A0A087WZ61_HUMAN Loading...

Zinc finger protein 316

AlphaFold DB , UniProt , Accession A0A087WZ61, Species HUMAN (Homo sapiens, Human), Gene ZNF316, Length 40 aa.

>A0A087WZ61_HUMAN|A0A087WZ61|ZNF316
MQENYGILVSLGYPIPKPDLIFRLEQGEEPWVPDSPRPEE
Structure Viewer
Loading PAE data...
(Predicted Aligned Error values between residue pairs)
Error loading PAE data: please refresh the page.

 

Download Structure   PDB   PAE   Table  
Site Residue pLDDT pLDDT confidence pLDDT10 pLDDT10 confidence SASA SASA [Ų] SASA10 SASA10 [Ų] RSA RSA unformatted RSA10 RSA10 unformatted Surface Surface10 (not used) Disorder (not used) Disorder Sec. str. Secondary structure Isomer Phi (φ) Psi (ψ) Omega (ω) Chi 1 (χ1) Chi 2 (χ2) Chi 3 (χ3) Chi 4 (χ4) Chi 5 (χ5) Tau (τ) Contacts (colored by PAE) Contact details
1M79.6Confident89.7Confident114 Ų11488.7 Ų88.756%0.56248%0.48SS*.  0-49.90-76.1-56.8-163.100112.9E3 N4 Y5 L20 I21 L24 W31M1-E3 PolarHBondContact O-N 2.86Å; M1-N4 PolarHBondContact O-N 3.12Å; M1-Y5 PolarHBondContact O-N 3.12Å; M1-L20 HydrophobicContact CB-CD2 4.4Å; M1-L20 HydrophobicContact CG-CD2 4.05Å; M1-I21 HydrophobicContact CB-CD1 4.32Å; M1-L24 HydrophobicContact CB-CD1 3.81Å; M1-W31 HydrophobicContact CB-CH2 4.47Å; M1-W31 HydrophobicContact CB-CZ3 4.5Å; M1-W31 HydrophobicContact CE-CZ3 4.36Å; M1-W31 HydrophobicContact CG-CH2 3.59Å; M1-W31 HydrophobicContact CG-CZ3 3.59Å
2Q82.9Confident90.1Very high84 Ų8486.3 Ų86.339%0.39349%0.491SS..Hα-helixtrans-55.3-45.3174.6-86.2-177.80.200114.1N4 Y5 G6 I21 L24 E25Q2-N4 VanDerWaalsContact C-N 3.3Å; Q2-N4 PolarHBondContact O-N 3.3Å; Q2-Y5 PolarHBondContact O-N 3.44Å; Q2-Y5 VanDerWaalsContact O-N 3.14Å; Q2-G6 PolarHBondContact O-N 2.93Å; Q2-I21 HydrophobicContact CG-CD1 4.28Å; Q2-I21 HydrophobicContact CG-CG2 4.34Å; Q2-L24 HydrophobicContact CG-CB 4.02Å; Q2-L24 HydrophobicContact CG-CD1 4.19Å; Q2-L24 PolarHBondContact NE2-O 3.27Å; Q2-E25 VanDerWaalsContact NE2-CG 3.3Å; Q2-E25 VanDerWaalsContact NE2-N 3.12Å
3E86.4Confident90.2Very high157 Ų15790.5 Ų90.573%0.73450%0.496SS*.Hα-helixtrans-53.1-46.5177.7-168.6113.470.900112.3M1 Y5 G6 I7M1-E3 PolarHBondContact O-N 2.86Å; E3-Y5 PolarHBondContact O-N 3.13Å; E3-G6 PolarHBondContact O-N 3.47Å; E3-G6 VanDerWaalsContact O-N 3.16Å; E3-I7 HydrophobicContact CG-CD1 4.31Å; E3-I7 WeakPolarHBondContact O-CG1 3.47Å; E3-I7 PolarHBondContact O-N 3.37Å
4N89.8Confident90Very high92 Ų9293.2 Ų93.249%0.49252%0.52SS..Hα-helixtrans-63.9-41.1179.8-62.5-2.1000112.2M1 Q2 G6 I7 L8M1-N4 PolarHBondContact O-N 3.12Å; Q2-N4 VanDerWaalsContact C-N 3.3Å; Q2-N4 PolarHBondContact O-N 3.3Å; N4-G6 VanDerWaalsContact C-N 3.33Å; N4-I7 PolarHBondContact O-N 3.32Å; N4-L8 WeakPolarHBondContact O-CG 3.44Å; N4-L8 PolarHBondContact O-N 3.36Å; N4-L8 VanDerWaalsContact O-N 3.08Å
5Y90.1Very high89.9Confident49 Ų4991.1 Ų91.119%0.19251%0.506CS..Hα-helixtrans-62.3-43.4174.6176.4-104.7000110.8M1 Q2 E3 I7 L8 V9 I15 K17 P18 I21M1-Y5 PolarHBondContact O-N 3.12Å; Q2-Y5 PolarHBondContact O-N 3.44Å; Q2-Y5 VanDerWaalsContact O-N 3.14Å; E3-Y5 PolarHBondContact O-N 3.13Å; Y5-I7 PolarHBondContact O-N 2.88Å; Y5-L8 PolarHBondContact O-N 3.47Å; Y5-V9 HydrophobicContact CD1-CG2 4.24Å; Y5-V9 HydrophobicContact CD2-CG2 4.29Å; Y5-V9 HydrophobicContact CE1-CG2 3.76Å; Y5-V9 HydrophobicContact CE2-CG2 3.81Å; Y5-V9 HydrophobicContact CG-CG2 4.48Å; Y5-V9 WeakPolarHBondContact O-CG2 3.48Å; Y5-V9 PolarHBondContact O-N 3.08Å; Y5-I15 HydrophobicContact CE2-CB 4.39Å; Y5-I15 HydrophobicContact CE2-CG2 4.46Å; Y5-I15 PolarHBondContact OH-O 3.41Å; Y5-K17 HydrophobicContact CE1-CG 4.27Å; Y5-P18 HydrophobicContact CD2-CG 4.45Å; Y5-I21 HydrophobicContact CD1-CG1 4.44Å; Y5-I21 HydrophobicContact CD1-CG2 3.92Å; Y5-I21 HydrophobicContact CD2-CG1 4.43Å; Y5-I21 HydrophobicContact CE1-CG2 4.36Å; Y5-I21 HydrophobicContact CG-CD1 4.48Å; Y5-I21 HydrophobicContact CG-CG1 4.02Å; Y5-I21 HydrophobicContact CG-CG2 4.35Å
6G90.3Very high89.8Confident31 Ų3192.3 Ų92.332%0.3252%0.52SS..Hα-helixtrans-56.1-47.7174.700000112.4Q2 E3 N4 L8 V9 S10Q2-G6 PolarHBondContact O-N 2.93Å; E3-G6 PolarHBondContact O-N 3.47Å; E3-G6 VanDerWaalsContact O-N 3.16Å; N4-G6 VanDerWaalsContact C-N 3.33Å; G6-L8 PolarHBondContact O-N 2.96Å; G6-V9 PolarHBondContact O-N 3.48Å; G6-S10 WeakPolarHBondContact O-CB 3.39Å; G6-S10 PolarHBondContact O-N 3.11Å; G6-S10 PolarHBondContact O-OG 3.21Å; G6-S10 VanDerWaalsContact O-OG 3.06Å
7I94.2Very high89.8Confident90 Ų9092.6 Ų92.646%0.46251%0.514SS..Hα-helixtrans-57.9-46.8176.8-66.8164.8000111.1E3 N4 Y5 V9 S10 L11E3-I7 HydrophobicContact CG-CD1 4.31Å; E3-I7 WeakPolarHBondContact O-CG1 3.47Å; E3-I7 PolarHBondContact O-N 3.37Å; N4-I7 PolarHBondContact O-N 3.32Å; Y5-I7 PolarHBondContact O-N 2.88Å; I7-V9 PolarHBondContact O-N 3.31Å; I7-S10 PolarHBondContact O-N 2.93Å; I7-L11 HydrophobicContact CG2-CD1 3.98Å; I7-L11 HydrophobicContact CG2-CG 4.47Å; I7-L11 VanDerWaalsContact O-CG 3.26Å; I7-L11 WeakPolarHBondContact O-CG 3.19Å; I7-L11 PolarHBondContact O-N 3.23Å
8L92.8Very high89.7Confident67 Ų6790.4 Ų90.435%0.35151%0.505SS..Hα-helixtrans-65.6-39.4-178.7-68171.7000112.5N4 Y5 G6 L11 G12 Y13 I15N4-L8 WeakPolarHBondContact O-CG 3.44Å; N4-L8 PolarHBondContact O-N 3.36Å; N4-L8 VanDerWaalsContact O-N 3.08Å; Y5-L8 PolarHBondContact O-N 3.47Å; G6-L8 PolarHBondContact O-N 2.96Å; L8-L11 PolarHBondContact O-N 3.49Å; L8-G12 PolarHBondContact O-N 3.03Å; L8-Y13 HydrophobicContact CD2-CD2 4.37Å; L8-Y13 WeakPolarHBondContact O-CB 3.36Å; L8-Y13 PolarHBondContact O-N 2.66Å; L8-Y13 VanDerWaalsContact O-N 3.12Å; L8-I15 HydrophobicContact CB-CD1 3.64Å; L8-I15 HydrophobicContact CD1-CD1 3.59Å; L8-I15 HydrophobicContact CD2-CD1 4.42Å; L8-I15 HydrophobicContact CG-CD1 4.08Å
9V91.9Very high89.7Confident67 Ų6792.3 Ų92.341%0.40651%0.514SS..Hα-helixtrans-65.3-43.4173.9172.60000110.8Y5 G6 I7 L11 G12Y5-V9 HydrophobicContact CD1-CG2 4.24Å; Y5-V9 HydrophobicContact CD2-CG2 4.29Å; Y5-V9 HydrophobicContact CE1-CG2 3.76Å; Y5-V9 HydrophobicContact CE2-CG2 3.81Å; Y5-V9 HydrophobicContact CG-CG2 4.48Å; Y5-V9 WeakPolarHBondContact O-CG2 3.48Å; Y5-V9 PolarHBondContact O-N 3.08Å; G6-V9 PolarHBondContact O-N 3.48Å; I7-V9 PolarHBondContact O-N 3.31Å; V9-L11 PolarHBondContact O-N 3.35Å; V9-G12 WeakPolarHBondContact O-CA 3.39Å; V9-G12 PolarHBondContact O-N 2.96Å
10S93.3Very high89.5Confident107 Ų10789.9 Ų89.975%0.74850%0.5SS*.Hα-helixtrans-63.2-29.4176.6-64.50000113.2G6 I7 G12G6-S10 WeakPolarHBondContact O-CB 3.39Å; G6-S10 PolarHBondContact O-N 3.11Å; G6-S10 PolarHBondContact O-OG 3.21Å; G6-S10 VanDerWaalsContact O-OG 3.06Å; I7-S10 PolarHBondContact O-N 2.93Å; S10-G12 PolarHBondContact O-N 2.65Å
11L96Very high89.5Confident118 Ų11886 Ų8662%0.61848%0.477SS*.THydrogen-bonded Turntrans-77.3-0.1172.8-68.7172.9000113.3I7 L8 V9 Y13I7-L11 HydrophobicContact CG2-CD1 3.98Å; I7-L11 HydrophobicContact CG2-CG 4.47Å; I7-L11 VanDerWaalsContact O-CG 3.26Å; I7-L11 WeakPolarHBondContact O-CG 3.19Å; I7-L11 PolarHBondContact O-N 3.23Å; L8-L11 PolarHBondContact O-N 3.49Å; V9-L11 PolarHBondContact O-N 3.35Å; L11-Y13 HydrophobicContact CB-CD2 3.74Å; L11-Y13 HydrophobicContact CB-CE2 3.88Å; L11-Y13 HydrophobicContact CD1-CE2 4.36Å
12G94.1Very high89.9Confident60 Ų6085.8 Ų85.862%0.61947%0.474SS*.THydrogen-bonded Turntrans81.615.7176.600000114.3L8 V9 S10 P14L8-G12 PolarHBondContact O-N 3.03Å; V9-G12 WeakPolarHBondContact O-CA 3.39Å; V9-G12 PolarHBondContact O-N 2.96Å; S10-G12 PolarHBondContact O-N 2.65Å; G12-P14 WeakPolarHBondContact O-CD 3.48Å
13Y91.8Very high90.1Very high140 Ų14086.7 Ų86.755%0.54947%0.474SS..  trans-73.9127.4175.1-73.4-89.1000110.4L8 L11 I15L8-Y13 HydrophobicContact CD2-CD2 4.37Å; L8-Y13 WeakPolarHBondContact O-CB 3.36Å; L8-Y13 PolarHBondContact O-N 2.66Å; L8-Y13 VanDerWaalsContact O-N 3.12Å; L11-Y13 HydrophobicContact CB-CD2 3.74Å; L11-Y13 HydrophobicContact CB-CE2 3.88Å; L11-Y13 HydrophobicContact CD1-CE2 4.36Å; Y13-I15 PolarHBondContact O-N 3.43Å
14P87.6Confident90Very high129 Ų12980.8 Ų80.884%0.83845%0.447SS*.  trans-78.872.4176.333.1-34.7000109.7G12G12-P14 WeakPolarHBondContact O-CD 3.48Å
15I88Confident89.9Confident61 Ų6180.8 Ų80.831%0.31344%0.444SS..PPolyproline II helixtrans-96.5120.3-179.4-48.6-171.4000108.8Y5 L8 Y13Y5-I15 HydrophobicContact CE2-CB 4.39Å; Y5-I15 HydrophobicContact CE2-CG2 4.46Å; Y5-I15 PolarHBondContact OH-O 3.41Å; L8-I15 HydrophobicContact CB-CD1 3.64Å; L8-I15 HydrophobicContact CD1-CD1 3.59Å; L8-I15 HydrophobicContact CD2-CD1 4.42Å; L8-I15 HydrophobicContact CG-CD1 4.08Å; Y13-I15 PolarHBondContact O-N 3.43Å
16P88.6Confident89.8Confident111 Ų11185.1 Ų85.172%0.72147%0.466SS*.PPolyproline II helixtrans-60.1143.5172.727-33.7000109.4P18P16-P18 WeakPolarHBondContact O-CD 3.27Å
17K89.3Confident89.5Confident97 Ų9786.7 Ų86.742%0.42248%0.483SS..PPolyproline II helixtrans-64118.9-177.1-164.6171.5-132.9178.30109.7Y5 I21 E25Y5-K17 HydrophobicContact CE1-CG 4.27Å; K17-I21 HydrophobicContact CD-CG2 4.38Å; K17-I21 HydrophobicContact CG-CB 4.18Å; K17-I21 HydrophobicContact CG-CG2 4.03Å; K17-E25 WeakPolarHBondContact CE-OE1 2.98Å; K17-E25 VanDerWaalsContact CE-OE2 3.26Å; K17-E25 WeakPolarHBondContact CE-OE2 3.37Å; K17-E25 IonicContact NZ-OE1 2.66Å; K17-E25 PolarHBondContact NZ-OE1 2.87Å; K17-E25 IonicContact NZ-OE2 2.65Å; K17-E25 PolarHBondContact NZ-OE2 3.02Å
18P87.9Confident88.9Confident54 Ų5487 Ų8735%0.35148%0.482SS..PPolyproline II helixtrans-68.1145.5178-1729.4000111.3Y5 P16 L20 I21 F22Y5-P18 HydrophobicContact CD2-CG 4.45Å; P16-P18 WeakPolarHBondContact O-CD 3.27Å; P18-L20 PolarHBondContact O-N 3.44Å; P18-L20 VanDerWaalsContact O-N 3.12Å; P18-I21 HydrophobicContact CB-CG1 4.14Å; P18-I21 HydrophobicContact CG-CG1 3.87Å; P18-I21 WeakPolarHBondContact O-CA 3.31Å; P18-I21 WeakPolarHBondContact O-CB 3.46Å; P18-I21 PolarHBondContact O-N 3.3Å; P18-F22 PolarHBondContact O-N 3.29Å; P18-F22 VanDerWaalsContact O-N 3.13Å
19D89.1Confident88Confident126 Ų12691.6 Ų91.667%0.67450%0.502SS*.Hα-helixtrans-53.1-34.3173.8-74.3-89.7000113.1I21 F22 R23D19-I21 VanDerWaalsContact C-N 3.31Å; D19-I21 PolarHBondContact O-N 2.95Å; D19-F22 PolarHBondContact O-N 3.16Å; D19-R23 VanDerWaalsContact O-CG 3.31Å; D19-R23 WeakPolarHBondContact O-CG 3.33Å; D19-R23 PolarHBondContact O-N 3.31Å
20L85.8Confident86.8Confident44 Ų4490.2 Ų90.223%0.2349%0.494CS..Hα-helixtrans-60.9-40.1174.9-178.762.5000112.3M1 P18 L24 P30 W31M1-L20 HydrophobicContact CB-CD2 4.4Å; M1-L20 HydrophobicContact CG-CD2 4.05Å; P18-L20 PolarHBondContact O-N 3.44Å; P18-L20 VanDerWaalsContact O-N 3.12Å; L20-L24 HydrophobicContact CG-CD1 4.21Å; L20-L24 VanDerWaalsContact O-CB 3.31Å; L20-L24 WeakPolarHBondContact O-CB 3.48Å; L20-L24 VanDerWaalsContact O-CG 3.23Å; L20-L24 WeakPolarHBondContact O-CG 3.38Å; L20-L24 PolarHBondContact O-N 2.94Å; L20-P30 HydrophobicContact CD1-CB 3.9Å; L20-W31 HydrophobicContact CD2-CZ3 4.38Å
21I89.2Confident85.7Confident7 Ų791.6 Ų91.64%0.03648%0.483CS..Hα-helixtrans-68.8-42.1177.2-60.3-53.1000110M1 Q2 Y5 K17 P18 D19 L24 E25M1-I21 HydrophobicContact CB-CD1 4.32Å; Q2-I21 HydrophobicContact CG-CD1 4.28Å; Q2-I21 HydrophobicContact CG-CG2 4.34Å; Y5-I21 HydrophobicContact CD1-CG1 4.44Å; Y5-I21 HydrophobicContact CD1-CG2 3.92Å; Y5-I21 HydrophobicContact CD2-CG1 4.43Å; Y5-I21 HydrophobicContact CE1-CG2 4.36Å; Y5-I21 HydrophobicContact CG-CD1 4.48Å; Y5-I21 HydrophobicContact CG-CG1 4.02Å; Y5-I21 HydrophobicContact CG-CG2 4.35Å; K17-I21 HydrophobicContact CD-CG2 4.38Å; K17-I21 HydrophobicContact CG-CB 4.18Å; K17-I21 HydrophobicContact CG-CG2 4.03Å; P18-I21 HydrophobicContact CB-CG1 4.14Å; P18-I21 HydrophobicContact CG-CG1 3.87Å; P18-I21 WeakPolarHBondContact O-CA 3.31Å; P18-I21 WeakPolarHBondContact O-CB 3.46Å; P18-I21 PolarHBondContact O-N 3.3Å; D19-I21 VanDerWaalsContact C-N 3.31Å; D19-I21 PolarHBondContact O-N 2.95Å; I21-L24 HydrophobicContact CD1-CD1 4.39Å; I21-L24 WeakPolarHBondContact O-CB 3.23Å; I21-L24 PolarHBondContact O-N 3.06Å; I21-E25 WeakPolarHBondContact O-CG 3.31Å; I21-E25 PolarHBondContact O-N 3.22Å
22F88.6Confident84.2Confident111 Ų11192.1 Ų92.149%0.48749%0.491SS..Hα-helixtrans-58.8-48.3176.5-179.9-102.1000111.8P18 D19 L24 E25 Q26P18-F22 PolarHBondContact O-N 3.29Å; P18-F22 VanDerWaalsContact O-N 3.13Å; D19-F22 PolarHBondContact O-N 3.16Å; F22-L24 PolarHBondContact O-N 2.97Å; F22-E25 PolarHBondContact O-N 3.14Å; F22-Q26 HydrophobicContact CE1-CG 4.42Å; F22-Q26 HydrophobicContact CZ-CG 4.49Å; F22-Q26 WeakPolarHBondContact O-CG 3.26Å; F22-Q26 PolarHBondContact O-N 3.44Å
23R87.7Confident82.7Confident102 Ų10293.2 Ų93.239%0.38549%0.487SS..Hα-helixtrans-63.3-42177.7-68.3-178.5-55.7141.8-10.1112.2D19 E25 Q26 G27 E28D19-R23 VanDerWaalsContact O-CG 3.31Å; D19-R23 WeakPolarHBondContact O-CG 3.33Å; D19-R23 PolarHBondContact O-N 3.31Å; R23-E25 VanDerWaalsContact C-N 3.33Å; R23-E25 PolarHBondContact O-N 3.37Å; R23-Q26 WeakPolarHBondContact O-CB 3.44Å; R23-Q26 PolarHBondContact O-N 3.43Å; R23-Q26 VanDerWaalsContact O-N 3.11Å; R23-G27 PolarHBondContact O-N 3.35Å; R23-E28 HydrophobicContact CB-CB 4.02Å; R23-E28 VanDerWaalsContact CD-OE1 3.27Å; R23-E28 WeakPolarHBondContact CD-OE1 3.49Å; R23-E28 IonicContact CZ-OE1 3.9Å; R23-E28 IonicContact NE-OE1 3.92Å; R23-E28 IonicContact NH1-OE1 3.11Å; R23-E28 PolarHBondContact NH1-OE1 3Å; R23-E28 VanDerWaalsContact NH1-OE1 3.11Å; R23-E28 WeakPolarHBondContact O-CB 3.26Å; R23-E28 PolarHBondContact O-N 3.39Å
24L85.1Confident81.3Confident33 Ų3394.4 Ų94.417%0.17350%0.503CS..Hα-helixtrans-59.7-39173.8-83.1172.4000113.4M1 Q2 L20 I21 F22 Q26 G27 E28 P30M1-L24 HydrophobicContact CB-CD1 3.81Å; Q2-L24 HydrophobicContact CG-CB 4.02Å; Q2-L24 HydrophobicContact CG-CD1 4.19Å; Q2-L24 PolarHBondContact NE2-O 3.27Å; L20-L24 HydrophobicContact CG-CD1 4.21Å; L20-L24 VanDerWaalsContact O-CB 3.31Å; L20-L24 WeakPolarHBondContact O-CB 3.48Å; L20-L24 VanDerWaalsContact O-CG 3.23Å; L20-L24 WeakPolarHBondContact O-CG 3.38Å; L20-L24 PolarHBondContact O-N 2.94Å; I21-L24 HydrophobicContact CD1-CD1 4.39Å; I21-L24 WeakPolarHBondContact O-CB 3.23Å; I21-L24 PolarHBondContact O-N 3.06Å; F22-L24 PolarHBondContact O-N 2.97Å; L24-Q26 VanDerWaalsContact C-N 3.27Å; L24-Q26 PolarHBondContact O-N 3.1Å; L24-G27 PolarHBondContact O-N 3.11Å; L24-G27 VanDerWaalsContact O-N 3.1Å; L24-E28 WeakPolarHBondContact CD2-O 3.14Å; L24-P30 HydrophobicContact CD1-CB 4Å; L24-P30 HydrophobicContact CD2-CB 3.4Å; L24-P30 VanDerWaalsContact CD2-CB 3.4Å; L24-P30 HydrophobicContact CD2-CG 3.57Å; L24-P30 HydrophobicContact CG-CB 3.81Å; L24-P30 HydrophobicContact CG-CG 4.47Å
25E86.6Confident79.8Confident92 Ų9291.6 Ų91.643%0.4349%0.486SS..Hα-helixtrans-68.3-27.9176.5-73.9176.9152.100112.5Q2 K17 I21 F22 R23 G27Q2-E25 VanDerWaalsContact NE2-CG 3.3Å; Q2-E25 VanDerWaalsContact NE2-N 3.12Å; K17-E25 WeakPolarHBondContact CE-OE1 2.98Å; K17-E25 VanDerWaalsContact CE-OE2 3.26Å; K17-E25 WeakPolarHBondContact CE-OE2 3.37Å; K17-E25 IonicContact NZ-OE1 2.66Å; K17-E25 PolarHBondContact NZ-OE1 2.87Å; K17-E25 IonicContact NZ-OE2 2.65Å; K17-E25 PolarHBondContact NZ-OE2 3.02Å; I21-E25 WeakPolarHBondContact O-CG 3.31Å; I21-E25 PolarHBondContact O-N 3.22Å; F22-E25 PolarHBondContact O-N 3.14Å; R23-E25 VanDerWaalsContact C-N 3.33Å; R23-E25 PolarHBondContact O-N 3.37Å; E25-G27 PolarHBondContact O-N 3.47Å
26Q88.1Confident78.4Confident140 Ų14094 Ų9465%0.65451%0.506SS*.THydrogen-bonded Turntrans-77.72.2172.1-60-55.2-71.700112.9F22 R23 L24 E28F22-Q26 HydrophobicContact CE1-CG 4.42Å; F22-Q26 HydrophobicContact CZ-CG 4.49Å; F22-Q26 WeakPolarHBondContact O-CG 3.26Å; F22-Q26 PolarHBondContact O-N 3.44Å; R23-Q26 WeakPolarHBondContact O-CB 3.44Å; R23-Q26 PolarHBondContact O-N 3.43Å; R23-Q26 VanDerWaalsContact O-N 3.11Å; L24-Q26 VanDerWaalsContact C-N 3.27Å; L24-Q26 PolarHBondContact O-N 3.1Å; Q26-E28 VanDerWaalsContact C-N 3.33Å
27G83.7Confident77Confident65 Ų6598.5 Ų98.567%0.6751%0.508SS*.THydrogen-bonded Turntrans8013.5-178.100000113.9R23 L24 E25R23-G27 PolarHBondContact O-N 3.35Å; L24-G27 PolarHBondContact O-N 3.11Å; L24-G27 VanDerWaalsContact O-N 3.1Å; E25-G27 PolarHBondContact O-N 3.47Å
28E82.2Confident75.8Confident96 Ų9699.4 Ų99.445%0.44953%0.525SS..  trans-73.9130.4174.9-154.2178.1105.100109.6R23 L24 Q26R23-E28 HydrophobicContact CB-CB 4.02Å; R23-E28 VanDerWaalsContact CD-OE1 3.27Å; R23-E28 WeakPolarHBondContact CD-OE1 3.49Å; R23-E28 IonicContact CZ-OE1 3.9Å; R23-E28 IonicContact NE-OE1 3.92Å; R23-E28 IonicContact NH1-OE1 3.11Å; R23-E28 PolarHBondContact NH1-OE1 3Å; R23-E28 VanDerWaalsContact NH1-OE1 3.11Å; R23-E28 WeakPolarHBondContact O-CB 3.26Å; R23-E28 PolarHBondContact O-N 3.39Å; L24-E28 WeakPolarHBondContact CD2-O 3.14Å; Q26-E28 VanDerWaalsContact C-N 3.33Å
29E73.4Confident74.6Confident163 Ų163105.6 Ų105.676%0.76255%0.549SS*.  trans-68.1131.5177-78.2-172.785.200110.5W31E29-W31 VanDerWaalsContact C-N 3.32Å; E29-W31 PolarHBondContact O-N 3.29Å
30P66.9Low72.8Confident39 Ų39112.3 Ų112.325%0.25358%0.576SS.*SBendtrans-77.3-18.1-160.829.9-35.3000114.5L20 L24L20-P30 HydrophobicContact CD1-CB 3.9Å; L24-P30 HydrophobicContact CD1-CB 4Å; L24-P30 HydrophobicContact CD2-CB 3.4Å; L24-P30 VanDerWaalsContact CD2-CB 3.4Å; L24-P30 HydrophobicContact CD2-CG 3.57Å; L24-P30 HydrophobicContact CG-CB 3.81Å; L24-P30 HydrophobicContact CG-CG 4.47Å
31W69.6Low72.2Confident136 Ų136115.7 Ų115.752%0.51559%0.593SS.*  trans-168.6129.2169.946.885.8000106.1M1 L20 E29 P33M1-W31 HydrophobicContact CB-CH2 4.47Å; M1-W31 HydrophobicContact CB-CZ3 4.5Å; M1-W31 HydrophobicContact CE-CZ3 4.36Å; M1-W31 HydrophobicContact CG-CH2 3.59Å; M1-W31 HydrophobicContact CG-CZ3 3.59Å; L20-W31 HydrophobicContact CD2-CZ3 4.38Å; E29-W31 VanDerWaalsContact C-N 3.32Å; E29-W31 PolarHBondContact O-N 3.29Å; W31-P33 VanDerWaalsContact O-CD 3.26Å; W31-P33 WeakPolarHBondContact O-CD 3.26Å
32V64.7Low71.3Confident128 Ų128121.4 Ų121.478%0.77662%0.623SS**  trans-70.2113.8147.3-170.80000102.3D34V32-D34 PolarHBondContact O-N 3.39Å
33P62Low70.3Confident84 Ų84122 Ų12255%0.54563%0.63SS.*  trans-57.6120.7166.124.7-26.6000104.5W31 S35W31-P33 VanDerWaalsContact O-CD 3.26Å; W31-P33 WeakPolarHBondContact O-CD 3.26Å; P33-S35 PolarHBondContact O-N 2.97Å
34D62.3Low69.3Low164 Ų164123.2 Ų123.288%0.87765%0.645SS**  trans-61.379156.1-109.1-70.9000104.9V32 P36V32-D34 PolarHBondContact O-N 3.39Å; D34-P36 WeakPolarHBondContact O-CD 3.48Å
35S56.8Low68.3Low70 Ų70128.8 Ų128.849%0.4967%0.674SS.*  trans-75.6104.2161.3164.90000102.5P33 R37P33-S35 PolarHBondContact O-N 2.97Å; S35-R37 PolarHBondContact O-N 3.24Å; S35-R37 PolarHBondContact OG-N 2.66Å
36P58.6Low67.1Low112 Ų112131.3 Ų131.373%0.72769%0.69SS**  trans-56.6109.6136.628.5-27.1000103D34 P38D34-P36 WeakPolarHBondContact O-CD 3.48Å; P36-P38 VanDerWaalsContact O-N 3.12Å
37R59.1Low65.6Low205 Ų205130.6 Ų130.677%0.77469%0.693SS**  trans-38.8128.2163.8-72175.8174.8168.1-2.2105.8S35 E39S35-R37 PolarHBondContact O-N 3.24Å; S35-R37 PolarHBondContact OG-N 2.66Å; R37-E39 PolarHBondContact O-N 2.94Å
38P63.5Low64.2Low117 Ų117135.7 Ų135.776%0.7670%0.695SS**  trans-59.6106.7152.8-1.817.4000103.5P36 E40P36-P38 VanDerWaalsContact O-N 3.12Å; P38-E40 PolarHBondContact O-N 2.87Å
39E64Low62.7Low184 Ų184139 Ų13986%0.8672%0.715SS**  trans-60.391.9156.5-78.2161123.500105.9R37R37-E39 PolarHBondContact O-N 2.94Å
40E51.7Low61.7Low266 Ų266136.8 Ų136.8100%1.24371%0.711SS**  trans-176.10145.8-110.6173.967.800112.1P38P38-E40 PolarHBondContact O-N 2.87Å

Retrieved 40 of 40 residues in 146.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).