A0A087WZ02_HUMAN Loading...

Diacylglycerol kinase eta

AlphaFold DB , UniProt , Accession A0A087WZ02, Species HUMAN (Homo sapiens, Human), Gene DGKH, Length 62 aa.

						>A0A087WZ02_HUMAN|A0A087WZ02|DGKH
AAAGAGAAVTSAAASAGPGEDSSDSEAEQEGPQKLIRKVSTSGQIRTKGFIMLARLVTSELK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	A	37.6	Very low	41	Very low	153 Å²	153	106.5 Å²	106.5	100%	1.264	85%	0.845	S	S	*	*				0	134.2	0	0	0	0	0	0	108.5
2	A	34.6	Very low	41	Very low	107 Å²	107	105.1 Å²	105.1	88%	0.884	84%	0.837	S	S	*	*			trans	62.7	142.8	172	0	0	0	0	0	116
3	A	38.3	Very low	41.7	Very low	103 Å²	103	104.6 Å²	104.6	85%	0.851	84%	0.835	S	S	*	*			cis	-165.2	166.5	4.9	0	0	0	0	0	105.2
4	G	36.4	Very low	42	Very low	77 Å²	77	104.4 Å²	104.4	79%	0.794	84%	0.835	S	S	*	*			cis	-173.9	159	11.3	0	0	0	0	0	108.7
5	A	47.9	Very low	42.4	Very low	111 Å²	111	104.8 Å²	104.8	92%	0.917	83%	0.831	S	S	*	*			trans	-83	152.2	176	0	0	0	0	0	111.6
6	G	37.8	Very low	43.1	Very low	68 Å²	68	104.4 Å²	104.4	70%	0.701	83%	0.83	S	S	*	*			trans	-163.5	104.2	154.7	0	0	0	0	0	106.6
7	A	42.5	Very low	43.7	Very low	104 Å²	104	102.5 Å²	102.5	86%	0.86	83%	0.825	S	S	*	*				42.1	107.7	76	0	0	0	0	0	109.3
8	A	43.2	Very low	44.3	Very low	89 Å²	89	103.6 Å²	103.6	74%	0.736	82%	0.823	S	S	*	*				165.8	139.4	62.7	0	0	0	0	0	103.1
9	V	43.3	Very low	45.2	Very low	122 Å²	122	101.7 Å²	101.7	74%	0.739	82%	0.816	S	S	*	*				138	153.1	65.4	141.2	0	0	0	0	107.4
10	T	44.1	Very low	46.2	Very low	126 Å²	126	105.3 Å²	105.3	77%	0.773	82%	0.816	S	S	*	*			trans	71.9	115.1	160.9	54.4	0	0	0	0	121.4
11	S	45.7	Very low	47.2	Very low	111 Å²	111	107 Å²	107	78%	0.776	81%	0.813	S	S	*	*				-169.8	109.6	91.4	-116.3	0	0	0	0	108.9
12	A	41.2	Very low	48.6	Very low	90 Å²	90	105.1 Å²	105.1	74%	0.744	79%	0.791	S	S	*	*				55.8	90.6	95.7	0	0	0	0	0	111.3
13	A	49.3	Very low	50.4	Low	99 Å²	99	104.5 Å²	104.5	82%	0.818	78%	0.78	S	S	*	*				72.7	135.8	90.3	0	0	0	0	0	114.2
14	A	45.7	Very low	52	Low	101 Å²	101	106.3 Å²	106.3	84%	0.835	78%	0.775	S	S	*	*			trans	80.6	132.3	175.4	0	0	0	0	0	113.8
15	S	49.2	Very low	53.7	Low	111 Å²	111	107.6 Å²	107.6	78%	0.776	77%	0.772	S	S	*	*			cis	-177.4	151.5	30.6	42.6	0	0	0	0	110.7
16	A	53	Low	54.7	Low	99 Å²	99	110.5 Å²	110.5	82%	0.818	77%	0.767	S	S	*	*			trans	80.2	113.8	150.2	0	0	0	0	0	119.5
17	G	53.8	Low	56.2	Low	71 Å²	71	110.6 Å²	110.6	73%	0.732	76%	0.761	S	S	*	*			trans	-73	-149.7	150.2	0	0	0	0	0	110.5
18	P	54.5	Low	57.4	Low	123 Å²	123	114.3 Å²	114.3	80%	0.799	76%	0.761	S	S	*	*			cis	-109.6	167	-17.6	38	-25	0	0	0	110.9
19	G	61.3	Low	58.5	Low	67 Å²	67	116 Å²	116	69%	0.691	75%	0.753	S	S	*	*			trans	176.9	47.3	-177.6	0	0	0	0	0	114.5	D21	G19-D21 PolarHBondContact O-N 3Å
20	E	64.1	Low	59.8	Low	173 Å²	173	119.4 Å²	119.4	81%	0.808	76%	0.761	S	S	*	*			trans	-45.1	104.5	154.1	-65.5	84.2	96.5	0	0	109.4
21	D	67.9	Low	61.5	Low	141 Å²	141	115.3 Å²	115.3	75%	0.754	74%	0.743	S	S	*	*				170.9	62.5	114.7	-147.8	-43.1	0	0	0	109.8	G19	G19-D21 PolarHBondContact O-N 3Å
22	S	67.6	Low	63.2	Low	115 Å²	115	116.1 Å²	116.1	80%	0.804	75%	0.746	S	S	*	*			trans	-93.4	96	160.7	-175	0	0	0	0	106.7	D24	S22-D24 VanDerWaalsContact C-N 3.26Å; S22-D24 PolarHBondContact O-N 2.82Å
23	S	72.1	Confident	65.1	Low	94 Å²	94	118.2 Å²	118.2	66%	0.657	74%	0.74	S	S	*	*			trans	-58.4	94.3	165.7	-82.2	0	0	0	0	108.4	S25	S23-S25 PolarHBondContact O-N 2.9Å
24	D	72.2	Confident	66.8	Low	140 Å²	140	121.3 Å²	121.3	75%	0.749	74%	0.736	S	S	*	*			trans	-65	94.3	160.7	-166.1	51.7	0	0	0	104.7	S22 E26	S22-D24 VanDerWaalsContact C-N 3.26Å; S22-D24 PolarHBondContact O-N 2.82Å; D24-E26 PolarHBondContact O-N 2.83Å
25	S	72.3	Confident	68.6	Low	105 Å²	105	124.1 Å²	124.1	73%	0.734	74%	0.736	S	S	*	*			trans	-58.7	100.9	171.6	-65.9	0	0	0	0	104.9	S23 A27	S23-S25 PolarHBondContact O-N 2.9Å; S25-A27 VanDerWaalsContact C-N 3.35Å; S25-A27 PolarHBondContact O-N 2.8Å
26	E	68.9	Low	70.3	Confident	172 Å²	172	125.3 Å²	125.3	80%	0.804	73%	0.732	S	S	*	*			trans	-48.2	110.3	170.9	-81.2	-132.2	101.5	0	0	104.6	D24 E28	D24-E26 PolarHBondContact O-N 2.83Å; E26-E28 PolarHBondContact O-N 2.63Å
27	A	67.9	Low	72	Confident	69 Å²	69	130.1 Å²	130.1	57%	0.57	73%	0.729	S	S	*	*			trans	-57.6	104.7	174.1	0	0	0	0	0	104.1	S25 Q29	S25-A27 VanDerWaalsContact C-N 3.35Å; S25-A27 PolarHBondContact O-N 2.8Å; A27-Q29 HydrophobicContact CB-CG 3.78Å; A27-Q29 PolarHBondContact O-N 2.74Å
28	E	68.1	Low	73.5	Confident	183 Å²	183	137.3 Å²	137.3	86%	0.855	74%	0.74	S	S	*	*			trans	-62	78.3	161.4	-68.1	-164.9	112.6	0	0	104.3	E26 E30	E26-E28 PolarHBondContact O-N 2.63Å; E28-E30 PolarHBondContact O-N 2.8Å
29	Q	67.1	Low	74.8	Confident	125 Å²	125	137.3 Å²	137.3	58%	0.584	74%	0.737	S	S	*	*			trans	-73.4	76.4	170.2	-63.8	-152	5.6	0	0	104.4	A27 G31	A27-Q29 HydrophobicContact CB-CG 3.78Å; A27-Q29 PolarHBondContact O-N 2.74Å; Q29-G31 PolarHBondContact O-N 2.89Å
30	E	69.8	Low	75.8	Confident	193 Å²	193	138.7 Å²	138.7	90%	0.902	74%	0.737	S	S	*	*			trans	-69.9	80.1	172	-163.2	172.5	172.3	0	0	107.1	E28	E28-E30 PolarHBondContact O-N 2.8Å
31	G	79.3	Confident	76.5	Confident	39 Å²	39	134.7 Å²	134.7	40%	0.402	72%	0.724	S	S	.	*	S	Bend	trans	94	175.7	175.2	0	0	0	0	0	115.9	Q29 Q33	Q29-G31 PolarHBondContact O-N 2.89Å; G31-Q33 PolarHBondContact O-N 2.75Å
32	P	82.2	Confident	76.8	Confident	128 Å²	128	133.4 Å²	133.4	83%	0.831	73%	0.726	S	S	*	*			trans	-62.4	99.8	-171.5	-20.2	31.9	0	0	0	112.2	K34	P32-K34 PolarHBondContact O-N 3.15Å; P32-K34 VanDerWaalsContact O-N 3.16Å
33	Q	81.1	Confident	77	Confident	134 Å²	134	131 Å²	131	63%	0.626	72%	0.719	S	S	*	*			trans	-78.4	98.6	174.9	-65.7	-156.6	49.8	0	0	110.2	G31	G31-Q33 PolarHBondContact O-N 2.75Å
34	K	84.8	Confident	76.9	Confident	165 Å²	165	133.8 Å²	133.8	72%	0.717	72%	0.722	S	S	*	*			trans	-97.6	120.9	175.9	-62.1	-168.1	-50.3	-175.4	0	111.1	P32 I36	P32-K34 PolarHBondContact O-N 3.15Å; P32-K34 VanDerWaalsContact O-N 3.16Å; K34-I36 HydrophobicContact CB-CD1 4.2Å; K34-I36 PolarHBondContact O-N 3.16Å; K34-I36 VanDerWaalsContact O-N 3.15Å
35	L	82.8	Confident	77	Confident	160 Å²	160	134.3 Å²	134.3	84%	0.838	72%	0.723	S	S	*	*			trans	-68.4	108.9	169.9	-176	61.7	0	0	0	110.2
36	I	84.9	Confident	76.7	Confident	135 Å²	135	140.3 Å²	140.3	69%	0.692	73%	0.73	S	S	*	*			trans	-86.5	122.5	177.7	-52.7	-55.8	0	0	0	109.6	K34	K34-I36 HydrophobicContact CB-CD1 4.2Å; K34-I36 PolarHBondContact O-N 3.16Å; K34-I36 VanDerWaalsContact O-N 3.15Å
37	R	88.9	Confident	76.4	Confident	201 Å²	201	137.2 Å²	137.2	76%	0.758	72%	0.723	S	S	*	*			trans	-99.5	142.7	174.1	-68.1	-172	-75.9	167.5	-4.6	110.4	V39	R37-V39 PolarHBondContact O-N 3.08Å; R37-V39 VanDerWaalsContact O-N 3.08Å
38	K	86.6	Confident	76.3	Confident	221 Å²	221	141.5 Å²	141.5	96%	0.961	73%	0.729	S	S	*	*			trans	-60.5	112.4	172.2	-70.4	171.9	67.8	172.3	0	108.6
39	V	82.1	Confident	76.2	Confident	123 Å²	123	135.2 Å²	135.2	75%	0.745	71%	0.713	S	S	*	*			trans	-114.7	132.1	170.4	-68.1	0	0	0	0	107.8	R37	R37-V39 PolarHBondContact O-N 3.08Å; R37-V39 VanDerWaalsContact O-N 3.08Å
40	S	82.3	Confident	76.3	Confident	97 Å²	97	136.4 Å²	136.4	68%	0.678	72%	0.716	S	S	*	*			trans	-86.1	122.8	179.4	-175.4	0	0	0	0	110.1	S42	S40-S42 VanDerWaalsContact C-N 3.28Å; S40-S42 WeakPolarHBondContact OG-CB 3.12Å; S40-S42 PolarHBondContact OG-N 3.17Å; S40-S42 PolarHBondContact OG-OG 2.77Å
41	T	77.4	Confident	76.7	Confident	89 Å²	89	132.3 Å²	132.3	55%	0.546	70%	0.7	S	S	.	*			trans	-93.7	21.9	167.1	51.3	0	0	0	0	111.8	G43 Q44	T41-G43 PolarHBondContact O-N 3.04Å; T41-Q44 PolarHBondContact O-N 2.88Å
42	S	73.8	Confident	76.7	Confident	114 Å²	114	136.2 Å²	136.2	80%	0.797	71%	0.709	S	S	*	*	T	Hydrogen-bonded Turn	trans	-61.7	5	-171.3	62.8	0	0	0	0	116.5	S40	S40-S42 VanDerWaalsContact C-N 3.28Å; S40-S42 WeakPolarHBondContact OG-CB 3.12Å; S40-S42 PolarHBondContact OG-N 3.17Å; S40-S42 PolarHBondContact OG-OG 2.77Å
43	G	72.1	Confident	76.8	Confident	64 Å²	64	134.9 Å²	134.9	66%	0.66	69%	0.694	S	S	*	*	T	Hydrogen-bonded Turn	trans	-129.7	8.6	174.8	0	0	0	0	0	115.3	T41 I45	T41-G43 PolarHBondContact O-N 3.04Å; G43-I45 PolarHBondContact O-N 3.04Å
44	Q	71.4	Confident	76.8	Confident	153 Å²	153	130.5 Å²	130.5	72%	0.715	68%	0.681	S	S	*	*			trans	-84.5	43.2	-173.2	-82.9	-173.1	-7.7	0	0	115	T41	T41-Q44 PolarHBondContact O-N 2.88Å
45	I	72.6	Confident	77	Confident	150 Å²	150	131.2 Å²	131.2	77%	0.769	68%	0.679	S	S	*	*			trans	-123.4	110.4	171.4	33	170.5	0	0	0	109	G43	G43-I45 PolarHBondContact O-N 3.04Å
46	R	67.6	Low	77	Confident	232 Å²	232	128.3 Å²	128.3	88%	0.875	66%	0.664	S	S	*	*	S	Bend	trans	-170.4	-14.5	136.8	-101.4	-177.2	-55.5	-162.1	10.5	114.1
47	T	62	Low	76.9	Confident	106 Å²	106	125.8 Å²	125.8	65%	0.65	65%	0.654	S	S	*	*	S	Bend	trans	-101.9	-38.7	-176.4	-40.1	0	0	0	0	114	G49 F50 I51	T47-G49 VanDerWaalsContact C-N 3.31Å; T47-G49 PolarHBondContact O-N 3.03Å; T47-F50 PolarHBondContact O-N 2.99Å; T47-I51 HydrophobicContact CG2-CD1 4.21Å; T47-I51 PolarHBondContact O-N 3.31Å
48	K	64.8	Low	76.6	Confident	160 Å²	160	120.6 Å²	120.6	70%	0.696	65%	0.645	S	S	*	*	H	α-helix	trans	-70.4	-27.4	-178	-164.1	161	-178.4	173.2	0	113.1	M52	K48-M52 PolarHBondContact O-N 3.39Å; K48-M52 WeakPolarHBondContact O-CG 3.37Å; K48-M52 VanDerWaalsContact O-CG 3.22Å; K48-M52 HydrophobicContact CG-CG 4.36Å; K48-M52 WeakPolarHBondContact O-CB 3.22Å
49	G	66.2	Low	76.4	Confident	51 Å²	51	113.3 Å²	113.3	53%	0.526	62%	0.622	S	S	.	*	H	α-helix	trans	-64.9	-43.7	173.1	0	0	0	0	0	112.2	T47 L53	T47-G49 VanDerWaalsContact C-N 3.31Å; T47-G49 PolarHBondContact O-N 3.03Å; G49-L53 WeakPolarHBondContact O-CB 3.38Å; G49-L53 PolarHBondContact O-N 3.25Å
50	F	69	Low	76	Confident	149 Å²	149	114.7 Å²	114.7	65%	0.654	62%	0.621	S	S	*	*	H	α-helix	trans	-68.6	-38.5	178.6	-172.9	-98.8	0	0	0	112.5	T47 A54	T47-F50 PolarHBondContact O-N 2.99Å; F50-A54 WeakPolarHBondContact O-CB 3.03Å; F50-A54 PolarHBondContact O-N 2.91Å
51	I	78.3	Confident	75.7	Confident	108 Å²	108	117.3 Å²	117.3	55%	0.554	63%	0.626	S	S	*	*	H	α-helix	trans	-67.2	-43.6	177	-63.5	165	0	0	0	111.2	T47 R55	T47-I51 HydrophobicContact CG2-CD1 4.21Å; T47-I51 PolarHBondContact O-N 3.31Å; I51-R55 WeakPolarHBondContact O-CB 3.29Å; I51-R55 PolarHBondContact O-N 2.81Å
52	M	80.7	Confident	75.1	Confident	121 Å²	121	124.9 Å²	124.9	60%	0.596	65%	0.652	S	S	*	*	H	α-helix	trans	-68.3	-40.7	176.6	-69.6	-73.4	-97.9	0	0	111.5	K48 R55 L56	K48-M52 PolarHBondContact O-N 3.39Å; K48-M52 WeakPolarHBondContact O-CG 3.37Å; K48-M52 VanDerWaalsContact O-CG 3.22Å; K48-M52 HydrophobicContact CG-CG 4.36Å; K48-M52 WeakPolarHBondContact O-CB 3.22Å; M52-R55 PolarHBondContact O-N 2.78Å; M52-L56 WeakPolarHBondContact O-CB 3.11Å; M52-L56 PolarHBondContact O-N 3.47Å
53	L	82.7	Confident	75.1	Confident	100 Å²	100	125.5 Å²	125.5	52%	0.524	64%	0.644	S	S	.	*	H	α-helix	trans	-64.8	-45.4	175.8	-176.7	66.5	0	0	0	111.4	G49 R55 L56 V57	G49-L53 WeakPolarHBondContact O-CB 3.38Å; G49-L53 PolarHBondContact O-N 3.25Å; L53-R55 VanDerWaalsContact C-N 3.33Å; L53-R55 PolarHBondContact O-N 2.9Å; L53-L56 PolarHBondContact O-N 3.46Å; L53-V57 PolarHBondContact O-N 3.25Å; L53-V57 WeakPolarHBondContact O-CG2 3.39Å; L53-V57 HydrophobicContact CD1-CG2 4.49Å; L53-V57 VanDerWaalsContact O-CG2 3.29Å
54	A	82.8	Confident	75.3	Confident	42 Å²	42	128.7 Å²	128.7	35%	0.347	64%	0.643	S	S	.	*	H	α-helix	trans	-59.9	-44.3	175.6	0	0	0	0	0	111.1	F50 V57 T58	F50-A54 WeakPolarHBondContact O-CB 3.03Å; F50-A54 PolarHBondContact O-N 2.91Å; A54-V57 PolarHBondContact O-N 3.41Å; A54-T58 WeakPolarHBondContact O-CG2 3.46Å; A54-T58 PolarHBondContact O-N 3.14Å; A54-T58 PolarHBondContact O-OG1 2.96Å; A54-T58 VanDerWaalsContact O-OG1 3.14Å
55	R	87.5	Confident	75.5	Confident	179 Å²	179	127.3 Å²	127.3	68%	0.675	64%	0.639	S	S	*	*	H	α-helix	trans	-60.4	-46.7	175	-175.1	-177.3	175.3	101.3	-0.4	111.7	I51 M52 L53 T58 S59	I51-R55 WeakPolarHBondContact O-CB 3.29Å; I51-R55 PolarHBondContact O-N 2.81Å; M52-R55 PolarHBondContact O-N 2.78Å; L53-R55 VanDerWaalsContact C-N 3.33Å; L53-R55 PolarHBondContact O-N 2.9Å; R55-T58 PolarHBondContact O-OG1 3.27Å; R55-T58 PolarHBondContact O-N 2.79Å; R55-T58 WeakPolarHBondContact CA-OG1 3.36Å; R55-S59 PolarHBondContact O-N 3.04Å; R55-S59 PolarHBondContact O-OG 3.22Å
56	L	82.9	Confident	75.7	Confident	100 Å²	100	126 Å²	126	52%	0.524	63%	0.632	S	S	.	*	H	α-helix	trans	-60.7	-48.3	179.3	-176.2	64.5	0	0	0	111.4	M52 L53 T58 S59 E60	M52-L56 WeakPolarHBondContact O-CB 3.11Å; M52-L56 PolarHBondContact O-N 3.47Å; L53-L56 PolarHBondContact O-N 3.46Å; L56-T58 VanDerWaalsContact C-N 3.27Å; L56-T58 PolarHBondContact O-N 3.2Å; L56-S59 WeakPolarHBondContact O-CB 3.47Å; L56-S59 PolarHBondContact O-N 3.31Å; L56-E60 PolarHBondContact O-N 3.03Å
57	V	83.8	Confident	76.2	Confident	81 Å²	81	119.4 Å²	119.4	49%	0.491	62%	0.617	S	S	.	*	H	α-helix	trans	-59.4	-38.7	177.4	171.6	0	0	0	0	111.5	L53 A54	L53-V57 PolarHBondContact O-N 3.25Å; L53-V57 WeakPolarHBondContact O-CG2 3.39Å; L53-V57 HydrophobicContact CD1-CG2 4.49Å; L53-V57 VanDerWaalsContact O-CG2 3.29Å; A54-V57 PolarHBondContact O-N 3.41Å
58	T	82.6	Confident	77.1	Confident	93 Å²	93	120.3 Å²	120.3	57%	0.571	61%	0.614	S	S	*	*	H	α-helix	trans	-75.6	-20.4	176	57.8	0	0	0	0	114.4	A54 R55 L56	A54-T58 WeakPolarHBondContact O-CG2 3.46Å; A54-T58 PolarHBondContact O-N 3.14Å; A54-T58 PolarHBondContact O-OG1 2.96Å; A54-T58 VanDerWaalsContact O-OG1 3.14Å; R55-T58 PolarHBondContact O-OG1 3.27Å; R55-T58 PolarHBondContact O-N 2.79Å; R55-T58 WeakPolarHBondContact CA-OG1 3.36Å; L56-T58 VanDerWaalsContact C-N 3.27Å; L56-T58 PolarHBondContact O-N 3.2Å
59	S	81.7	Confident	78	Confident	68 Å²	68	117.4 Å²	117.4	48%	0.476	61%	0.609	S	S	.	*	H	α-helix	trans	-76.4	-31.7	175.5	-73.2	0	0	0	0	112.3	R55 L56 L61	R55-S59 PolarHBondContact O-N 3.04Å; R55-S59 PolarHBondContact O-OG 3.22Å; L56-S59 WeakPolarHBondContact O-CB 3.47Å; L56-S59 PolarHBondContact O-N 3.31Å; S59-L61 VanDerWaalsContact C-N 3.28Å
60	E	74.3	Confident	78.9	Confident	152 Å²	152	122.5 Å²	122.5	71%	0.71	62%	0.615	S	S	*	*	T	Hydrogen-bonded Turn	trans	-78.8	-10.7	176.2	-60.1	-61.7	131.4	0	0	113.3	L56	L56-E60 PolarHBondContact O-N 3.03Å
61	L	75.8	Confident	79.8	Confident	151 Å²	151	120.3 Å²	120.3	79%	0.791	61%	0.612	S	S	*	*	T	Hydrogen-bonded Turn	trans	-96	12	-177.9	-114.3	80.3	0	0	0	113.8	S59	S59-L61 VanDerWaalsContact C-N 3.28Å
62	K	63.9	Low	79.9	Confident	249 Å²	249	121.5 Å²	121.5	100%	1.083	62%	0.617	S	S	*	*			trans	-124.7	0	-172.4	-160.8	151.6	-178.8	147.4	0	111.1

Retrieved 62 of 62 residues in 343.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).