A0A087WZ93_HUMAN Loading...

Signal peptide peptidase like 2B

AlphaFold DB , UniProt , Accession A0A087WZ93, Species HUMAN (Homo sapiens, Human), Gene SPPL2B, Length 139 aa.

						>A0A087WZ93_HUMAN|A0A087WZ93|SPPL2B
MAAAVAAALARLLAAFLLLAAQVACEYGMVHVVSQAGGPEGKDYCILYNPQWAHLPHDLSKASFLQLRNWTASLLCSAADLPARGFSNQIPLVARGNCTFYEKVRLAQGSGARGLLIVSRERLLQRHAGHLHGSVSAAR
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	60.6	Low	78.3	Confident	211 Å²	211	93.6 Å²	93.6	100%	1.039	59%	0.587	S	S	*	*				0	-54.3	0	-94.6	159.8	-107.7	0	0	113	A3 A4 V5	M1-A3 PolarHBondContact O-N 3.21Å; M1-A4 PolarHBondContact O-N 3.25Å; M1-V5 WeakPolarHBondContact O-CG2 3.25Å; M1-V5 PolarHBondContact O-N 3.32Å
2	A	68.3	Low	79.3	Confident	83 Å²	83	95.7 Å²	95.7	69%	0.686	59%	0.589	S	S	*	*	H	α-helix	trans	-55.2	-42.4	-177.5	0	0	0	0	0	115.4	A4 V5 A6	A2-A4 VanDerWaalsContact C-N 3.34Å; A2-A4 PolarHBondContact O-N 2.71Å; A2-V5 PolarHBondContact O-N 3.06Å; A2-A6 PolarHBondContact O-N 3.28Å
3	A	71.6	Confident	80.1	Confident	83 Å²	83	96.5 Å²	96.5	69%	0.686	59%	0.587	S	S	*	*	H	α-helix	trans	-64.7	-34.3	179.8	0	0	0	0	0	113.7	M1 A7	M1-A3 PolarHBondContact O-N 3.21Å; A3-A7 WeakPolarHBondContact O-CB 3.29Å; A3-A7 PolarHBondContact O-N 3.26Å; A3-A7 VanDerWaalsContact O-N 3.12Å
4	A	74.4	Confident	80.4	Confident	69 Å²	69	93 Å²	93	57%	0.57	57%	0.573	S	S	*	*	H	α-helix	trans	-71.5	-36.4	178	0	0	0	0	0	111.8	M1 A2 A7 A8	M1-A4 PolarHBondContact O-N 3.25Å; A2-A4 VanDerWaalsContact C-N 3.34Å; A2-A4 PolarHBondContact O-N 2.71Å; A4-A7 PolarHBondContact O-N 3.44Å; A4-A8 WeakPolarHBondContact O-CB 3.39Å; A4-A8 PolarHBondContact O-N 3.38Å
5	V	78.1	Confident	80.6	Confident	86 Å²	86	89.9 Å²	89.9	52%	0.521	56%	0.56	S	S	.	*	H	α-helix	trans	-68.2	-42.7	176.4	-179	0	0	0	0	110.9	M1 A2 A7 A8 L9	M1-V5 WeakPolarHBondContact O-CG2 3.25Å; M1-V5 PolarHBondContact O-N 3.32Å; A2-V5 PolarHBondContact O-N 3.06Å; V5-A7 PolarHBondContact O-N 3.31Å; V5-A8 PolarHBondContact O-N 2.69Å; V5-L9 HydrophobicContact CG1-CD1 4.09Å; V5-L9 WeakPolarHBondContact O-CG 3.48Å; V5-L9 PolarHBondContact O-N 2.89Å
6	A	80.8	Confident	80.6	Confident	59 Å²	59	93.3 Å²	93.3	49%	0.488	57%	0.565	S	S	.	*	H	α-helix	trans	-61.6	-42.4	175.5	0	0	0	0	0	112.2	A2 L9 A10	A2-A6 PolarHBondContact O-N 3.28Å; A6-L9 PolarHBondContact O-N 3.4Å; A6-A10 WeakPolarHBondContact O-CB 3.47Å; A6-A10 PolarHBondContact O-N 3.03Å
7	A	80.8	Confident	80.5	Confident	42 Å²	42	94.5 Å²	94.5	35%	0.347	57%	0.567	S	S	.	*	H	α-helix	trans	-65.7	-37.3	176.1	0	0	0	0	0	112.7	A3 A4 V5 R11	A3-A7 WeakPolarHBondContact O-CB 3.29Å; A3-A7 PolarHBondContact O-N 3.26Å; A3-A7 VanDerWaalsContact O-N 3.12Å; A4-A7 PolarHBondContact O-N 3.44Å; V5-A7 PolarHBondContact O-N 3.31Å; A7-R11 VanDerWaalsContact O-CG 3.3Å; A7-R11 WeakPolarHBondContact O-CG 3.39Å; A7-R11 PolarHBondContact O-N 3.15Å; A7-R11 VanDerWaalsContact O-N 3.09Å
8	A	84.6	Confident	80.1	Confident	47 Å²	47	96 Å²	96	39%	0.388	57%	0.57	S	S	.	*	H	α-helix	trans	-66.4	-44	175.7	0	0	0	0	0	111.9	A4 V5 R11 L12	A4-A8 WeakPolarHBondContact O-CB 3.39Å; A4-A8 PolarHBondContact O-N 3.38Å; V5-A8 PolarHBondContact O-N 2.69Å; A8-R11 PolarHBondContact O-N 2.81Å; A8-L12 WeakPolarHBondContact O-CG 3.39Å; A8-L12 PolarHBondContact O-N 2.84Å
9	L	86.4	Confident	79.4	Confident	99 Å²	99	97.7 Å²	97.7	52%	0.518	58%	0.576	S	S	.	*	H	α-helix	trans	-62.6	-42.8	175.6	-76.5	164.6	0	0	0	112.1	V5 A6 R11 L12 L13	V5-L9 HydrophobicContact CG1-CD1 4.09Å; V5-L9 WeakPolarHBondContact O-CG 3.48Å; V5-L9 PolarHBondContact O-N 2.89Å; A6-L9 PolarHBondContact O-N 3.4Å; L9-R11 VanDerWaalsContact C-N 3.33Å; L9-R11 PolarHBondContact O-N 3.48Å; L9-L12 PolarHBondContact O-N 3.27Å; L9-L13 WeakPolarHBondContact O-CB 3.2Å; L9-L13 PolarHBondContact O-N 3.07Å
10	A	87.8	Confident	78.6	Confident	58 Å²	58	96.7 Å²	96.7	48%	0.479	58%	0.579	S	S	.	*	H	α-helix	trans	-62.3	-40.2	176.7	0	0	0	0	0	112.1	A6 A14	A6-A10 WeakPolarHBondContact O-CB 3.47Å; A6-A10 PolarHBondContact O-N 3.03Å; A10-A14 VanDerWaalsContact O-CB 3.32Å; A10-A14 WeakPolarHBondContact O-CB 3.17Å; A10-A14 PolarHBondContact O-N 2.88Å
11	R	88.6	Confident	77.6	Confident	193 Å²	193	95.7 Å²	95.7	73%	0.728	58%	0.581	S	S	*	*	H	α-helix	trans	-66.2	-40.9	175.4	-73.7	171.7	180	165.1	0.5	112.4	A7 A8 L9 A14 A15	A7-R11 VanDerWaalsContact O-CG 3.3Å; A7-R11 WeakPolarHBondContact O-CG 3.39Å; A7-R11 PolarHBondContact O-N 3.15Å; A7-R11 VanDerWaalsContact O-N 3.09Å; A8-R11 PolarHBondContact O-N 2.81Å; L9-R11 VanDerWaalsContact C-N 3.33Å; L9-R11 PolarHBondContact O-N 3.48Å; R11-A14 PolarHBondContact O-N 2.87Å; R11-A15 WeakPolarHBondContact O-CB 3.43Å; R11-A15 PolarHBondContact O-N 2.84Å
12	L	89.8	Confident	77.4	Confident	118 Å²	118	92.4 Å²	92.4	62%	0.618	56%	0.563	S	S	*	*	H	α-helix	trans	-65.3	-43.2	176.2	-75.6	164.3	0	0	0	111.7	A8 L9 A15 F16	A8-L12 WeakPolarHBondContact O-CG 3.39Å; A8-L12 PolarHBondContact O-N 2.84Å; L9-L12 PolarHBondContact O-N 3.27Å; L12-A15 PolarHBondContact O-N 2.84Å; L12-F16 WeakPolarHBondContact O-CB 3.33Å; L12-F16 PolarHBondContact O-N 3.34Å
13	L	89.1	Confident	76.7	Confident	106 Å²	106	93.5 Å²	93.5	56%	0.555	56%	0.561	S	S	*	*	H	α-helix	trans	-62.4	-45.1	174.1	-91	158	0	0	0	111.9	L9 A15 F16 L17	L9-L13 WeakPolarHBondContact O-CB 3.2Å; L9-L13 PolarHBondContact O-N 3.07Å; L13-A15 VanDerWaalsContact C-N 3.35Å; L13-A15 PolarHBondContact O-N 2.69Å; L13-F16 PolarHBondContact O-N 2.91Å; L13-L17 WeakPolarHBondContact O-CB 3.25Å; L13-L17 VanDerWaalsContact O-CG 3.31Å; L13-L17 WeakPolarHBondContact O-CG 3.3Å; L13-L17 PolarHBondContact O-N 2.86Å
14	A	84.8	Confident	76	Confident	48 Å²	48	91.6 Å²	91.6	40%	0.397	55%	0.545	S	S	.	.	H	α-helix	trans	-61.8	-42.7	176.1	0	0	0	0	0	111.8	A10 R11 L17 L18	A10-A14 VanDerWaalsContact O-CB 3.32Å; A10-A14 WeakPolarHBondContact O-CB 3.17Å; A10-A14 PolarHBondContact O-N 2.88Å; R11-A14 PolarHBondContact O-N 2.87Å; A14-L17 PolarHBondContact O-N 3.08Å; A14-L18 WeakPolarHBondContact O-CB 3.15Å; A14-L18 WeakPolarHBondContact O-CD1 3.39Å; A14-L18 VanDerWaalsContact O-CG 3.3Å; A14-L18 WeakPolarHBondContact O-CG 3.4Å; A14-L18 PolarHBondContact O-N 3.14Å
15	A	83.1	Confident	75.2	Confident	46 Å²	46	90.3 Å²	90.3	38%	0.38	53%	0.532	S	S	.	.	H	α-helix	trans	-63.9	-41.8	175.8	0	0	0	0	0	112.2	R11 L12 L13 L18 L19	R11-A15 WeakPolarHBondContact O-CB 3.43Å; R11-A15 PolarHBondContact O-N 2.84Å; L12-A15 PolarHBondContact O-N 2.84Å; L13-A15 VanDerWaalsContact C-N 3.35Å; L13-A15 PolarHBondContact O-N 2.69Å; A15-L18 PolarHBondContact O-N 2.99Å; A15-L19 VanDerWaalsContact O-CD1 3.3Å; A15-L19 WeakPolarHBondContact O-CD1 3.15Å; A15-L19 PolarHBondContact O-N 2.99Å
16	F	81.4	Confident	74.8	Confident	144 Å²	144	90.8 Å²	90.8	63%	0.632	53%	0.528	S	S	*	.	H	α-helix	trans	-63.9	-43.4	176.8	-175.8	-103.5	0	0	0	112.1	L12 L13 L18 L19 A20	L12-F16 WeakPolarHBondContact O-CB 3.33Å; L12-F16 PolarHBondContact O-N 3.34Å; L13-F16 PolarHBondContact O-N 2.91Å; F16-L18 VanDerWaalsContact C-N 3.34Å; F16-L18 PolarHBondContact O-N 3.12Å; F16-L19 PolarHBondContact O-N 3.04Å; F16-A20 WeakPolarHBondContact O-CB 3.5Å; F16-A20 PolarHBondContact O-N 2.95Å
17	L	78.3	Confident	74.8	Confident	115 Å²	115	93.9 Å²	93.9	60%	0.602	53%	0.528	S	S	*	.	H	α-helix	trans	-63.5	-38.6	175	-71	170.1	0	0	0	112.1	L13 A14 A20 A21	L13-L17 WeakPolarHBondContact O-CB 3.25Å; L13-L17 VanDerWaalsContact O-CG 3.31Å; L13-L17 WeakPolarHBondContact O-CG 3.3Å; L13-L17 PolarHBondContact O-N 2.86Å; A14-L17 PolarHBondContact O-N 3.08Å; L17-A20 PolarHBondContact O-N 2.83Å; L17-A21 PolarHBondContact O-N 3.19Å
18	L	73.2	Confident	74.9	Confident	121 Å²	121	92.5 Å²	92.5	63%	0.634	52%	0.519	S	S	*	.	H	α-helix	trans	-66.9	-36.7	175.6	-77.6	163.4	0	0	0	112.6	A14 A15 F16	A14-L18 WeakPolarHBondContact O-CB 3.15Å; A14-L18 WeakPolarHBondContact O-CD1 3.39Å; A14-L18 VanDerWaalsContact O-CG 3.3Å; A14-L18 WeakPolarHBondContact O-CG 3.4Å; A14-L18 PolarHBondContact O-N 3.14Å; A15-L18 PolarHBondContact O-N 2.99Å; F16-L18 VanDerWaalsContact C-N 3.34Å; F16-L18 PolarHBondContact O-N 3.12Å
19	L	67	Low	74.9	Confident	129 Å²	129	94.9 Å²	94.9	68%	0.675	52%	0.523	S	S	*	.	H	α-helix	trans	-70.2	-38.2	173.9	-98.2	82.6	0	0	0	112.2	A15 F16 A21 Q22	A15-L19 VanDerWaalsContact O-CD1 3.3Å; A15-L19 WeakPolarHBondContact O-CD1 3.15Å; A15-L19 PolarHBondContact O-N 2.99Å; F16-L19 PolarHBondContact O-N 3.04Å; L19-A21 VanDerWaalsContact C-N 3.26Å; L19-A21 PolarHBondContact O-N 3.23Å; L19-Q22 WeakPolarHBondContact O-CG 3.18Å; L19-Q22 PolarHBondContact O-N 2.85Å
20	A	62.6	Low	75	Confident	76 Å²	76	91.7 Å²	91.7	63%	0.628	51%	0.507	S	S	*	.	H	α-helix	trans	-69.4	-23.1	179.3	0	0	0	0	0	113.4	F16 L17 Q22	F16-A20 WeakPolarHBondContact O-CB 3.5Å; F16-A20 PolarHBondContact O-N 2.95Å; L17-A20 PolarHBondContact O-N 2.83Å; A20-Q22 VanDerWaalsContact C-N 3.32Å
21	A	59.2	Low	75	Confident	76 Å²	76	91.9 Å²	91.9	63%	0.628	50%	0.498	S	S	*	.	T	Hydrogen-bonded Turn	trans	-86	4.8	179	0	0	0	0	0	114.3	L17 L19 V23	L17-A21 PolarHBondContact O-N 3.19Å; L19-A21 VanDerWaalsContact C-N 3.26Å; L19-A21 PolarHBondContact O-N 3.23Å; A21-V23 PolarHBondContact O-N 2.85Å
22	Q	56	Low	75	Confident	143 Å²	143	84.7 Å²	84.7	67%	0.668	48%	0.475	S	S	*	.			trans	-69.5	114.3	179.1	-62.6	-75.7	-11.7	0	0	109.9	L19 A20 A24	L19-Q22 WeakPolarHBondContact O-CG 3.18Å; L19-Q22 PolarHBondContact O-N 2.85Å; A20-Q22 VanDerWaalsContact C-N 3.32Å; Q22-A24 PolarHBondContact O-N 2.87Å
23	V	54	Low	74.9	Confident	105 Å²	105	82.5 Å²	82.5	64%	0.636	47%	0.467	S	S	*	.			trans	-77.3	111.4	167.9	-179.6	0	0	0	0	107.3	A21 C25	A21-V23 PolarHBondContact O-N 2.85Å; V23-C25 PolarHBondContact O-N 2.88Å
24	A	56.2	Low	74.8	Confident	43 Å²	43	81 Å²	81	36%	0.355	47%	0.465	S	S	.	.			trans	-65.4	106.6	169.5	0	0	0	0	0	108.4	Q22 N49 P50	Q22-A24 PolarHBondContact O-N 2.87Å; A24-N49 PolarHBondContact O-OD1 3.47Å; A24-P50 HydrophobicContact CB-CG 4.26Å
25	C	57.6	Low	74.6	Confident	43 Å²	43	86.5 Å²	86.5	29%	0.291	48%	0.483	S	S	.	.			trans	-106.2	120.3	164.5	-164.6	0	0	0	0	107.5	V23 Q125	V23-C25 PolarHBondContact O-N 2.88Å; C25-Q125 VanDerWaalsContact SG-CD 3.55Å; C25-Q125 PolarHBondContact SG-NE2 2.97Å; C25-Q125 PolarHBondContact SG-OE1 2.99Å
26	E	70.5	Confident	74.4	Confident	96 Å²	96	88.8 Å²	88.8	45%	0.449	50%	0.502	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.4	160.7	172.5	-73.6	-172.3	176.2	0	0	110.3	Y48 P50	E26-Y48 HydrophobicContact CB-CD1 4.15Å; E26-Y48 HydrophobicContact CB-CE1 3.47Å; E26-Y48 VanDerWaalsContact CB-CE1 3.47Å; E26-Y48 PolarHBondContact N-O 3.38Å; E26-Y48 WeakPolarHBondContact O-CD1 3.08Å; E26-Y48 PolarHBondContact O-N 2.92Å; E26-Y48 PolarHBondContact OE2-OH 3.05Å; E26-P50 HydrophobicContact CB-CG 4.35Å; E26-P50 HydrophobicContact CG-CG 3.89Å
27	Y	80.8	Confident	73.8	Confident	123 Å²	123	85 Å²	85	48%	0.482	50%	0.503	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.7	131.2	175.1	-67.6	-84.3	0	0	0	109.8	I46 L47 Y48 A128 L131	Y27-I46 CarbonylContact C-O 3.44Å; Y27-I46 WeakPolarHBondContact CA-O 3.15Å; Y27-L47 HydrophobicContact CD1-CD2 3.73Å; Y27-L47 HydrophobicContact CE1-CD2 3.34Å; Y27-L47 HydrophobicContact CE1-CG 4.33Å; Y27-Y48 WeakPolarHBondContact O-CE1 3.45Å; Y27-A128 WeakPolarHBondContact OH-CB 3.33Å; Y27-L131 HydrophobicContact CE1-CD1 3.81Å
28	G	82.6	Confident	73.1	Confident	14 Å²	14	82 Å²	82	14%	0.144	50%	0.501	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.9	174.6	170.2	0	0	0	0	0	110.9	C45 I46	G28-C45 WeakPolarHBondContact O-CA 3.33Å; G28-I46 VanDerWaalsContact C-CG1 3.44Å; G28-I46 PolarHBondContact N-O 3.33Å; G28-I46 WeakPolarHBondContact O-CG1 3.49Å; G28-I46 PolarHBondContact O-N 2.62Å
29	M	84.9	Confident	72.8	Confident	96 Å²	96	82.4 Å²	82.4	47%	0.473	51%	0.51	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.6	139.7	173.7	-174.7	178.5	-81.4	0	0	110.1	D43 Y44 L59	M29-D43 HydrophobicContact CE-CB 4.33Å; M29-D43 HydrophobicContact CG-CB 4.16Å; M29-D43 HydrophobicContact SD-CB 3.99Å; M29-Y44 CarbonylContact C-O 3.49Å; M29-Y44 WeakPolarHBondContact CA-O 3.44Å; M29-L59 HydrophobicContact CG-CD2 4.5Å; M29-L59 HydrophobicContact SD-CD1 3.91Å
30	V	87.1	Confident	73.4	Confident	33 Å²	33	84.7 Å²	84.7	20%	0.2	52%	0.517	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.2	121.2	171.3	174.4	0	0	0	0	108.4	V32 D43 Y44 I46 L116	V30-V32 HydrophobicContact CG1-CG2 3.89Å; V30-D43 CarbonylContact O-C 3.57Å; V30-D43 WeakPolarHBondContact O-CA 3.15Å; V30-Y44 PolarHBondContact N-O 3.19Å; V30-Y44 PolarHBondContact O-N 3.01Å; V30-I46 HydrophobicContact CB-CG2 4.15Å; V30-I46 HydrophobicContact CG2-CB 4.43Å; V30-I46 HydrophobicContact CG2-CD1 3.68Å; V30-I46 HydrophobicContact CG2-CG1 4.1Å; V30-I46 HydrophobicContact CG2-CG2 3.51Å; V30-L116 HydrophobicContact CG2-CD2 4.47Å
31	H	88.6	Confident	74.3	Confident	62 Å²	62	82 Å²	82	29%	0.287	50%	0.497	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-93.2	118.9	172.5	-173.6	75.7	0	0	0	109.9	V33 D43 L59	H31-V33 VanDerWaalsContact CD2-CG1 3.47Å; H31-V33 WeakPolarHBondContact CD2-CG1 3.48Å; H31-V33 WeakPolarHBondContact NE2-CG1 3.32Å; H31-D43 WeakPolarHBondContact CB-OD1 3.29Å; H31-D43 IonicContact CE1-OD1 3.84Å; H31-D43 IonicContact CG-OD1 3.4Å; H31-D43 IonicContact ND1-OD1 2.69Å; H31-D43 PolarHBondContact ND1-OD1 3.5Å; H31-L59 HydrophobicContact CB-CD2 4.43Å
32	V	88.5	Confident	75.6	Confident	41 Å²	41	84.2 Å²	84.2	25%	0.248	49%	0.492	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.7	122	-179.1	-177.4	0	0	0	0	109.9	V30 G41 K42 Y44 L67	V30-V32 HydrophobicContact CG1-CG2 3.89Å; V32-G41 CarbonylContact O-C 3.53Å; V32-G41 WeakPolarHBondContact O-CA 3.26Å; V32-K42 PolarHBondContact N-O 3.11Å; V32-K42 PolarHBondContact O-N 2.89Å; V32-Y44 HydrophobicContact CB-CD2 4.37Å; V32-Y44 HydrophobicContact CB-CE2 4.01Å; V32-Y44 HydrophobicContact CG2-CD2 3.72Å; V32-Y44 HydrophobicContact CG2-CE2 3.75Å; V32-L67 HydrophobicContact CG1-CD2 3.91Å; V32-L67 HydrophobicContact CG2-CD2 4.33Å
33	V	87.9	Confident	77.1	Confident	72 Å²	72	81.5 Å²	81.5	44%	0.436	48%	0.482	S	S	.	.			trans	-110.8	147	176.8	-64.1	0	0	0	0	110.9	H31 F64	H31-V33 VanDerWaalsContact CD2-CG1 3.47Å; H31-V33 WeakPolarHBondContact CD2-CG1 3.48Å; H31-V33 WeakPolarHBondContact NE2-CG1 3.32Å; V33-F64 HydrophobicContact CG1-CE1 4.08Å; V33-F64 HydrophobicContact CG2-CD1 4.02Å; V33-F64 HydrophobicContact CG2-CE1 3.78Å
34	S	86.4	Confident	78.5	Confident	74 Å²	74	81.9 Å²	81.9	52%	0.517	47%	0.473	S	S	.	.			trans	-74.6	132.6	172.7	177.9	0	0	0	0	110.4	A36 G37	S34-A36 PolarHBondContact O-N 2.88Å; S34-A36 PolarHBondContact OG-N 3.09Å; S34-G37 PolarHBondContact O-N 3.13Å
35	Q	81.6	Confident	79.8	Confident	164 Å²	164	83.1 Å²	83.1	77%	0.766	48%	0.479	S	S	*	.	T	Hydrogen-bonded Turn	trans	-64.7	-29.6	173.7	-174.4	175.2	6.9	0	0	112.6	G37	Q35-G37 PolarHBondContact O-N 2.98Å
36	A	77.9	Confident	81	Confident	95 Å²	95	81.2 Å²	81.2	79%	0.785	47%	0.466	S	S	*	.	T	Hydrogen-bonded Turn	trans	-78.3	-3.9	-175.6	0	0	0	0	0	113.9	S34	S34-A36 PolarHBondContact O-N 2.88Å; S34-A36 PolarHBondContact OG-N 3.09Å
37	G	68.4	Low	81.4	Confident	63 Å²	63	77 Å²	77	65%	0.649	45%	0.446	S	S	*	.			trans	72.6	123.4	-167.9	0	0	0	0	0	110.6	S34 Q35	S34-G37 PolarHBondContact O-N 3.13Å; Q35-G37 PolarHBondContact O-N 2.98Å
38	G	65.1	Low	81.2	Confident	54 Å²	54	72.3 Å²	72.3	56%	0.557	43%	0.428	S	S	*	.			trans	-165.7	-175.8	-176.8	0	0	0	0	0	110.3
39	P	66.9	Low	80.7	Confident	128 Å²	128	72.2 Å²	72.2	83%	0.831	42%	0.424	S	S	*	.	S	Bend	trans	-55.1	163.4	177.3	25.5	-34	0	0	0	111.5
40	E	78.4	Confident	80.2	Confident	177 Å²	177	68.7 Å²	68.7	83%	0.827	41%	0.408	S	S	*	.	S	Bend	trans	-37.3	138.3	-178.9	-118.4	-170.8	167.3	0	0	112.9
41	G	82.4	Confident	79.4	Confident	20 Å²	20	74.2 Å²	74.2	21%	0.206	43%	0.432	C	S	.	.			trans	-55.8	172.7	-178.7	0	0	0	0	0	113.5	V32	V32-G41 CarbonylContact O-C 3.53Å; V32-G41 WeakPolarHBondContact O-CA 3.26Å
42	K	86.3	Confident	78.5	Confident	122 Å²	122	78.2 Å²	78.2	53%	0.53	44%	0.444	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.5	127.5	-178.9	-69	-81.6	166.5	-78	0	109.6	V32 Y44	V32-K42 PolarHBondContact N-O 3.11Å; V32-K42 PolarHBondContact O-N 2.89Å; K42-Y44 HydrophobicContact CB-CD2 4.37Å; K42-Y44 HydrophobicContact CB-CE2 3.53Å; K42-Y44 WeakPolarHBondContact O-CD2 3.36Å
43	D	86.2	Confident	77.8	Confident	86 Å²	86	76.5 Å²	76.5	46%	0.46	44%	0.435	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.5	133.8	173	-63.7	-41.7	0	0	0	110.9	M29 V30 H31	M29-D43 HydrophobicContact CE-CB 4.33Å; M29-D43 HydrophobicContact CG-CB 4.16Å; M29-D43 HydrophobicContact SD-CB 3.99Å; V30-D43 CarbonylContact O-C 3.57Å; V30-D43 WeakPolarHBondContact O-CA 3.15Å; H31-D43 WeakPolarHBondContact CB-OD1 3.29Å; H31-D43 IonicContact CE1-OD1 3.84Å; H31-D43 IonicContact CG-OD1 3.4Å; H31-D43 IonicContact ND1-OD1 2.69Å; H31-D43 PolarHBondContact ND1-OD1 3.5Å
44	Y	83.6	Confident	77.4	Confident	114 Å²	114	80.9 Å²	80.9	45%	0.447	45%	0.45	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.9	132.5	176.8	-63.2	-87.5	0	0	0	109.9	M29 V30 V32 K42	M29-Y44 CarbonylContact C-O 3.49Å; M29-Y44 WeakPolarHBondContact CA-O 3.44Å; V30-Y44 PolarHBondContact N-O 3.19Å; V30-Y44 PolarHBondContact O-N 3.01Å; V32-Y44 HydrophobicContact CB-CD2 4.37Å; V32-Y44 HydrophobicContact CB-CE2 4.01Å; V32-Y44 HydrophobicContact CG2-CD2 3.72Å; V32-Y44 HydrophobicContact CG2-CE2 3.75Å; K42-Y44 HydrophobicContact CB-CD2 4.37Å; K42-Y44 HydrophobicContact CB-CE2 3.53Å; K42-Y44 WeakPolarHBondContact O-CD2 3.36Å
45	C	83.3	Confident	77.2	Confident	69 Å²	69	80.1 Å²	80.1	47%	0.466	44%	0.44	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-74.9	132.9	167.9	-65.8	0	0	0	0	109.7	G28	G28-C45 WeakPolarHBondContact O-CA 3.33Å
46	I	82.8	Confident	77.4	Confident	3 Å²	3	75.3 Å²	75.3	2%	0.015	42%	0.423	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.6	149.7	177.7	62.4	161.4	0	0	0	111	Y27 G28 V30 L55 V135 A137	Y27-I46 CarbonylContact C-O 3.44Å; Y27-I46 WeakPolarHBondContact CA-O 3.15Å; G28-I46 VanDerWaalsContact C-CG1 3.44Å; G28-I46 PolarHBondContact N-O 3.33Å; G28-I46 WeakPolarHBondContact O-CG1 3.49Å; G28-I46 PolarHBondContact O-N 2.62Å; V30-I46 HydrophobicContact CB-CG2 4.15Å; V30-I46 HydrophobicContact CG2-CB 4.43Å; V30-I46 HydrophobicContact CG2-CD1 3.68Å; V30-I46 HydrophobicContact CG2-CG1 4.1Å; V30-I46 HydrophobicContact CG2-CG2 3.51Å; I46-L55 HydrophobicContact CD1-CD1 3.93Å; I46-V135 CarbonylContact C-O 3.55Å; I46-V135 WeakPolarHBondContact CA-O 3.43Å; I46-V135 VanDerWaalsContact CB-O 3.23Å; I46-V135 WeakPolarHBondContact CB-O 3.23Å; I46-V135 HydrophobicContact CG2-CB 3.93Å; I46-V135 HydrophobicContact CG2-CG1 4.11Å; I46-A137 HydrophobicContact CD1-CB 3.58Å
47	L	78.9	Confident	77.7	Confident	6 Å²	6	79.7 Å²	79.7	3%	0.031	43%	0.427	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.9	117.5	171.4	-70.6	163.3	0	0	0	107.8	Y27 L123 V135 S136 A137	Y27-L47 HydrophobicContact CD1-CD2 3.73Å; Y27-L47 HydrophobicContact CE1-CD2 3.34Å; Y27-L47 HydrophobicContact CE1-CG 4.33Å; L47-L123 HydrophobicContact CD1-CB 4.32Å; L47-V135 PolarHBondContact N-O 2.97Å; L47-S136 WeakPolarHBondContact O-CA 3.3Å; L47-S136 WeakPolarHBondContact O-CB 3.3Å; L47-S136 PolarHBondContact O-OG 3.26Å; L47-A137 PolarHBondContact O-N 3.3Å
48	Y	77.4	Confident	78.4	Confident	26 Å²	26	80.2 Å²	80.2	10%	0.102	41%	0.414	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.7	157.3	-177.8	84.1	-71.4	0	0	0	111	E26 Y27 P50 A53 L55	E26-Y48 HydrophobicContact CB-CD1 4.15Å; E26-Y48 HydrophobicContact CB-CE1 3.47Å; E26-Y48 VanDerWaalsContact CB-CE1 3.47Å; E26-Y48 PolarHBondContact N-O 3.38Å; E26-Y48 WeakPolarHBondContact O-CD1 3.08Å; E26-Y48 PolarHBondContact O-N 2.92Å; E26-Y48 PolarHBondContact OE2-OH 3.05Å; Y27-Y48 WeakPolarHBondContact O-CE1 3.45Å; Y48-P50 HydrophobicContact CE2-CB 3.88Å; Y48-A53 WeakPolarHBondContact CE2-O 3.35Å; Y48-L55 HydrophobicContact CD1-CD1 3.83Å; Y48-L55 HydrophobicContact CD2-CD1 3.68Å; Y48-L55 HydrophobicContact CD2-CG 3.94Å; Y48-L55 HydrophobicContact CE1-CD1 3.97Å; Y48-L55 HydrophobicContact CE2-CB 4.33Å; Y48-L55 HydrophobicContact CE2-CD1 3.78Å; Y48-L55 HydrophobicContact CE2-CG 3.82Å; Y48-L55 HydrophobicContact CG-CD1 3.71Å; Y48-L55 HydrophobicContact CG-CG 4.46Å
49	N	72.6	Confident	79.2	Confident	11 Å²	11	81.6 Å²	81.6	6%	0.059	41%	0.409	C	S	.	.			trans	-98.5	115.4	171	-175	-19.5	0	0	0	108.6	A24 Q51 W52 A53	A24-N49 PolarHBondContact O-OD1 3.47Å; N49-Q51 PolarHBondContact O-N 3.23Å; N49-Q51 VanDerWaalsContact OD1-CB 3.28Å; N49-Q51 WeakPolarHBondContact OD1-CB 3.25Å; N49-Q51 PolarHBondContact OD1-N 2.86Å; N49-W52 HydrophobicContact CB-CB 4.3Å; N49-W52 HydrophobicContact CB-CD2 3.72Å; N49-W52 HydrophobicContact CB-CE3 3.64Å; N49-W52 HydrophobicContact CB-CG 4.02Å; N49-W52 HydrophobicContact CB-CZ3 4.21Å; N49-W52 VanDerWaalsContact ND2-CE2 3.32Å; N49-W52 PolarHBondContact O-N 2.94Å; N49-A53 PolarHBondContact O-N 3.31Å; N49-A53 VanDerWaalsContact O-N 3.14Å
50	P	74.1	Confident	79.9	Confident	22 Å²	22	80.8 Å²	80.8	14%	0.143	41%	0.406	C	S	.	.	T	Hydrogen-bonded Turn	trans	-64.5	-20	180	28.5	-36.7	0	0	0	113.2	A24 E26 Y48 W52	A24-P50 HydrophobicContact CB-CG 4.26Å; E26-P50 HydrophobicContact CB-CG 4.35Å; E26-P50 HydrophobicContact CG-CG 3.89Å; Y48-P50 HydrophobicContact CE2-CB 3.88Å; P50-W52 VanDerWaalsContact C-N 3.29Å
51	Q	70.6	Confident	80.3	Confident	150 Å²	150	79.1 Å²	79.1	70%	0.701	40%	0.396	S	S	*	.	T	Hydrogen-bonded Turn	trans	-73.7	-19.7	173.2	-56.6	-168.1	-71.1	0	0	113.1	N49	N49-Q51 PolarHBondContact O-N 3.23Å; N49-Q51 VanDerWaalsContact OD1-CB 3.28Å; N49-Q51 WeakPolarHBondContact OD1-CB 3.25Å; N49-Q51 PolarHBondContact OD1-N 2.86Å
52	W	69.6	Low	80.4	Confident	145 Å²	145	80.1 Å²	80.1	55%	0.549	40%	0.402	S	S	.	.	T	Hydrogen-bonded Turn	trans	-101.1	-30.4	-179.3	-61.2	-15.7	0	0	0	112.4	N49 P50	N49-W52 HydrophobicContact CB-CB 4.3Å; N49-W52 HydrophobicContact CB-CD2 3.72Å; N49-W52 HydrophobicContact CB-CE3 3.64Å; N49-W52 HydrophobicContact CB-CG 4.02Å; N49-W52 HydrophobicContact CB-CZ3 4.21Å; N49-W52 VanDerWaalsContact ND2-CE2 3.32Å; N49-W52 PolarHBondContact O-N 2.94Å; P50-W52 VanDerWaalsContact C-N 3.29Å
53	A	72.9	Confident	80.4	Confident	6 Å²	6	79 Å²	79	5%	0.05	41%	0.41	C	S	.	.			trans	-144.2	122.3	179.8	0	0	0	0	0	110.5	Y48 N49 L55 R139	Y48-A53 WeakPolarHBondContact CE2-O 3.35Å; N49-A53 PolarHBondContact O-N 3.31Å; N49-A53 VanDerWaalsContact O-N 3.14Å; A53-L55 PolarHBondContact O-N 2.98Å; A53-R139 HydrophobicContact CB-CB 3.56Å
54	H	79.4	Confident	80.4	Confident	163 Å²	163	82 Å²	82	76%	0.755	42%	0.42	S	S	*	.			trans	-84	113.3	168.1	-69.3	-62.4	0	0	0	109.5
55	L	82.1	Confident	80.6	Confident	59 Å²	59	80 Å²	80	31%	0.309	42%	0.416	S	S	.	.			trans	-90.8	141.4	173.1	-61.4	-179.8	0	0	0	109.9	I46 Y48 A53	I46-L55 HydrophobicContact CD1-CD1 3.93Å; Y48-L55 HydrophobicContact CD1-CD1 3.83Å; Y48-L55 HydrophobicContact CD2-CD1 3.68Å; Y48-L55 HydrophobicContact CD2-CG 3.94Å; Y48-L55 HydrophobicContact CE1-CD1 3.97Å; Y48-L55 HydrophobicContact CE2-CB 4.33Å; Y48-L55 HydrophobicContact CE2-CD1 3.78Å; Y48-L55 HydrophobicContact CE2-CG 3.82Å; Y48-L55 HydrophobicContact CG-CD1 3.71Å; Y48-L55 HydrophobicContact CG-CG 4.46Å; A53-L55 PolarHBondContact O-N 2.98Å
56	P	86	Confident	81	Confident	62 Å²	62	81.5 Å²	81.5	40%	0.403	42%	0.416	S	S	.	.			trans	-64.3	146.1	171.3	27.8	-31.9	0	0	0	109.6	D58 K61 A62	P56-D58 VanDerWaalsContact C-N 3.3Å; P56-K61 HydrophobicContact CB-CB 4.03Å; P56-A62 HydrophobicContact CG-CB 3.9Å
57	H	85.2	Confident	81.4	Confident	188 Å²	188	84.5 Å²	84.5	87%	0.87	43%	0.432	S	S	*	.	S	Bend	trans	-76	-23.3	-178.4	-64.3	39.7	0	0	0	112.2
58	D	83.5	Confident	82.1	Confident	73 Å²	73	87.5 Å²	87.5	39%	0.39	44%	0.443	S	S	.	.	S	Bend	trans	-115.8	134.3	179.8	-54.1	-58	0	0	0	110.3	P56 S60 K61	P56-D58 VanDerWaalsContact C-N 3.3Å; D58-S60 PolarHBondContact O-N 3.2Å; D58-K61 HydrophobicContact CB-CD 4.2Å; D58-K61 HydrophobicContact CB-CG 4.37Å; D58-K61 PolarHBondContact O-N 3.14Å; D58-K61 WeakPolarHBondContact OD2-CE 3.34Å; D58-K61 IonicContact OD2-NZ 2.71Å; D58-K61 PolarHBondContact OD2-NZ 3.1Å
59	L	80.5	Confident	82.8	Confident	83 Å²	83	91.8 Å²	91.8	44%	0.435	47%	0.467	S	S	.	.	G	3₁₀ helix	trans	-60.2	-30.3	176.2	-67.8	176	0	0	0	112.7	M29 H31 K61 A62	M29-L59 HydrophobicContact CG-CD2 4.5Å; M29-L59 HydrophobicContact SD-CD1 3.91Å; H31-L59 HydrophobicContact CB-CD2 4.43Å; L59-K61 PolarHBondContact O-N 3.2Å; L59-A62 VanDerWaalsContact O-CB 3.29Å; L59-A62 WeakPolarHBondContact O-CB 3.28Å; L59-A62 PolarHBondContact O-N 2.93Å
60	S	81.9	Confident	83.8	Confident	111 Å²	111	94.4 Å²	94.4	78%	0.776	48%	0.477	S	S	*	.	G	3₁₀ helix	trans	-64.4	-20.7	177.2	58.6	0	0	0	0	113.7	D58	D58-S60 PolarHBondContact O-N 3.2Å
61	K	86.2	Confident	84.6	Confident	142 Å²	142	96.2 Å²	96.2	62%	0.617	49%	0.487	S	S	*	.	G	3₁₀ helix	trans	-96.8	-5.5	176.4	-63	170.9	-176.2	157	0	112.2	P56 D58 L59	P56-K61 HydrophobicContact CB-CB 4.03Å; D58-K61 HydrophobicContact CB-CD 4.2Å; D58-K61 HydrophobicContact CB-CG 4.37Å; D58-K61 PolarHBondContact O-N 3.14Å; D58-K61 WeakPolarHBondContact OD2-CE 3.34Å; D58-K61 IonicContact OD2-NZ 2.71Å; D58-K61 PolarHBondContact OD2-NZ 3.1Å; L59-K61 PolarHBondContact O-N 3.2Å
62	A	86	Confident	85.6	Confident	41 Å²	41	94.3 Å²	94.3	34%	0.339	50%	0.497	S	S	.	.	S	Bend	trans	-75	141	177.4	0	0	0	0	0	110.9	P56 L59	P56-A62 HydrophobicContact CG-CB 3.9Å; L59-A62 VanDerWaalsContact O-CB 3.29Å; L59-A62 WeakPolarHBondContact O-CB 3.28Å; L59-A62 PolarHBondContact O-N 2.93Å
63	S	84.9	Confident	86.7	Confident	100 Å²	100	88.2 Å²	88.2	70%	0.699	48%	0.477	S	S	*	.			trans	-83.8	130.2	174	-53.8	0	0	0	0	109.9	L65	S63-L65 PolarHBondContact O-N 2.89Å
64	F	86.7	Confident	87.6	Confident	149 Å²	149	91.3 Å²	91.3	65%	0.654	49%	0.492	S	S	*	.			trans	-71.9	115.8	170.3	-79.9	-85.8	0	0	0	110	V33	V33-F64 HydrophobicContact CG1-CE1 4.08Å; V33-F64 HydrophobicContact CG2-CD1 4.02Å; V33-F64 HydrophobicContact CG2-CE1 3.78Å
65	L	89.1	Confident	88.3	Confident	72 Å²	72	83.5 Å²	83.5	38%	0.377	46%	0.456	S	S	.	.			trans	-112	143.3	176.9	-67.2	170.8	0	0	0	109.7	S63 L67 I90 R113	S63-L65 PolarHBondContact O-N 2.89Å; L65-L67 PolarHBondContact O-N 2.78Å; L65-I90 HydrophobicContact CB-CD1 3.74Å; L65-I90 HydrophobicContact CB-CG1 3.94Å; L65-I90 HydrophobicContact CD1-CD1 3.78Å; L65-I90 HydrophobicContact CD1-CG1 4.08Å; L65-I90 HydrophobicContact CG-CD1 4.4Å; L65-R113 HydrophobicContact CD1-CB 4.02Å; L65-R113 HydrophobicContact CD1-CG 3.71Å; L65-R113 HydrophobicContact CD2-CG 4.43Å
66	Q	91.5	Very high	88.9	Confident	100 Å²	100	82.6 Å²	82.6	47%	0.467	45%	0.454	S	S	.	.			trans	-65.6	125.2	178.4	-83.7	-72.8	-11.6	0	0	110.1	Q89 I90	Q66-Q89 HydrophobicContact CB-CG 3.98Å; Q66-Q89 WeakPolarHBondContact O-CA 3.49Å; Q66-Q89 WeakPolarHBondContact O-CB 3.35Å; Q66-I90 PolarHBondContact O-N 3.34Å
67	L	91	Very high	89.4	Confident	65 Å²	65	82.1 Å²	82.1	34%	0.34	45%	0.452	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-89.9	119.2	-180	-159.6	69.6	0	0	0	108.9	V32 L65 I90 L92 L116	V32-L67 HydrophobicContact CG1-CD2 3.91Å; V32-L67 HydrophobicContact CG2-CD2 4.33Å; L65-L67 PolarHBondContact O-N 2.78Å; L67-I90 HydrophobicContact CD1-CB 4.06Å; L67-I90 HydrophobicContact CD1-CG2 3.99Å; L67-L92 HydrophobicContact CD1-CD1 3.23Å; L67-L92 HydrophobicContact CD2-CD1 3.68Å; L67-L92 HydrophobicContact CD2-CD2 4.42Å; L67-L92 HydrophobicContact CG-CD1 3.28Å; L67-L116 HydrophobicContact CD1-CD1 3.72Å
68	R	91.9	Very high	89.7	Confident	70 Å²	70	76.6 Å²	76.6	26%	0.264	44%	0.439	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.5	119.6	-179.5	-166.6	-170.3	-171.9	152.5	-11.1	110.2	W70 G85 Q89 I90 P91 L92	R68-W70 HydrophobicContact CG-CE3 4.32Å; R68-W70 VanDerWaalsContact NE-CZ3 3.3Å; R68-W70 VanDerWaalsContact NH2-CZ3 3.32Å; R68-W70 PolarHBondContact O-N 3.23Å; R68-G85 PolarHBondContact NH1-O 3Å; R68-Q89 HydrophobicContact CB-CB 4.3Å; R68-Q89 VanDerWaalsContact CD-OE1 3.26Å; R68-I90 PolarHBondContact N-O 2.87Å; R68-P91 CarbonylContact O-C 3.53Å; R68-P91 WeakPolarHBondContact O-CA 3.48Å; R68-L92 PolarHBondContact O-N 3.43Å
69	N	92.3	Very high	90.2	Very high	116 Å²	116	77.6 Å²	77.6	62%	0.62	46%	0.458	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-69.5	116.3	172.1	-173.3	-3.4	0	0	0	110.1	T71	N69-T71 WeakPolarHBondContact OD1-CG2 3.48Å; N69-T71 PolarHBondContact OD1-N 3.48Å; N69-T71 PolarHBondContact OD1-OG1 3.03Å
70	W	94.4	Very high	90.9	Very high	66 Å²	66	75.9 Å²	75.9	25%	0.25	45%	0.449	C	S	.	.			trans	-131	22.9	175.5	-143.1	-109.8	0	0	0	111.4	R68 A72 S73 D80 P82 F86 P91 L92 V93	R68-W70 HydrophobicContact CG-CE3 4.32Å; R68-W70 VanDerWaalsContact NE-CZ3 3.3Å; R68-W70 VanDerWaalsContact NH2-CZ3 3.32Å; R68-W70 PolarHBondContact O-N 3.23Å; W70-A72 PolarHBondContact O-N 3.12Å; W70-A72 VanDerWaalsContact O-N 3.12Å; W70-S73 PolarHBondContact O-N 3.37Å; W70-D80 PolarHBondContact NE1-O 3.41Å; W70-D80 VanDerWaalsContact NE1-O 3.14Å; W70-P82 HydrophobicContact CH2-CB 3.83Å; W70-P82 HydrophobicContact CZ2-CB 3.72Å; W70-P82 HydrophobicContact CZ2-CG 4.14Å; W70-F86 HydrophobicContact CD2-CE1 4.15Å; W70-F86 HydrophobicContact CG-CE1 4.05Å; W70-F86 HydrophobicContact CG-CZ 4.46Å; W70-P91 HydrophobicContact CB-CB 4.23Å; W70-L92 CarbonylContact C-O 3.59Å; W70-L92 WeakPolarHBondContact CA-O 3.32Å; W70-L92 VanDerWaalsContact CB-O 3.26Å; W70-L92 WeakPolarHBondContact CB-O 3.18Å; W70-L92 PolarHBondContact N-O 3.05Å; W70-V93 HydrophobicContact CB-CG1 4.29Å
71	T	91.6	Very high	91.5	Very high	59 Å²	59	72.8 Å²	72.8	36%	0.362	42%	0.423	S	S	.	.	T	Hydrogen-bonded Turn	trans	-70.7	-11.3	-170.4	60.2	0	0	0	0	113.6	N69 S73 L92 A94 V118	N69-T71 WeakPolarHBondContact OD1-CG2 3.48Å; N69-T71 PolarHBondContact OD1-N 3.48Å; N69-T71 PolarHBondContact OD1-OG1 3.03Å; T71-S73 PolarHBondContact O-N 3.02Å; T71-L92 HydrophobicContact CG2-CB 3.81Å; T71-L92 PolarHBondContact N-O 3.45Å; T71-A94 WeakPolarHBondContact O-CB 3.48Å; T71-V118 HydrophobicContact CG2-CG2 4.33Å
72	A	91.6	Very high	91.8	Very high	111 Å²	111	66.6 Å²	66.6	92%	0.917	40%	0.398	S	S	*	.	T	Hydrogen-bonded Turn	trans	-70.9	-18.1	171.8	0	0	0	0	0	112.6	W70	W70-A72 PolarHBondContact O-N 3.12Å; W70-A72 VanDerWaalsContact O-N 3.12Å
73	S	92.1	Very high	92	Very high	17 Å²	17	70.1 Å²	70.1	12%	0.119	43%	0.427	C	S	.	.			trans	-107.1	149.8	176.6	179.4	0	0	0	0	111.6	W70 T71 L75 D80 A94	W70-S73 PolarHBondContact O-N 3.37Å; T71-S73 PolarHBondContact O-N 3.02Å; S73-L75 PolarHBondContact OG-N 3.26Å; S73-D80 VanDerWaalsContact OG-CB 3.32Å; S73-D80 WeakPolarHBondContact OG-CB 3.4Å; S73-D80 PolarHBondContact OG-OD1 2.94Å; S73-A94 PolarHBondContact O-N 3.13Å
74	L	92.4	Very high	92.3	Very high	70 Å²	70	76.2 Å²	76.2	37%	0.366	43%	0.434	S	S	.	.			trans	-85.5	-15	169.9	-55.5	-176.7	0	0	0	112.1	C76 A94 K103	L74-C76 VanDerWaalsContact C-N 3.34Å; L74-C76 PolarHBondContact O-N 3.2Å; L74-A94 HydrophobicContact CD2-CB 4.02Å; L74-K103 PolarHBondContact O-NZ 3.4Å
75	L	93.9	Very high	92.6	Very high	0 Å²	0	69.6 Å²	69.6	0%	0	41%	0.408	C	S	.	.			trans	51.8	50.4	-176.4	-165	70.3	0	0	0	112.7	S73 D80 L81 F86 V93 K103 L106 A107 L115	S73-L75 PolarHBondContact OG-N 3.26Å; L75-D80 HydrophobicContact CD1-CB 4.21Å; L75-L81 HydrophobicContact CD1-CD2 3.63Å; L75-L81 HydrophobicContact CD1-CG 4.45Å; L75-F86 HydrophobicContact CD1-CE2 4.16Å; L75-F86 HydrophobicContact CD1-CZ 4.06Å; L75-F86 HydrophobicContact CD2-CE2 4.38Å; L75-V93 HydrophobicContact CB-CB 4.32Å; L75-V93 HydrophobicContact CB-CG1 3.89Å; L75-V93 HydrophobicContact CD2-CG1 3.89Å; L75-V93 HydrophobicContact CG-CG1 4.46Å; L75-K103 HydrophobicContact CD2-CB 4.49Å; L75-K103 WeakPolarHBondContact O-CG 3.2Å; L75-L106 HydrophobicContact CD1-CB 4.49Å; L75-L106 HydrophobicContact CG-CB 4.31Å; L75-L106 WeakPolarHBondContact O-CD1 3.3Å; L75-A107 HydrophobicContact CD2-CB 3.93Å; L75-L115 HydrophobicContact CD2-CD1 3.9Å; L75-L115 HydrophobicContact CD2-CD2 4.43Å
76	C	94.8	Very high	92.7	Very high	40 Å²	40	66.1 Å²	66.1	27%	0.27	39%	0.39	S	S	.	.			trans	-104.2	-9.7	-179.1	-65.3	0	0	0	0	112.8	L74 D80 C98	L74-C76 VanDerWaalsContact C-N 3.34Å; L74-C76 PolarHBondContact O-N 3.2Å; C76-D80 PolarHBondContact N-OD2 3.35Å; C76-C98 WeakPolarHBondContact CA-SG 3.36Å; C76-C98 HydrophobicContact CB-CB 3.62Å; C76-C98 WeakPolarHBondContact CB-SG 3.41Å; C76-C98 WeakPolarHBondContact SG-CB 3.4Å; C76-C98 CovalentContact SG-SG 2.03Å; C76-C98 PolarHBondContact SG-SG 2.93Å
77	S	95.2	Very high	92.6	Very high	51 Å²	51	65 Å²	65	36%	0.357	39%	0.392	S	S	.	.	S	Bend	trans	-142.7	165.9	-178.6	71.5	0	0	0	0	112.1	A79 D80	S77-A79 PolarHBondContact O-N 3.34Å; S77-A79 PolarHBondContact OG-N 3.17Å; S77-D80 PolarHBondContact N-OD2 2.83Å; S77-D80 VanDerWaalsContact O-CB 3.32Å; S77-D80 WeakPolarHBondContact O-CB 3.49Å; S77-D80 PolarHBondContact O-N 2.95Å; S77-D80 VanDerWaalsContact O-N 3.11Å; S77-D80 PolarHBondContact OG-OD2 3.3Å
78	A	92.9	Very high	92.4	Very high	72 Å²	72	67.5 Å²	67.5	60%	0.595	41%	0.407	S	S	*	.	G	3₁₀ helix	trans	-63.4	-25.3	174	0	0	0	0	0	112.9	D80 L81	A78-D80 PolarHBondContact O-N 3.42Å; A78-L81 WeakPolarHBondContact O-CB 3.19Å; A78-L81 PolarHBondContact O-N 3.42Å
79	A	93.7	Very high	92.3	Very high	95 Å²	95	66.9 Å²	66.9	79%	0.785	41%	0.406	S	S	*	.	G	3₁₀ helix	trans	-68.7	-19.9	175.9	0	0	0	0	0	112.9	S77 L81	S77-A79 PolarHBondContact O-N 3.34Å; S77-A79 PolarHBondContact OG-N 3.17Å; A79-L81 PolarHBondContact O-N 3.35Å
80	D	94.3	Very high	92.3	Very high	47 Å²	47	62.8 Å²	62.8	25%	0.251	38%	0.384	S	S	.	.	G	3₁₀ helix	trans	-79.5	-7.8	176.5	-67	-56	0	0	0	113.3	W70 S73 L75 C76 S77 A78	W70-D80 PolarHBondContact NE1-O 3.41Å; W70-D80 VanDerWaalsContact NE1-O 3.14Å; S73-D80 VanDerWaalsContact OG-CB 3.32Å; S73-D80 WeakPolarHBondContact OG-CB 3.4Å; S73-D80 PolarHBondContact OG-OD1 2.94Å; L75-D80 HydrophobicContact CD1-CB 4.21Å; C76-D80 PolarHBondContact N-OD2 3.35Å; S77-D80 PolarHBondContact N-OD2 2.83Å; S77-D80 VanDerWaalsContact O-CB 3.32Å; S77-D80 WeakPolarHBondContact O-CB 3.49Å; S77-D80 PolarHBondContact O-N 2.95Å; S77-D80 VanDerWaalsContact O-N 3.11Å; S77-D80 PolarHBondContact OG-OD2 3.3Å; A78-D80 PolarHBondContact O-N 3.42Å
81	L	94.4	Very high	92.3	Very high	45 Å²	45	59.7 Å²	59.7	24%	0.236	37%	0.373	C	S	.	.	S	Bend	trans	-79.5	139.8	-177.3	-66.8	172.9	0	0	0	111.6	L75 A78 A79 F86 L106	L75-L81 HydrophobicContact CD1-CD2 3.63Å; L75-L81 HydrophobicContact CD1-CG 4.45Å; A78-L81 WeakPolarHBondContact O-CB 3.19Å; A78-L81 PolarHBondContact O-N 3.42Å; A79-L81 PolarHBondContact O-N 3.35Å; L81-F86 HydrophobicContact CD2-CE2 3.82Å; L81-F86 HydrophobicContact CD2-CZ 4.44Å; L81-L106 HydrophobicContact CD1-CD2 4.45Å; L81-L106 HydrophobicContact CD2-CB 4.42Å
82	P	93.6	Very high	92.3	Very high	13 Å²	13	58.6 Å²	58.6	8%	0.084	36%	0.364	C	S	.	.			trans	-62.3	144.6	169.3	23.8	-30.6	0	0	0	110.9	W70 R84 G85 F86	W70-P82 HydrophobicContact CH2-CB 3.83Å; W70-P82 HydrophobicContact CZ2-CB 3.72Å; W70-P82 HydrophobicContact CZ2-CG 4.14Å; P82-R84 PolarHBondContact O-N 3.06Å; P82-R84 VanDerWaalsContact O-N 3.08Å; P82-G85 VanDerWaalsContact CG-C 3.48Å; P82-G85 WeakPolarHBondContact CG-O 3.38Å; P82-G85 PolarHBondContact O-N 3.41Å; P82-F86 HydrophobicContact CG-CD1 3.83Å; P82-F86 HydrophobicContact CG-CE1 3.67Å; P82-F86 HydrophobicContact CG-CG 4.31Å; P82-F86 HydrophobicContact CG-CZ 4.05Å
83	A	90.8	Very high	92.4	Very high	114 Å²	114	53.3 Å²	53.3	94%	0.942	32%	0.321	S	S	*	.	T	Hydrogen-bonded Turn	trans	-56.1	-30.4	-176.8	0	0	0	0	0	114.7
84	R	90.2	Very high	92.4	Very high	229 Å²	229	53.6 Å²	53.6	86%	0.864	32%	0.324	S	S	*	.	T	Hydrogen-bonded Turn	trans	-104.5	13.1	176.6	-61.9	-171.7	-176.8	178.2	1.3	113.4	P82 S87	P82-R84 PolarHBondContact O-N 3.06Å; P82-R84 VanDerWaalsContact O-N 3.08Å; R84-S87 PolarHBondContact O-OG 3.32Å
85	G	92.2	Very high	92.2	Very high	9 Å²	9	55 Å²	55	9%	0.093	33%	0.325	C	S	.	.			trans	64.7	-169.3	-173.3	0	0	0	0	0	114.3	R68 P82 S110	R68-G85 PolarHBondContact NH1-O 3Å; P82-G85 VanDerWaalsContact CG-C 3.48Å; P82-G85 WeakPolarHBondContact CG-O 3.38Å; P82-G85 PolarHBondContact O-N 3.41Å; G85-S110 WeakPolarHBondContact CA-OG 3.33Å
86	F	92.4	Very high	91.9	Very high	0 Å²	0	56.2 Å²	56.2	0%	0	34%	0.337	C	S	.	.			trans	-89.2	-15.6	-177.8	-65.8	-63.1	0	0	0	113.3	W70 L75 L81 P82 N88 Q89 P91 A107 S110 A112	W70-F86 HydrophobicContact CD2-CE1 4.15Å; W70-F86 HydrophobicContact CG-CE1 4.05Å; W70-F86 HydrophobicContact CG-CZ 4.46Å; L75-F86 HydrophobicContact CD1-CE2 4.16Å; L75-F86 HydrophobicContact CD1-CZ 4.06Å; L75-F86 HydrophobicContact CD2-CE2 4.38Å; L81-F86 HydrophobicContact CD2-CE2 3.82Å; L81-F86 HydrophobicContact CD2-CZ 4.44Å; P82-F86 HydrophobicContact CG-CD1 3.83Å; P82-F86 HydrophobicContact CG-CE1 3.67Å; P82-F86 HydrophobicContact CG-CG 4.31Å; P82-F86 HydrophobicContact CG-CZ 4.05Å; F86-N88 PolarHBondContact O-N 3.36Å; F86-Q89 WeakPolarHBondContact O-CB 2.98Å; F86-Q89 WeakPolarHBondContact O-CG 3.47Å; F86-Q89 PolarHBondContact O-N 3.28Å; F86-Q89 VanDerWaalsContact O-N 3.07Å; F86-P91 HydrophobicContact CD1-CB 3.7Å; F86-P91 HydrophobicContact CD1-CG 3.75Å; F86-P91 HydrophobicContact CD2-CG 3.97Å; F86-P91 HydrophobicContact CE1-CB 3.49Å; F86-P91 VanDerWaalsContact CE1-CB 3.49Å; F86-P91 HydrophobicContact CE1-CG 3.83Å; F86-P91 HydrophobicContact CE2-CB 4.48Å; F86-P91 HydrophobicContact CE2-CG 4.02Å; F86-P91 HydrophobicContact CG-CB 4.31Å; F86-P91 HydrophobicContact CG-CG 3.83Å; F86-P91 HydrophobicContact CZ-CB 3.91Å; F86-P91 HydrophobicContact CZ-CG 3.95Å; F86-A107 HydrophobicContact CE2-CB 4.44Å; F86-S110 PolarHBondContact N-O 3.37Å; F86-A112 HydrophobicContact CB-CB 3.85Å; F86-A112 HydrophobicContact CD2-CB 3.88Å; F86-A112 HydrophobicContact CG-CB 4.14Å
87	S	89.4	Confident	91.6	Very high	75 Å²	75	61.4 Å²	61.4	52%	0.524	36%	0.362	S	S	.	.	T	Hydrogen-bonded Turn	trans	50	58.7	166.6	-63.9	0	0	0	0	114.3	R84 Q89	R84-S87 PolarHBondContact O-OG 3.32Å; S87-Q89 PolarHBondContact O-N 2.85Å
88	N	85.6	Confident	91.4	Very high	119 Å²	119	60 Å²	60	64%	0.636	35%	0.352	S	S	*	.	T	Hydrogen-bonded Turn	trans	65.8	13.5	-178.9	-57.4	-48.3	0	0	0	116	F86 G111	F86-N88 PolarHBondContact O-N 3.36Å; N88-G111 PolarHBondContact N-O 3.11Å
89	Q	91.4	Very high	91.1	Very high	56 Å²	56	60.1 Å²	60.1	26%	0.262	35%	0.345	S	S	.	.			trans	-92.4	165.8	175.2	-57.8	174.3	-7.7	0	0	111.4	Q66 R68 F86 S87 P91 A112 R113	Q66-Q89 HydrophobicContact CB-CG 3.98Å; Q66-Q89 WeakPolarHBondContact O-CA 3.49Å; Q66-Q89 WeakPolarHBondContact O-CB 3.35Å; R68-Q89 HydrophobicContact CB-CB 4.3Å; R68-Q89 VanDerWaalsContact CD-OE1 3.26Å; F86-Q89 WeakPolarHBondContact O-CB 2.98Å; F86-Q89 WeakPolarHBondContact O-CG 3.47Å; F86-Q89 PolarHBondContact O-N 3.28Å; F86-Q89 VanDerWaalsContact O-N 3.07Å; S87-Q89 PolarHBondContact O-N 2.85Å; Q89-P91 WeakPolarHBondContact O-CD 3.49Å; Q89-A112 WeakPolarHBondContact O-CA 3.3Å; Q89-R113 PolarHBondContact O-N 3.48Å
90	I	92.1	Very high	90.6	Very high	31 Å²	31	59.1 Å²	59.1	16%	0.159	32%	0.324	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.3	101.3	170.8	-59.7	179.7	0	0	0	108.4	L65 Q66 L67 R68 L116	L65-I90 HydrophobicContact CB-CD1 3.74Å; L65-I90 HydrophobicContact CB-CG1 3.94Å; L65-I90 HydrophobicContact CD1-CD1 3.78Å; L65-I90 HydrophobicContact CD1-CG1 4.08Å; L65-I90 HydrophobicContact CG-CD1 4.4Å; Q66-I90 PolarHBondContact O-N 3.34Å; L67-I90 HydrophobicContact CD1-CB 4.06Å; L67-I90 HydrophobicContact CD1-CG2 3.99Å; R68-I90 PolarHBondContact N-O 2.87Å; I90-L116 HydrophobicContact CG2-CB 4.39Å; I90-L116 HydrophobicContact CG2-CD1 3.89Å; I90-L116 HydrophobicContact CG2-CG 3.62Å
91	P	93.6	Very high	90.1	Very high	0 Å²	0	64.2 Å²	64.2	0%	0	34%	0.34	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-68	137	171.5	24.6	-35.3	0	0	0	113.1	R68 W70 F86 Q89 V93 A112 G114 L115 L116	R68-P91 CarbonylContact O-C 3.53Å; R68-P91 WeakPolarHBondContact O-CA 3.48Å; W70-P91 HydrophobicContact CB-CB 4.23Å; F86-P91 HydrophobicContact CD1-CB 3.7Å; F86-P91 HydrophobicContact CD1-CG 3.75Å; F86-P91 HydrophobicContact CD2-CG 3.97Å; F86-P91 HydrophobicContact CE1-CB 3.49Å; F86-P91 VanDerWaalsContact CE1-CB 3.49Å; F86-P91 HydrophobicContact CE1-CG 3.83Å; F86-P91 HydrophobicContact CE2-CB 4.48Å; F86-P91 HydrophobicContact CE2-CG 4.02Å; F86-P91 HydrophobicContact CG-CB 4.31Å; F86-P91 HydrophobicContact CG-CG 3.83Å; F86-P91 HydrophobicContact CZ-CB 3.91Å; F86-P91 HydrophobicContact CZ-CG 3.95Å; Q89-P91 WeakPolarHBondContact O-CD 3.49Å; P91-V93 HydrophobicContact CB-CG1 4.35Å; P91-A112 HydrophobicContact CG-CB 4.13Å; P91-G114 VanDerWaalsContact CD-O 3.3Å; P91-G114 WeakPolarHBondContact CD-O 3.44Å; P91-L115 HydrophobicContact CB-CD1 4.35Å; P91-L115 HydrophobicContact CG-CD1 3.76Å; P91-L116 PolarHBondContact O-N 3.45Å
92	L	92.8	Very high	89.8	Confident	36 Å²	36	66.4 Å²	66.4	19%	0.188	35%	0.349	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.3	119.1	162	-87.1	69.2	0	0	0	108.8	L67 R68 W70 T71 L116 V118	L67-L92 HydrophobicContact CD1-CD1 3.23Å; L67-L92 HydrophobicContact CD2-CD1 3.68Å; L67-L92 HydrophobicContact CD2-CD2 4.42Å; L67-L92 HydrophobicContact CG-CD1 3.28Å; R68-L92 PolarHBondContact O-N 3.43Å; W70-L92 CarbonylContact C-O 3.59Å; W70-L92 WeakPolarHBondContact CA-O 3.32Å; W70-L92 VanDerWaalsContact CB-O 3.26Å; W70-L92 WeakPolarHBondContact CB-O 3.18Å; W70-L92 PolarHBondContact N-O 3.05Å; T71-L92 HydrophobicContact CG2-CB 3.81Å; T71-L92 PolarHBondContact N-O 3.45Å; L92-L116 CarbonylContact C-O 2.86Å; L92-L116 VanDerWaalsContact CA-O 3.3Å; L92-L116 WeakPolarHBondContact CA-O 3.49Å; L92-L116 HydrophobicContact CD1-CB 4.14Å; L92-L116 HydrophobicContact CD1-CD1 3.95Å; L92-L116 HydrophobicContact CG-CB 4.09Å; L92-V118 HydrophobicContact CB-CG2 4.24Å; L92-V118 HydrophobicContact CD2-CG2 3.97Å; L92-V118 HydrophobicContact CG-CG2 4.07Å
93	V	93.1	Very high	89.7	Confident	0 Å²	0	65.8 Å²	65.8	0%	0	35%	0.345	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.4	152.9	178.9	-60.4	0	0	0	0	110.8	W70 L75 P91 L115 L116 I117 V118	W70-V93 HydrophobicContact CB-CG1 4.29Å; L75-V93 HydrophobicContact CB-CB 4.32Å; L75-V93 HydrophobicContact CB-CG1 3.89Å; L75-V93 HydrophobicContact CD2-CG1 3.89Å; L75-V93 HydrophobicContact CG-CG1 4.46Å; P91-V93 HydrophobicContact CB-CG1 4.35Å; V93-L115 HydrophobicContact CB-CD1 4.35Å; V93-L115 HydrophobicContact CG1-CD1 3.76Å; V93-L115 HydrophobicContact CG2-CD1 3.66Å; V93-L115 HydrophobicContact CG2-CD2 4.32Å; V93-L115 HydrophobicContact CG2-CG 4.15Å; V93-L116 PolarHBondContact N-O 2.94Å; V93-I117 HydrophobicContact CG2-CB 4.39Å; V93-I117 HydrophobicContact CG2-CG1 3.91Å; V93-I117 HydrophobicContact CG2-CG2 4.47Å; V93-I117 CarbonylContact O-C 3.58Å; V93-I117 WeakPolarHBondContact O-CA 3.32Å; V93-V118 PolarHBondContact O-N 2.98Å
94	A	90.7	Very high	89.6	Confident	24 Å²	24	61 Å²	61	20%	0.198	30%	0.304	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-77.3	147.3	173.9	0	0	0	0	0	111.5	T71 S73 L74 G96 K103	T71-A94 WeakPolarHBondContact O-CB 3.48Å; S73-A94 PolarHBondContact O-N 3.13Å; L74-A94 HydrophobicContact CD2-CB 4.02Å; A94-G96 PolarHBondContact O-N 2.58Å; A94-K103 PolarHBondContact O-NZ 2.62Å; A94-K103 VanDerWaalsContact O-NZ 3.13Å
95	R	89.9	Confident	89.5	Confident	99 Å²	99	58.4 Å²	58.4	37%	0.374	30%	0.295	S	S	.	.			trans	-60.5	133.3	164.1	-172.3	177.7	-175.2	-173.9	-0.8	109	I117 V118 S119 R122	R95-I117 HydrophobicContact CB-CG2 4.31Å; R95-V118 PolarHBondContact N-O 3.32Å; R95-S119 WeakPolarHBondContact CD-OG 3.47Å; R95-R122 PolarHBondContact NH1-O 2.89Å
96	G	87.2	Confident	89.5	Confident	25 Å²	25	59.8 Å²	59.8	26%	0.258	30%	0.3	S	S	.	.			trans	-131.8	-159.5	178.5	0	0	0	0	0	110.8	A94	A94-G96 PolarHBondContact O-N 2.58Å
97	N	88.8	Confident	89.5	Confident	150 Å²	150	59.9 Å²	59.9	80%	0.802	30%	0.3	S	S	*	.	S	Bend	trans	-86.8	-14.3	178.7	61.2	-10.1	0	0	0	114.2
98	C	89.6	Confident	89.5	Confident	20 Å²	20	60.5 Å²	60.5	14%	0.135	30%	0.295	C	S	.	.	S	Bend	trans	-82	157.9	172.8	63.2	0	0	0	0	112.4	C76 E102 K103	C76-C98 WeakPolarHBondContact CA-SG 3.36Å; C76-C98 HydrophobicContact CB-CB 3.62Å; C76-C98 WeakPolarHBondContact CB-SG 3.41Å; C76-C98 WeakPolarHBondContact SG-CB 3.4Å; C76-C98 CovalentContact SG-SG 2.03Å; C76-C98 PolarHBondContact SG-SG 2.93Å; C98-E102 WeakPolarHBondContact CB-OE2 3.46Å; C98-K103 WeakPolarHBondContact SG-CE 3.22Å; C98-K103 PolarHBondContact SG-NZ 3.37Å; C98-K103 VanDerWaalsContact SG-NZ 3.45Å
99	T	86.8	Confident	89.7	Confident	75 Å²	75	58.4 Å²	58.4	46%	0.46	30%	0.302	S	S	.	.			trans	-68.9	158.3	-178	67.7	0	0	0	0	112	Y101 E102 K103	T99-Y101 VanDerWaalsContact C-N 3.26Å; T99-Y101 PolarHBondContact O-N 3.01Å; T99-E102 PolarHBondContact N-OE2 2.93Å; T99-E102 PolarHBondContact O-N 3.43Å; T99-E102 VanDerWaalsContact OG1-CD 3.25Å; T99-E102 VanDerWaalsContact OG1-CG 3.22Å; T99-E102 WeakPolarHBondContact OG1-CG 3.19Å; T99-E102 PolarHBondContact OG1-N 3.33Å; T99-E102 VanDerWaalsContact OG1-N 3.17Å; T99-E102 PolarHBondContact OG1-OE2 3.4Å; T99-K103 WeakPolarHBondContact O-CG 3.32Å; T99-K103 PolarHBondContact O-N 2.91Å
100	F	84.8	Confident	89.8	Confident	75 Å²	75	56.9 Å²	56.9	33%	0.329	30%	0.297	S	S	.	.	H	α-helix	trans	-61.8	-38.4	172.7	-59.7	-32.9	0	0	0	111.8	E102 K103 V104 I117 L123	F100-E102 PolarHBondContact O-N 2.95Å; F100-K103 PolarHBondContact O-N 3.32Å; F100-V104 WeakPolarHBondContact O-CB 3.38Å; F100-V104 WeakPolarHBondContact O-CG2 3.05Å; F100-V104 PolarHBondContact O-N 2.92Å; F100-I117 HydrophobicContact CB-CD1 4.07Å; F100-I117 HydrophobicContact CD1-CD1 3.42Å; F100-I117 VanDerWaalsContact CD1-CD1 3.42Å; F100-I117 HydrophobicContact CD1-CG2 4.41Å; F100-I117 HydrophobicContact CE1-CD1 4.1Å; F100-I117 HydrophobicContact CE1-CG2 4.11Å; F100-I117 HydrophobicContact CG-CD1 3.96Å; F100-L123 HydrophobicContact CE1-CD2 4.5Å; F100-L123 HydrophobicContact CZ-CD1 4.17Å; F100-L123 HydrophobicContact CZ-CD2 3.77Å
101	Y	82.8	Confident	89.7	Confident	153 Å²	153	57 Å²	57	60%	0.6	31%	0.306	S	S	*	.	H	α-helix	trans	-59.5	-43.8	179	-177.9	-99.4	0	0	0	112.5	T99 V104 R105	T99-Y101 VanDerWaalsContact C-N 3.26Å; T99-Y101 PolarHBondContact O-N 3.01Å; Y101-V104 PolarHBondContact O-N 3.15Å; Y101-R105 WeakPolarHBondContact O-CB 3.03Å; Y101-R105 PolarHBondContact O-N 3.4Å
102	E	88.6	Confident	89.6	Confident	91 Å²	91	57.2 Å²	57.2	43%	0.425	31%	0.308	S	S	.	.	H	α-helix	trans	-61.8	-46.5	177.7	-74.1	161.7	150.6	0	0	112.1	C98 T99 F100 V104 R105 L106	C98-E102 WeakPolarHBondContact CB-OE2 3.46Å; T99-E102 PolarHBondContact N-OE2 2.93Å; T99-E102 PolarHBondContact O-N 3.43Å; T99-E102 VanDerWaalsContact OG1-CD 3.25Å; T99-E102 VanDerWaalsContact OG1-CG 3.22Å; T99-E102 WeakPolarHBondContact OG1-CG 3.19Å; T99-E102 PolarHBondContact OG1-N 3.33Å; T99-E102 VanDerWaalsContact OG1-N 3.17Å; T99-E102 PolarHBondContact OG1-OE2 3.4Å; F100-E102 PolarHBondContact O-N 2.95Å; E102-V104 VanDerWaalsContact C-N 3.31Å; E102-V104 PolarHBondContact O-N 3.42Å; E102-R105 PolarHBondContact O-N 3.39Å; E102-L106 WeakPolarHBondContact O-CG 3.28Å; E102-L106 PolarHBondContact O-N 3.18Å
103	K	91.6	Very high	89.4	Confident	0 Å²	0	60 Å²	60	0%	0	32%	0.316	C	S	.	.	H	α-helix	trans	-59.5	-44.6	177.7	-62.4	167.2	-174.5	-77.2	0	111.2	L74 L75 A94 C98 T99 F100 L106 A107 L115 I117	L74-K103 PolarHBondContact O-NZ 3.4Å; L75-K103 HydrophobicContact CD2-CB 4.49Å; L75-K103 WeakPolarHBondContact O-CG 3.2Å; A94-K103 PolarHBondContact O-NZ 2.62Å; A94-K103 VanDerWaalsContact O-NZ 3.13Å; C98-K103 WeakPolarHBondContact SG-CE 3.22Å; C98-K103 PolarHBondContact SG-NZ 3.37Å; C98-K103 VanDerWaalsContact SG-NZ 3.45Å; T99-K103 WeakPolarHBondContact O-CG 3.32Å; T99-K103 PolarHBondContact O-N 2.91Å; F100-K103 PolarHBondContact O-N 3.32Å; K103-L106 PolarHBondContact O-N 2.87Å; K103-A107 WeakPolarHBondContact O-CB 3.34Å; K103-A107 PolarHBondContact O-N 2.9Å; K103-L115 HydrophobicContact CB-CD2 3.66Å; K103-I117 HydrophobicContact CD-CD1 3.87Å; K103-I117 HydrophobicContact CD-CG1 4.45Å
104	V	87.5	Confident	89.1	Confident	14 Å²	14	60.5 Å²	60.5	9%	0.085	32%	0.321	C	S	.	.	H	α-helix	trans	-62.3	-46.4	179.6	169.6	0	0	0	0	110.6	F100 Y101 E102 L106 A107 Q108 L115 A138	F100-V104 WeakPolarHBondContact O-CB 3.38Å; F100-V104 WeakPolarHBondContact O-CG2 3.05Å; F100-V104 PolarHBondContact O-N 2.92Å; Y101-V104 PolarHBondContact O-N 3.15Å; E102-V104 VanDerWaalsContact C-N 3.31Å; E102-V104 PolarHBondContact O-N 3.42Å; V104-L106 VanDerWaalsContact C-N 3.32Å; V104-L106 PolarHBondContact O-N 2.96Å; V104-A107 PolarHBondContact O-N 3.21Å; V104-Q108 HydrophobicContact CG1-CG 4.11Å; V104-Q108 VanDerWaalsContact CG1-NE2 3.26Å; V104-Q108 WeakPolarHBondContact O-CB 3.49Å; V104-Q108 VanDerWaalsContact O-CG 3.25Å; V104-Q108 WeakPolarHBondContact O-CG 3.46Å; V104-Q108 PolarHBondContact O-N 2.03Å; V104-L115 HydrophobicContact CG2-CD2 3.87Å; V104-A138 HydrophobicContact CB-CB 4.13Å; V104-A138 HydrophobicContact CG1-CB 3.57Å; V104-A138 HydrophobicContact CG2-CB 3.38Å
105	R	88.4	Confident	89.1	Confident	174 Å²	174	59.5 Å²	59.5	66%	0.657	31%	0.312	S	S	*	.	H	α-helix	trans	-58.4	-43.4	177.2	-175.8	-179.1	178.1	-170.4	0.1	112.1	Y101 E102 G109	Y101-R105 WeakPolarHBondContact O-CB 3.03Å; Y101-R105 PolarHBondContact O-N 3.4Å; E102-R105 PolarHBondContact O-N 3.39Å; R105-G109 PolarHBondContact O-N 3.31Å
106	L	92.8	Very high	89.1	Confident	39 Å²	39	55.3 Å²	55.3	20%	0.204	30%	0.297	C	S	.	.	H	α-helix	trans	-66	-45.6	177.1	-72.1	169.9	0	0	0	111.9	L75 L81 E102 K103 V104 S110	L75-L106 HydrophobicContact CD1-CB 4.49Å; L75-L106 HydrophobicContact CG-CB 4.31Å; L75-L106 WeakPolarHBondContact O-CD1 3.3Å; L81-L106 HydrophobicContact CD1-CD2 4.45Å; L81-L106 HydrophobicContact CD2-CB 4.42Å; E102-L106 WeakPolarHBondContact O-CG 3.28Å; E102-L106 PolarHBondContact O-N 3.18Å; K103-L106 PolarHBondContact O-N 2.87Å; V104-L106 VanDerWaalsContact C-N 3.32Å; V104-L106 PolarHBondContact O-N 2.96Å; L106-S110 WeakPolarHBondContact O-CB 3.39Å; L106-S110 PolarHBondContact O-N 2.79Å; L106-S110 VanDerWaalsContact O-N 3.13Å
107	A	92.6	Very high	89.1	Confident	1 Å²	1	54.3 Å²	54.3	1%	0.008	29%	0.286	C	S	.	.	H	α-helix	trans	-61.5	-51.6	178.9	0	0	0	0	0	111.9	L75 F86 K103 V104 G109 S110 G111 A112 L115	L75-A107 HydrophobicContact CD2-CB 3.93Å; F86-A107 HydrophobicContact CE2-CB 4.44Å; K103-A107 WeakPolarHBondContact O-CB 3.34Å; K103-A107 PolarHBondContact O-N 2.9Å; V104-A107 PolarHBondContact O-N 3.21Å; A107-G109 PolarHBondContact O-N 2.96Å; A107-S110 CarbonylContact O-C 3.6Å; A107-S110 PolarHBondContact O-N 3.32Å; A107-S110 VanDerWaalsContact O-N 3.09Å; A107-G111 PolarHBondContact O-N 2.9Å; A107-A112 HydrophobicContact CB-CB 3.86Å; A107-A112 WeakPolarHBondContact O-CB 3.43Å; A107-A112 PolarHBondContact O-N 3.3Å; A107-L115 HydrophobicContact CB-CB 4.21Å; A107-L115 HydrophobicContact CB-CD1 4.02Å; A107-L115 HydrophobicContact CB-CD2 4.25Å; A107-L115 HydrophobicContact CB-CG 4.4Å
108	Q	89.1	Confident	89	Confident	89 Å²	89	49.6 Å²	49.6	42%	0.416	26%	0.262	S	S	.	.	H	α-helix	trans	-58.7	-48.1	177.9	-72.7	168.8	-15.3	0	0	111.3	V104 S110 G111 R139	V104-Q108 HydrophobicContact CG1-CG 4.11Å; V104-Q108 VanDerWaalsContact CG1-NE2 3.26Å; V104-Q108 WeakPolarHBondContact O-CB 3.49Å; V104-Q108 VanDerWaalsContact O-CG 3.25Å; V104-Q108 WeakPolarHBondContact O-CG 3.46Å; V104-Q108 PolarHBondContact O-N 2.03Å; Q108-S110 PolarHBondContact O-N 2.89Å; Q108-S110 VanDerWaalsContact O-N 3.11Å; Q108-G111 PolarHBondContact O-N 3.48Å; Q108-R139 PolarHBondContact NE2-O 3.29Å
109	G	90	Very high	88.5	Confident	75 Å²	75	49 Å²	49	77%	0.773	26%	0.258	S	S	*	.	H	α-helix	trans	-61.6	-19.4	177.9	0	0	0	0	0	113.7	R105 A107	R105-G109 PolarHBondContact O-N 3.31Å; A107-G109 PolarHBondContact O-N 2.96Å
110	S	93	Very high	87.8	Confident	23 Å²	23	57.4 Å²	57.4	16%	0.161	28%	0.282	C	S	.	.	T	Hydrogen-bonded Turn	trans	-103	17.4	177	-158.3	0	0	0	0	113.4	G85 F86 L106 A107 Q108	G85-S110 WeakPolarHBondContact CA-OG 3.33Å; F86-S110 PolarHBondContact N-O 3.37Å; L106-S110 WeakPolarHBondContact O-CB 3.39Å; L106-S110 PolarHBondContact O-N 2.79Å; L106-S110 VanDerWaalsContact O-N 3.13Å; A107-S110 CarbonylContact O-C 3.6Å; A107-S110 PolarHBondContact O-N 3.32Å; A107-S110 VanDerWaalsContact O-N 3.09Å; Q108-S110 PolarHBondContact O-N 2.89Å; Q108-S110 VanDerWaalsContact O-N 3.11Å
111	G	90.4	Very high	86.9	Confident	34 Å²	34	60.5 Å²	60.5	35%	0.351	30%	0.297	S	S	.	.	T	Hydrogen-bonded Turn	trans	75.3	22.7	173.6	0	0	0	0	0	114.7	N88 A107 Q108	N88-G111 PolarHBondContact N-O 3.11Å; A107-G111 PolarHBondContact O-N 2.9Å; Q108-G111 PolarHBondContact O-N 3.48Å
112	A	91.9	Very high	85.7	Confident	5 Å²	5	57.3 Å²	57.3	4%	0.041	28%	0.284	C	S	.	.			trans	-68.5	144.1	168.4	0	0	0	0	0	110.2	F86 Q89 P91 A107	F86-A112 HydrophobicContact CB-CB 3.85Å; F86-A112 HydrophobicContact CD2-CB 3.88Å; F86-A112 HydrophobicContact CG-CB 4.14Å; Q89-A112 WeakPolarHBondContact O-CA 3.3Å; P91-A112 HydrophobicContact CG-CB 4.13Å; A107-A112 HydrophobicContact CB-CB 3.86Å; A107-A112 WeakPolarHBondContact O-CB 3.43Å; A107-A112 PolarHBondContact O-N 3.3Å
113	R	88.3	Confident	84.1	Confident	95 Å²	95	53.6 Å²	53.6	36%	0.358	27%	0.267	S	S	.	.	S	Bend	trans	-91.5	-14.2	175.8	-164.9	52.8	-75.9	165.3	21.3	113.6	L65 Q89 R139	L65-R113 HydrophobicContact CD1-CB 4.02Å; L65-R113 HydrophobicContact CD1-CG 3.71Å; L65-R113 HydrophobicContact CD2-CG 4.43Å; Q89-R113 PolarHBondContact O-N 3.48Å; R113-R139 PolarHBondContact NH2-OXT 2.98Å
114	G	87.6	Confident	82	Confident	10 Å²	10	60.8 Å²	60.8	10%	0.103	31%	0.305	C	S	.	.			trans	-168.9	172.4	167.1	0	0	0	0	0	108.4	P91 A138	P91-G114 VanDerWaalsContact CD-O 3.3Å; P91-G114 WeakPolarHBondContact CD-O 3.44Å; G114-A138 CarbonylContact C-O 3.59Å; G114-A138 VanDerWaalsContact CA-O 3.25Å; G114-A138 WeakPolarHBondContact CA-O 3.42Å
115	L	88.9	Confident	80	Confident	2 Å²	2	63.5 Å²	63.5	1%	0.01	32%	0.316	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.4	132.9	177	179.2	67.7	0	0	0	108.8	L75 P91 V93 K103 V104 A107 I117 A137 A138	L75-L115 HydrophobicContact CD2-CD1 3.9Å; L75-L115 HydrophobicContact CD2-CD2 4.43Å; P91-L115 HydrophobicContact CB-CD1 4.35Å; P91-L115 HydrophobicContact CG-CD1 3.76Å; V93-L115 HydrophobicContact CB-CD1 4.35Å; V93-L115 HydrophobicContact CG1-CD1 3.76Å; V93-L115 HydrophobicContact CG2-CD1 3.66Å; V93-L115 HydrophobicContact CG2-CD2 4.32Å; V93-L115 HydrophobicContact CG2-CG 4.15Å; K103-L115 HydrophobicContact CB-CD2 3.66Å; V104-L115 HydrophobicContact CG2-CD2 3.87Å; A107-L115 HydrophobicContact CB-CB 4.21Å; A107-L115 HydrophobicContact CB-CD1 4.02Å; A107-L115 HydrophobicContact CB-CD2 4.25Å; A107-L115 HydrophobicContact CB-CG 4.4Å; L115-I117 HydrophobicContact CD2-CD1 4.12Å; L115-I117 HydrophobicContact CD2-CG1 3.98Å; L115-I117 HydrophobicContact CG-CG1 4.08Å; L115-A137 VanDerWaalsContact O-CA 3.29Å; L115-A137 WeakPolarHBondContact O-CA 3.5Å; L115-A138 PolarHBondContact N-O 3.19Å; L115-A138 VanDerWaalsContact N-O 3.12Å
116	L	90.3	Very high	77.6	Confident	12 Å²	12	66.7 Å²	66.7	6%	0.063	33%	0.328	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.3	118.3	172	-67.5	-179	0	0	0	109.7	V30 L67 I90 P91 L92 V93 V135 S136 A137	V30-L116 HydrophobicContact CG2-CD2 4.47Å; L67-L116 HydrophobicContact CD1-CD1 3.72Å; I90-L116 HydrophobicContact CG2-CB 4.39Å; I90-L116 HydrophobicContact CG2-CD1 3.89Å; I90-L116 HydrophobicContact CG2-CG 3.62Å; P91-L116 PolarHBondContact O-N 3.45Å; L92-L116 CarbonylContact C-O 2.86Å; L92-L116 VanDerWaalsContact CA-O 3.3Å; L92-L116 WeakPolarHBondContact CA-O 3.49Å; L92-L116 HydrophobicContact CD1-CB 4.14Å; L92-L116 HydrophobicContact CD1-CD1 3.95Å; L92-L116 HydrophobicContact CG-CB 4.09Å; V93-L116 PolarHBondContact N-O 2.94Å; L116-V135 HydrophobicContact CB-CG1 3.45Å; L116-V135 VanDerWaalsContact CB-CG1 3.45Å; L116-V135 HydrophobicContact CD1-CG1 4.22Å; L116-V135 HydrophobicContact CD2-CG1 3.39Å; L116-V135 HydrophobicContact CG-CG1 3.8Å; L116-S136 WeakPolarHBondContact CA-O 3.4Å; L116-A137 HydrophobicContact CD2-CB 4.04Å
117	I	88.4	Confident	75.2	Confident	3 Å²	3	73.9 Å²	73.9	2%	0.015	36%	0.36	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.9	111	-178.7	-53.7	176.4	0	0	0	109.3	V93 R95 F100 K103 L115 V135 S136	V93-I117 HydrophobicContact CG2-CB 4.39Å; V93-I117 HydrophobicContact CG2-CG1 3.91Å; V93-I117 HydrophobicContact CG2-CG2 4.47Å; V93-I117 CarbonylContact O-C 3.58Å; V93-I117 WeakPolarHBondContact O-CA 3.32Å; R95-I117 HydrophobicContact CB-CG2 4.31Å; F100-I117 HydrophobicContact CB-CD1 4.07Å; F100-I117 HydrophobicContact CD1-CD1 3.42Å; F100-I117 VanDerWaalsContact CD1-CD1 3.42Å; F100-I117 HydrophobicContact CD1-CG2 4.41Å; F100-I117 HydrophobicContact CE1-CD1 4.1Å; F100-I117 HydrophobicContact CE1-CG2 4.11Å; F100-I117 HydrophobicContact CG-CD1 3.96Å; K103-I117 HydrophobicContact CD-CD1 3.87Å; K103-I117 HydrophobicContact CD-CG1 4.45Å; L115-I117 HydrophobicContact CD2-CD1 4.12Å; L115-I117 HydrophobicContact CD2-CG1 3.98Å; L115-I117 HydrophobicContact CG-CG1 4.08Å; I117-V135 WeakPolarHBondContact O-CA 3.47Å; I117-S136 PolarHBondContact N-O 3.4Å
118	V	84.9	Confident	72.5	Confident	52 Å²	52	75.5 Å²	75.5	32%	0.315	37%	0.374	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-89.8	126.4	179.1	-172.6	0	0	0	0	109.7	T71 L92 V93 R95	T71-V118 HydrophobicContact CG2-CG2 4.33Å; L92-V118 HydrophobicContact CB-CG2 4.24Å; L92-V118 HydrophobicContact CD2-CG2 3.97Å; L92-V118 HydrophobicContact CG-CG2 4.07Å; V93-V118 PolarHBondContact O-N 2.98Å; R95-V118 PolarHBondContact N-O 3.32Å
119	S	80.3	Confident	69.8	Low	6 Å²	6	74.2 Å²	74.2	4%	0.042	39%	0.385	C	S	.	.			trans	-122.4	134.4	176.8	-175.9	0	0	0	0	110.7	R95 E121	R95-S119 WeakPolarHBondContact CD-OG 3.47Å; S119-E121 VanDerWaalsContact CB-O 3.28Å; S119-E121 WeakPolarHBondContact CB-O 3.31Å; S119-E121 PolarHBondContact OG-N 3.46Å; S119-E121 PolarHBondContact OG-O 2.91Å
120	R	71.9	Confident	67	Low	253 Å²	253	77.2 Å²	77.2	96%	0.955	38%	0.378	S	S	*	.	S	Bend	trans	-76.5	-31	170.5	-63.6	-173.2	-174.9	-158.9	1.8	111.7
121	E	66.3	Low	64.1	Low	140 Å²	140	78.9 Å²	78.9	65%	0.654	39%	0.385	S	S	*	.	S	Bend	trans	-86.7	153.7	172.7	-64.4	172.6	-170.3	0	0	109.9	S119 L123	S119-E121 VanDerWaalsContact CB-O 3.28Å; S119-E121 WeakPolarHBondContact CB-O 3.31Å; S119-E121 PolarHBondContact OG-N 3.46Å; S119-E121 PolarHBondContact OG-O 2.91Å; E121-L123 PolarHBondContact O-N 3.45Å
122	R	56.6	Low	61.2	Low	86 Å²	86	84.8 Å²	84.8	33%	0.325	40%	0.403	S	S	.	.			trans	-60.1	133.6	174	-60.3	-167.9	-168.7	-176.2	-4.8	109.7	R95 L124 H130 L131	R95-R122 PolarHBondContact NH1-O 2.89Å; R122-L124 HydrophobicContact CB-CD2 4.34Å; R122-L124 HydrophobicContact CB-CG 4.47Å; R122-L124 PolarHBondContact O-N 3.09Å; R122-H130 VanDerWaalsContact CZ-CG 3.46Å; R122-H130 VanDerWaalsContact NH1-CA 3.25Å; R122-H130 PolarHBondContact NH1-ND1 3.29Å; R122-H130 PolarHBondContact NH2-CD2 3.44Å; R122-H130 PolarHBondContact NH2-CE1 3.27Å; R122-H130 PolarHBondContact NH2-ND1 2.97Å; R122-H130 PolarHBondContact NH2-NE2 3.48Å; R122-L131 WeakPolarHBondContact CG-O 3.5Å
123	L	54.8	Low	58.6	Low	13 Å²	13	86.4 Å²	86.4	7%	0.068	42%	0.42	C	S	.	.			trans	-72	92.9	162.5	-61.5	-173.4	0	0	0	106.1	L47 F100 E121 Q125 S134	L47-L123 HydrophobicContact CD1-CB 4.32Å; F100-L123 HydrophobicContact CE1-CD2 4.5Å; F100-L123 HydrophobicContact CZ-CD1 4.17Å; F100-L123 HydrophobicContact CZ-CD2 3.77Å; E121-L123 PolarHBondContact O-N 3.45Å; L123-Q125 VanDerWaalsContact C-N 3.28Å; L123-Q125 PolarHBondContact O-N 3.05Å; L123-S134 WeakPolarHBondContact CD1-O 3.47Å; L123-S134 PolarHBondContact N-OG 3.12Å
124	L	47.6	Very low	56.2	Low	151 Å²	151	82.1 Å²	82.1	79%	0.791	41%	0.405	S	S	*	.			trans	-69.6	90.3	172.7	-67.7	173.2	0	0	0	107.9	R122	R122-L124 HydrophobicContact CB-CD2 4.34Å; R122-L124 HydrophobicContact CB-CG 4.47Å; R122-L124 PolarHBondContact O-N 3.09Å
125	Q	46.4	Very low	54.4	Low	70 Å²	70	82.5 Å²	82.5	33%	0.327	41%	0.405	S	S	.	.			trans	-78.7	128	147.3	-88.9	162.5	-46.9	0	0	107	C25 L123 H127 A128	C25-Q125 VanDerWaalsContact SG-CD 3.55Å; C25-Q125 PolarHBondContact SG-NE2 2.97Å; C25-Q125 PolarHBondContact SG-OE1 2.99Å; L123-Q125 VanDerWaalsContact C-N 3.28Å; L123-Q125 PolarHBondContact O-N 3.05Å; Q125-H127 CarbonylContact O-C 3.58Å; Q125-H127 PolarHBondContact O-N 3.33Å; Q125-A128 PolarHBondContact O-N 3.03Å
126	R	38.6	Very low	52.7	Low	242 Å²	242	83.3 Å²	83.3	91%	0.913	41%	0.411	S	S	*	.	S	Bend	trans	-54.2	114.1	168.5	-80.1	-176.5	168.4	168.3	-2.9	106
127	H	40.6	Very low	51	Low	189 Å²	189	83.7 Å²	83.7	88%	0.875	42%	0.416	S	S	*	.	S	Bend	trans	82.9	66	-170.3	-46.1	-63.8	0	0	0	116.2	Q125	Q125-H127 CarbonylContact O-C 3.58Å; Q125-H127 PolarHBondContact O-N 3.33Å
128	A	36.4	Very low	49.1	Very low	35 Å²	35	84 Å²	84	29%	0.289	42%	0.419	S	S	.	.			trans	-158.3	122.7	153.5	0	0	0	0	0	110.4	Y27 Q125	Y27-A128 WeakPolarHBondContact OH-CB 3.33Å; Q125-A128 PolarHBondContact O-N 3.03Å
129	G	33.4	Very low	47.1	Very low	63 Å²	63	88.3 Å²	88.3	65%	0.649	43%	0.429	S	S	*	.			trans	-59.1	151.5	177	0	0	0	0	0	113	L131	G129-L131 PolarHBondContact O-N 3.49Å
130	H	31.1	Very low	45.4	Very low	138 Å²	138	92.4 Å²	92.4	64%	0.639	45%	0.449	S	S	*	.			trans	7.4	79.5	155.6	-141.7	115.2	0	0	0	118.1	R122	R122-H130 VanDerWaalsContact CZ-CG 3.46Å; R122-H130 VanDerWaalsContact NH1-CA 3.25Å; R122-H130 PolarHBondContact NH1-ND1 3.29Å; R122-H130 PolarHBondContact NH2-CD2 3.44Å; R122-H130 PolarHBondContact NH2-CE1 3.27Å; R122-H130 PolarHBondContact NH2-ND1 2.97Å; R122-H130 PolarHBondContact NH2-NE2 3.48Å
131	L	31.8	Very low	44	Very low	57 Å²	57	83.9 Å²	83.9	30%	0.298	42%	0.422	S	S	.	.			trans	-117.3	111.9	165	-73.6	163.1	0	0	0	109.5	Y27 R122 G129	Y27-L131 HydrophobicContact CE1-CD1 3.81Å; R122-L131 WeakPolarHBondContact CG-O 3.5Å; G129-L131 PolarHBondContact O-N 3.49Å
132	H	28.9	Very low	42.8	Very low	158 Å²	158	80.8 Å²	80.8	73%	0.731	41%	0.409	S	S	*	.	S	Bend	trans	-73.1	118.5	164.3	-100.5	-109	0	0	0	107.9
133	G	36.9	Very low	41.9	Very low	39 Å²	39	80.5 Å²	80.5	40%	0.402	41%	0.414	S	S	.	.	S	Bend	trans	77.6	72	177.7	0	0	0	0	0	113.5
134	S	37.5	Very low	41.1	Very low	5 Å²	5	84.8 Å²	84.8	4%	0.035	44%	0.436	C	S	.	.			trans	-83	125.9	174	-31.9	0	0	0	0	109.4	L123	L123-S134 WeakPolarHBondContact CD1-O 3.47Å; L123-S134 PolarHBondContact N-OG 3.12Å
135	V	50.1	Low	40.7	Very low	19 Å²	19	80.3 Å²	80.3	12%	0.115	41%	0.412	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.4	124.4	174.6	178.7	0	0	0	0	108.2	I46 L47 L116 I117	I46-V135 CarbonylContact C-O 3.55Å; I46-V135 WeakPolarHBondContact CA-O 3.43Å; I46-V135 VanDerWaalsContact CB-O 3.23Å; I46-V135 WeakPolarHBondContact CB-O 3.23Å; I46-V135 HydrophobicContact CG2-CB 3.93Å; I46-V135 HydrophobicContact CG2-CG1 4.11Å; L47-V135 PolarHBondContact N-O 2.97Å; L116-V135 HydrophobicContact CB-CG1 3.45Å; L116-V135 VanDerWaalsContact CB-CG1 3.45Å; L116-V135 HydrophobicContact CD1-CG1 4.22Å; L116-V135 HydrophobicContact CD2-CG1 3.39Å; L116-V135 HydrophobicContact CG-CG1 3.8Å; I117-V135 WeakPolarHBondContact O-CA 3.47Å
136	S	54	Low	40.3	Very low	19 Å²	19	81.1 Å²	81.1	13%	0.133	42%	0.418	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.3	133.4	173.8	-94.6	0	0	0	0	111.6	L47 L116 I117	L47-S136 WeakPolarHBondContact O-CA 3.3Å; L47-S136 WeakPolarHBondContact O-CB 3.3Å; L47-S136 PolarHBondContact O-OG 3.26Å; L116-S136 WeakPolarHBondContact CA-O 3.4Å; I117-S136 PolarHBondContact N-O 3.4Å
137	A	54.4	Low	40.4	Very low	19 Å²	19	68.7 Å²	68.7	16%	0.157	38%	0.38	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.5	132	176	0	0	0	0	0	111.4	I46 L47 L115 L116	I46-A137 HydrophobicContact CD1-CB 3.58Å; L47-A137 PolarHBondContact O-N 3.3Å; L115-A137 VanDerWaalsContact O-CA 3.29Å; L115-A137 WeakPolarHBondContact O-CA 3.5Å; L116-A137 HydrophobicContact CD2-CB 4.04Å
138	A	48.3	Very low	40.4	Very low	9 Å²	9	58.7 Å²	58.7	7%	0.074	34%	0.339	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.8	142.8	162.8	0	0	0	0	0	108.7	V104 G114 L115	V104-A138 HydrophobicContact CB-CB 4.13Å; V104-A138 HydrophobicContact CG1-CB 3.57Å; V104-A138 HydrophobicContact CG2-CB 3.38Å; G114-A138 CarbonylContact C-O 3.59Å; G114-A138 VanDerWaalsContact CA-O 3.25Å; G114-A138 WeakPolarHBondContact CA-O 3.42Å; L115-A138 PolarHBondContact N-O 3.19Å; L115-A138 VanDerWaalsContact N-O 3.12Å
139	R	42.3	Very low	40.8	Very low	143 Å²	143	60.8 Å²	60.8	54%	0.54	34%	0.343	S	S	.	.			trans	-84.4	0	-175	175	173.9	-154.7	-162.5	8.8	111.2	A53 Q108 R113	A53-R139 HydrophobicContact CB-CB 3.56Å; Q108-R139 PolarHBondContact NE2-O 3.29Å; R113-R139 PolarHBondContact NH2-OXT 2.98Å

Retrieved 139 of 139 residues in 37.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).