContact O-N 2.93Å; Q5-L8 WeakPolarHBondContact O-CB 3.34Å; Q5-L8 PolarHBondContact O-N 3.06Å; Q5-L8 VanDerWaalsContact O-N 3.16Å; Q5-F9 WeakPolarHBondContact O-CD2 3.38Å; Q5-F9 VanDerWaalsContact O-N 3.17Å; Q5-F9 PolarHBondContact O-N 3.45Å
6	A	85.2	Confident	82	Confident	37 Å²	37	117 Å²	117	31%	0.306	62%	0.617	S	S	.	*	H	α-helix	trans	-63.2	-34.1	179	0	0	0	0	0	111.7	Q3 P4 F9 V10	Q3-A6 PolarHBondContact O-N 3.14Å; Q3-A6 WeakPolarHBondContact O-CB 3.32Å; P4-A6 PolarHBondContact O-N 3.26Å; P4-A6 VanDerWaalsContact C-N 3.34Å; A6-F9 PolarHBondContact O-N 3.48Å; A6-V10 VanDerWaalsContact O-CG2 3.32Å; A6-V10 WeakPolarHBondContact O-CG2 3.33Å; A6-V10 PolarHBondContact O-N 3.41Å; A6-V10 VanDerWaalsContact O-N 3.14Å
7	L	87.1	Confident	81.7	Confident	104 Å²	104	123.5 Å²	123.5	55%	0.545	63%	0.631	S	S	.	*	H	α-helix	trans	-67.2	-38.5	176.5	-60.9	176.6	0	0	0	111.8	P4 Q5 V10 A11	P4-L7 WeakPolarHBondContact O-CB 3.49Å; P4-L7 PolarHBondContact O-N 3.17Å; Q5-L7 PolarHBondContact O-N 2.93Å; L7-V10 PolarHBondContact O-N 2.97Å; L7-A11 WeakPolarHBondContact O-CB 3.13Å; L7-A11 PolarHBondContact O-N 3.16Å
8	L	87.8	Confident	81.5	Confident	128 Å²	128	123.9 Å²	123.9	67%	0.67	64%	0.635	S	S	*	*	H	α-helix	trans	-64.7	-42.9	176.6	-63.6	176.2	0	0	0	111.8	P4 Q5 A11 A12	P4-L8 PolarHBondContact O-N 3.33Å; Q5-L8 WeakPolarHBondContact O-CB 3.34Å; Q5-L8 PolarHBondContact O-N 3.06Å; Q5-L8 VanDerWaalsContact O-N 3.16Å; L8-A11 PolarHBondContact O-N 2.91Å; L8-A12 WeakPolarHBondContact O-CB 3.36Å; L8-A12 PolarHBondContact O-N 3.42Å
9	F	87.1	Confident	81	Confident	152 Å²	152	120.1 Å²	120.1	67%	0.667	63%	0.629	S	S	*	*	H	α-helix	trans	-63.2	-42.9	176.9	-76.8	-70.5	0	0	0	112.5	Q5 A6 A12 A13	Q5-F9 WeakPolarHBondContact O-CD2 3.38Å; Q5-F9 VanDerWaalsContact O-N 3.17Å; Q5-F9 PolarHBondContact O-N 3.45Å; A6-F9 PolarHBondContact O-N 3.48Å; F9-A12 PolarHBondContact O-N 3.4Å; F9-A13 WeakPolarHBondContact O-CB 3.5Å; F9-A13 PolarHBondContact O-N 2.93Å
10	V	89.3	Confident	79.9	Confident	100 Å²	100	116.5 Å²	116.5	61%	0.606	62%	0.623	S	S	*	*	H	α-helix	trans	-65.6	-42.1	177.8	172.7	0	0	0	0	111.1	A6 L7 A13 R14	A6-V10 VanDerWaalsContact O-CG2 3.32Å; A6-V10 WeakPolarHBondContact O-CG2 3.33Å; A6-V10 PolarHBondContact O-N 3.41Å; A6-V10 VanDerWaalsContact O-N 3.14Å; L7-V10 PolarHBondContact O-N 2.97Å; V10-A13 PolarHBondContact O-N 3.12Å; V10-R14 PolarHBondContact O-N 3.37Å; V10-R14 WeakPolarHBondContact O-CB 3.41Å; V10-R14 VanDerWaalsContact O-CB 3.29Å
11	A	84.9	Confident	78.7	Confident	60 Å²	60	116.2 Å²	116.2	50%	0.496	64%	0.636	S	S	.	*	H	α-helix	trans	-62.6	-45.2	175.9	0	0	0	0	0	111.9	L7 L8 R14 A15	L7-A11 WeakPolarHBondContact O-CB 3.13Å; L7-A11 PolarHBondContact O-N 3.16Å; L8-A11 PolarHBondContact O-N 2.91Å; A11-R14 PolarHBondContact O-N 2.89Å; A11-A15 WeakPolarHBondContact O-CB 3.37Å; A11-A15 PolarHBondContact O-N 3.32Å
12	A	83.5	Confident	78.2	Confident	49 Å²	49	109.1 Å²	109.1	41%	0.405	62%	0.616	S	S	.	*	H	α-helix	trans	-63.3	-43.8	177	0	0	0	0	0	112.2	L8 F9 R14 A15 R16	L8-A12 WeakPolarHBondContact O-CB 3.36Å; L8-A12 PolarHBondContact O-N 3.42Å; F9-A12 PolarHBondContact O-N 3.4Å; A12-R14 VanDerWaalsContact C-N 3.34Å; A12-R14 PolarHBondContact O-N 3.49Å; A12-A15 PolarHBondContact O-N 2.91Å; A12-R16 WeakPolarHBondContact O-CG 3.29Å; A12-R16 PolarHBondContact O-N 3.45Å
13	A	85.3	Confident	77.8	Confident	50 Å²	50	106.4 Å²	106.4	41%	0.413	61%	0.614	S	S	.	*	H	α-helix	trans	-63.3	-40.9	176.2	0	0	0	0	0	111.8	F9 V10 R16 R17	F9-A13 WeakPolarHBondContact O-CB 3.5Å; F9-A13 PolarHBondContact O-N 2.93Å; V10-A13 PolarHBondContact O-N 3.12Å; A13-R16 PolarHBondContact O-N 3.43Å; A13-R17 PolarHBondContact O-N 3.01Å; A13-R17 WeakPolarHBondContact O-CG 3.42Å; A13-R17 VanDerWaalsContact O-N 3.12Å
14	R	86.3	Confident	76.8	Confident	173 Å²	173	105 Å²	105	65%	0.653	62%	0.62	S	S	*	*	H	α-helix	trans	-66.5	-41.1	176.7	-169.2	175.5	-167.4	-144	2	111.8	V10 A11 A12 R17 L18	V10-R14 PolarHBondContact O-N 3.37Å; V10-R14 WeakPolarHBondContact O-CB 3.41Å; V10-R14 VanDerWaalsContact O-CB 3.29Å; A11-R14 PolarHBondContact O-N 2.89Å; A12-R14 VanDerWaalsContact C-N 3.34Å; A12-R14 PolarHBondContact O-N 3.49Å; R14-R17 PolarHBondContact O-N 2.9Å; R14-L18 HydrophobicContact CG-CD1 3.63Å; R14-L18 HydrophobicContact CG-CG 4.16Å; R14-L18 WeakPolarHBondContact O-CB 3.33Å; R14-L18 WeakPolarHBondContact O-CG 3.35Å; R14-L18 PolarHBondContact O-N 3.26Å
15	A	83.5	Confident	75.5	Confident	58 Å²	58	108.5 Å²	108.5	48%	0.479	63%	0.627	S	S	.	*	H	α-helix	trans	-61.7	-42.7	175.1	0	0	0	0	0	112	A11 A12 R17 L18 G19 G20	A11-A15 WeakPolarHBondContact O-CB 3.37Å; A11-A15 PolarHBondContact O-N 3.32Å; A12-A15 PolarHBondContact O-N 2.91Å; A15-R17 VanDerWaalsContact C-N 3.33Å; A15-R17 PolarHBondContact O-N 3.41Å; A15-L18 PolarHBondContact O-N 3.34Å; A15-G19 PolarHBondContact O-N 2.91Å; A15-G20 PolarHBondContact O-N 3.1Å; A15-G20 VanDerWaalsContact O-N 3.1Å
16	R	75.9	Confident	74.6	Confident	200 Å²	200	107.7 Å²	107.7	76%	0.755	63%	0.634	S	S	*	*	H	α-helix	trans	-58.6	-42.7	173.9	-73.3	178.5	179.4	-175.7	-0.4	112.5	A12 A13 G20	A12-R16 WeakPolarHBondContact O-CG 3.29Å; A12-R16 PolarHBondContact O-N 3.45Å; A13-R16 PolarHBondContact O-N 3.43Å; R16-G20 PolarHBondContact O-N 3.39Å
17	R	76.2	Confident	73.4	Confident	227 Å²	227	110.9 Å²	110.9	86%	0.857	65%	0.654	S	S	*	*	H	α-helix	trans	-75.3	-31.6	-179.5	-66.4	-178	90.6	175.5	7.8	113.8	A13 R14 A15	A13-R17 PolarHBondContact O-N 3.01Å; A13-R17 WeakPolarHBondContact O-CG 3.42Å; A13-R17 VanDerWaalsContact O-N 3.12Å; R14-R17 PolarHBondContact O-N 2.9Å; A15-R17 VanDerWaalsContact C-N 3.33Å; A15-R17 PolarHBondContact O-N 3.41Å
18	L	78.5	Confident	72.2	Confident	131 Å²	131	110.5 Å²	110.5	69%	0.686	67%	0.666	S	S	*	*	H	α-helix	trans	-91.9	-19	-175.6	-68.4	-179.8	0	0	0	114.3	R14 A15	R14-L18 HydrophobicContact CG-CD1 3.63Å; R14-L18 HydrophobicContact CG-CG 4.16Å; R14-L18 WeakPolarHBondContact O-CB 3.33Å; R14-L18 WeakPolarHBondContact O-CG 3.35Å; R14-L18 PolarHBondContact O-N 3.26Å; A15-L18 PolarHBondContact O-N 3.34Å
19	G	71.1	Confident	70.8	Confident	51 Å²	51	107.2 Å²	107.2	53%	0.526	66%	0.663	S	S	.	*	H	α-helix	trans	-178.6	18.9	-179.1	0	0	0	0	0	116.3	A15 A21	A15-G19 PolarHBondContact O-N 2.91Å; G19-A21 PolarHBondContact O-N 3.02Å
20	G	60.7	Low	69.6	Low	49 Å²	49	105.3 Å²	105.3	51%	0.505	67%	0.668	S	S	.	*	T	Hydrogen-bonded Turn	trans	-74	25.8	-174.8	0	0	0	0	0	116.1	A15 R16	A15-G20 PolarHBondContact O-N 3.1Å; A15-G20 VanDerWaalsContact O-N 3.1Å; R16-G20 PolarHBondContact O-N 3.39Å
21	A	54.7	Low	68.2	Low	110 Å²	110	109.3 Å²	109.3	91%	0.909	68%	0.68	S	S	*	*	T	Hydrogen-bonded Turn	trans	-87.6	-5.6	167.4	0	0	0	0	0	112.7	G19	G19-A21 PolarHBondContact O-N 3.02Å
22	A	56.4	Low	67.1	Low	94 Å²	94	111 Å²	111	78%	0.777	69%	0.694	S	S	*	*	S	Bend	trans	-123.4	5.7	-168.4	0	0	0	0	0	116.4
23	A	62.4	Low	66.2	Low	84 Å²	84	112.8 Å²	112.8	69%	0.694	71%	0.709	S	S	*	*	S	Bend	trans	-130	86.4	175.8	0	0	0	0	0	109.6
24	S	58.4	Low	65.1	Low	111 Å²	111	116 Å²	116	78%	0.776	73%	0.728	S	S	*	*			trans	42.8	109.7	161.1	-53.3	0	0	0	0	115.9	P26	S24-P26 WeakPolarHBondContact O-CD 3.42Å; S24-P26 VanDerWaalsContact O-N 3.12Å
25	E	54.1	Low	63.9	Low	177 Å²	177	113.5 Å²	113.5	83%	0.827	74%	0.735	S	S	*	*			trans	-39.2	122.9	150.1	-64.6	-176.7	155.7	0	0	108.2	S27	E25-S27 PolarHBondContact O-N 2.78Å
26	P	58.9	Low	63.4	Low	116 Å²	116	119.7 Å²	119.7	75%	0.753	75%	0.751	S	S	*	*			trans	-60.6	105.5	149.8	26.6	-26.2	0	0	0	102.8	S24 A28	S24-P26 WeakPolarHBondContact O-CD 3.42Å; S24-P26 VanDerWaalsContact O-N 3.12Å; P26-A28 PolarHBondContact O-N 3.15Å
27	S	59.1	Low	63	Low	104 Å²	104	115.7 Å²	115.7	73%	0.727	75%	0.754	S	S	*	*			trans	-48.6	103.2	170.1	173	0	0	0	0	105.7	E25 G29	E25-S27 PolarHBondContact O-N 2.78Å; S27-G29 PolarHBondContact O-N 3.14Å; S27-G29 PolarHBondContact OG-N 2.94Å
28	A	61.7	Low	62.4	Low	97 Å²	97	111.6 Å²	111.6	80%	0.802	75%	0.754	S	S	*	*			trans	-75.6	38.3	173	0	0	0	0	0	108.8	P26 S30	P26-A28 PolarHBondContact O-N 3.15Å; A28-S30 PolarHBondContact O-N 3.48Å
29	G	59.3	Low	62.1	Low	59 Å²	59	114 Å²	114	61%	0.608	76%	0.761	S	S	*	*			trans	-71.9	56.8	153.8	0	0	0	0	0	108.7	S27 E31	S27-G29 PolarHBondContact O-N 3.14Å; S27-G29 PolarHBondContact OG-N 2.94Å; G29-E31 PolarHBondContact O-N 2.89Å; G29-E31 VanDerWaalsContact O-N 3.14Å
30	S	60.6	Low	62.1	Low	112 Å²	112	115.4 Å²	115.4	78%	0.783	77%	0.768	S	S	*	*			trans	-62.3	113.2	152.1	-153.9	0	0	0	0	103.8	A28 A32	A28-S30 PolarHBondContact O-N 3.48Å; S30-A32 PolarHBondContact O-N 2.71Å; S30-A32 VanDerWaalsContact O-N 3.15Å
31	E	61.7	Low	62.3	Low	183 Å²	183	119.1 Å²	119.1	86%	0.855	78%	0.783	S	S	*	*			trans	-22.5	113.9	-178.3	-61.7	-179.9	135.1	0	0	111	G29 A33	G29-E31 PolarHBondContact O-N 2.89Å; G29-E31 VanDerWaalsContact O-N 3.14Å; E31-A33 VanDerWaalsContact C-N 3.27Å; E31-A33 PolarHBondContact O-N 2.88Å
32	A	62	Low	63.1	Low	95 Å²	95	120 Å²	120	79%	0.785	78%	0.782	S	S	*	*			trans	-51	107.2	160	0	0	0	0	0	105.2	S30 S34	S30-A32 PolarHBondContact O-N 2.71Å; S30-A32 VanDerWaalsContact O-N 3.15Å; A32-S34 PolarHBondContact O-N 2.83Å
33	A	63.9	Low	63.5	Low	87 Å²	87	119.1 Å²	119.1	72%	0.719	78%	0.783	S	S	*	*			trans	-44.7	111.1	175.3	0	0	0	0	0	106.1	E31 P35	E31-A33 VanDerWaalsContact C-N 3.27Å; E31-A33 PolarHBondContact O-N 2.88Å; A33-P35 WeakPolarHBondContact O-CD 3Å
34	S	61	Low	63	Low	117 Å²	117	123.9 Å²	123.9	82%	0.818	82%	0.822	S	S	*	*			trans	-53.9	107.3	173.6	-88.7	0	0	0	0	105.9	A32 K36	A32-S34 PolarHBondContact O-N 2.83Å; S34-K36 VanDerWaalsContact C-N 3.34Å; S34-K36 PolarHBondContact O-N 2.93Å
35	P	61.6	Low	63.2	Low	121 Å²	121	124.6 Å²	124.6	79%	0.786	82%	0.824	S	S	*	*			trans	-69.3	110.3	170.3	24.2	-16.4	0	0	0	103.3	A33 S37	A33-P35 WeakPolarHBondContact O-CD 3Å; P35-S37 PolarHBondContact O-N 3.04Å
36	K	72.9	Confident	63.7	Low	189 Å²	189	121.8 Å²	121.8	82%	0.822	82%	0.824	S	S	*	*			trans	-32.2	118.3	167	-127.2	171.6	-178.7	169.9	0	107.2	S34 V38	S34-K36 VanDerWaalsContact C-N 3.34Å; S34-K36 PolarHBondContact O-N 2.93Å; K36-V38 PolarHBondContact O-N 2.86Å
37	S	68.7	Low	64	Low	116 Å²	116	122.1 Å²	122.1	81%	0.811	83%	0.828	S	S	*	*			trans	-51.5	106.2	174.9	38.1	0	0	0	0	107.4	P35 Q39	P35-S37 PolarHBondContact O-N 3.04Å; S37-Q39 VanDerWaalsContact C-N 3.28Å; S37-Q39 PolarHBondContact O-N 2.93Å
38	V	62.1	Low	64.2	Low	141 Å²	141	123.2 Å²	123.2	86%	0.855	83%	0.834	S	S	*	*			trans	-72.2	99	172.5	-170.6	0	0	0	0	104.2	K36 A40	K36-V38 PolarHBondContact O-N 2.86Å; V38-A40 PolarHBondContact O-N 3.03Å
39	Q	72.1	Confident	64.4	Low	181 Å²	181	124.8 Å²	124.8	85%	0.846	84%	0.836	S	S	*	*			trans	-53.5	111.3	171.7	-175.8	164.6	32.9	0	0	107.6	S37	S37-Q39 VanDerWaalsContact C-N 3.28Å; S37-Q39 PolarHBondContact O-N 2.93Å
40	A	71.3	Confident	64.8	Low	80 Å²	80	129.2 Å²	129.2	66%	0.661	85%	0.851	S	S	*	*			trans	-61.7	132.4	171.8	0	0	0	0	0	107.9	V38 S42	V38-A40 PolarHBondContact O-N 3.03Å; A40-S42 PolarHBondContact O-N 3.21Å; A40-S42 VanDerWaalsContact O-N 3.14Å
41	P	65.8	Low	65	Low	128 Å²	128	130.4 Å²	130.4	83%	0.831	86%	0.856	S	S	*	*			trans	-62.7	119.8	174.7	25.1	-31	0	0	0	108.3	G43	P41-G43 PolarHBondContact O-N 3.14Å
42	S	70.5	Confident	65.3	Low	128 Å²	128	126.4 Å²	126.4	90%	0.895	86%	0.856	S	S	*	*			trans	-71.6	110	169.9	64.3	0	0	0	0	108	A40	A40-S42 PolarHBondContact O-N 3.21Å; A40-S42 VanDerWaalsContact O-N 3.14Å
43	G	65.1	Low	65.6	Low	76 Å²	76	129 Å²	129	78%	0.784	86%	0.862	S	S	*	*			trans	176.8	89.3	174.3	0	0	0	0	0	114.2	P41	P41-G43 PolarHBondContact O-N 3.14Å
44	A	52.2	Low	65.7	Low	184 Å²	184	132.8 Å²	132.8	100%	1.521	88%	0.875	S	S	*	*			trans	-165.4	0	137.3	0	0	0	0	0	108.5

Retrieved 44 of 44 residues in 10.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).