A0A087WZL4_HUMAN Loading...

EPH receptor B6

AlphaFold DB , UniProt , Accession A0A087WZL4, Species HUMAN (Homo sapiens, Human), Gene EPHB6, Length 50 aa.

						>A0A087WZL4_HUMAN|A0A087WZL4|EPHB6
MATEGAAQLGNRVAGMVCSLWVLLLVSSVLALEVGRGECSGRPATPDSDL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	48	Very low	61	Low	221 Å²	221	103.9 Å²	103.9	100%	1.089	65%	0.646	S	S	*	*				0	56.7	0	-65.5	174.9	176.4	0	0	110.5
2	A	56.4	Low	62.4	Low	98 Å²	98	109.5 Å²	109.5	81%	0.81	65%	0.646	S	S	*	*			trans	-125.2	-6.6	-176.4	0	0	0	0	0	113.6
3	T	57.3	Low	63.9	Low	119 Å²	119	107.2 Å²	107.2	73%	0.73	63%	0.634	S	S	*	*	S	Bend	trans	-89.2	-17.1	-178.3	-153.4	0	0	0	0	112.6	G5	T3-G5 VanDerWaalsContact C-N 3.33Å; T3-G5 PolarHBondContact O-N 3.5Å
4	E	55.4	Low	65.3	Low	111 Å²	111	103.7 Å²	103.7	52%	0.519	62%	0.623	S	S	.	*	H	α-helix	trans	-69.2	-31.3	-176.1	-64.8	154.4	133.9	0	0	112.1	A6 Q8	E4-A6 PolarHBondContact O-N 3.05Å; E4-Q8 WeakPolarHBondContact O-CB 3.47Å; E4-Q8 PolarHBondContact O-N 3.48Å
5	G	61.3	Low	66.7	Low	45 Å²	45	99.2 Å²	99.2	46%	0.464	61%	0.606	S	S	.	*	H	α-helix	trans	-67.3	-35.6	-178.5	0	0	0	0	0	114.1	T3 L9	T3-G5 VanDerWaalsContact C-N 3.33Å; T3-G5 PolarHBondContact O-N 3.5Å; G5-L9 PolarHBondContact O-N 3.39Å
6	A	60.4	Low	68.2	Low	77 Å²	77	101 Å²	101	64%	0.636	61%	0.607	S	S	*	*	H	α-helix	trans	-76.8	-38.3	179.7	0	0	0	0	0	112	E4 L9 G10	E4-A6 PolarHBondContact O-N 3.05Å; A6-L9 PolarHBondContact O-N 3.34Å; A6-G10 PolarHBondContact O-N 2.98Å
7	A	60.7	Low	69.5	Low	71 Å²	71	99.3 Å²	99.3	59%	0.587	60%	0.597	S	S	*	*	H	α-helix	trans	-67.3	-37.8	175.8	0	0	0	0	0	112.2	L9 N11	A7-L9 VanDerWaalsContact C-N 3.34Å; A7-L9 PolarHBondContact O-N 3.11Å; A7-N11 WeakPolarHBondContact O-CB 3.31Å; A7-N11 PolarHBondContact O-N 3.42Å; A7-N11 VanDerWaalsContact O-N 3.11Å
8	Q	61.6	Low	70.7	Confident	114 Å²	114	98.1 Å²	98.1	53%	0.533	59%	0.593	S	S	.	*	H	α-helix	trans	-65.6	-35.4	173.6	-87.4	179.6	-56.6	0	0	112.8	E4 N11 R12	E4-Q8 WeakPolarHBondContact O-CB 3.47Å; E4-Q8 PolarHBondContact O-N 3.48Å; Q8-N11 PolarHBondContact O-N 3.5Å; Q8-R12 WeakPolarHBondContact O-CB 3.49Å; Q8-R12 VanDerWaalsContact O-CG 3.29Å; Q8-R12 WeakPolarHBondContact O-CG 3.48Å; Q8-R12 PolarHBondContact O-N 2.98Å
9	L	66.9	Low	71.7	Confident	120 Å²	120	96.7 Å²	96.7	63%	0.628	59%	0.588	S	S	*	*	H	α-helix	trans	-65.8	-46.8	179.3	-145.2	99.1	0	0	0	110.9	G5 A6 A7 N11 R12 V13	G5-L9 PolarHBondContact O-N 3.39Å; A6-L9 PolarHBondContact O-N 3.34Å; A7-L9 VanDerWaalsContact C-N 3.34Å; A7-L9 PolarHBondContact O-N 3.11Å; L9-N11 VanDerWaalsContact C-N 3.33Å; L9-N11 PolarHBondContact O-N 3.24Å; L9-R12 PolarHBondContact O-N 3.43Å; L9-V13 WeakPolarHBondContact O-CG2 3.35Å; L9-V13 PolarHBondContact O-N 3Å
10	G	70.3	Confident	72.8	Confident	44 Å²	44	97.2 Å²	97.2	45%	0.454	59%	0.587	S	S	.	*	H	α-helix	trans	-60.9	-40.6	175.9	0	0	0	0	0	112.6	A6 R12 V13 A14	A6-G10 PolarHBondContact O-N 2.98Å; G10-R12 PolarHBondContact O-N 3.45Å; G10-V13 PolarHBondContact O-N 2.89Å; G10-A14 VanDerWaalsContact O-CB 3.31Å; G10-A14 WeakPolarHBondContact O-CB 3.33Å; G10-A14 PolarHBondContact O-N 3.39Å
11	N	73.1	Confident	73.9	Confident	123 Å²	123	100.5 Å²	100.5	66%	0.658	59%	0.589	S	S	*	*	H	α-helix	trans	-66.7	-36.7	177.2	-166.2	53.8	0	0	0	112.7	A7 Q8 L9 G15	A7-N11 WeakPolarHBondContact O-CB 3.31Å; A7-N11 PolarHBondContact O-N 3.42Å; A7-N11 VanDerWaalsContact O-N 3.11Å; Q8-N11 PolarHBondContact O-N 3.5Å; L9-N11 VanDerWaalsContact C-N 3.33Å; L9-N11 PolarHBondContact O-N 3.24Å; N11-G15 PolarHBondContact O-N 3.01Å
12	R	77.9	Confident	76.1	Confident	171 Å²	171	93.9 Å²	93.9	65%	0.645	56%	0.561	S	S	*	*	H	α-helix	trans	-66.4	-43.9	174.9	-76.1	177.2	-178.5	-156.3	1.8	111.9	Q8 L9 G10 G15 M16	Q8-R12 WeakPolarHBondContact O-CB 3.49Å; Q8-R12 VanDerWaalsContact O-CG 3.29Å; Q8-R12 WeakPolarHBondContact O-CG 3.48Å; Q8-R12 PolarHBondContact O-N 2.98Å; L9-R12 PolarHBondContact O-N 3.43Å; G10-R12 PolarHBondContact O-N 3.45Å; R12-G15 PolarHBondContact O-N 3.33Å; R12-M16 WeakPolarHBondContact O-CG 3.31Å; R12-M16 PolarHBondContact O-N 3.5Å
13	V	81.8	Confident	77.9	Confident	80 Å²	80	95 Å²	95	49%	0.485	55%	0.552	S	S	.	*	H	α-helix	trans	-66	-44	178.3	175.5	0	0	0	0	110.5	L9 G10 G15 M16 V17	L9-V13 WeakPolarHBondContact O-CG2 3.35Å; L9-V13 PolarHBondContact O-N 3Å; G10-V13 PolarHBondContact O-N 2.89Å; V13-G15 VanDerWaalsContact C-N 3.3Å; V13-G15 PolarHBondContact O-N 3.27Å; V13-M16 PolarHBondContact O-N 3.43Å; V13-V17 HydrophobicContact CG1-CG2 4.28Å; V13-V17 WeakPolarHBondContact O-CB 3.26Å; V13-V17 VanDerWaalsContact O-CG2 3.26Å; V13-V17 WeakPolarHBondContact O-CG2 3.48Å; V13-V17 PolarHBondContact O-N 3.18Å
14	A	83.3	Confident	79.5	Confident	58 Å²	58	94.2 Å²	94.2	48%	0.479	54%	0.543	S	S	.	.	H	α-helix	trans	-60	-40.4	175.3	0	0	0	0	0	112	G10 C18	G10-A14 VanDerWaalsContact O-CB 3.31Å; G10-A14 WeakPolarHBondContact O-CB 3.33Å; G10-A14 PolarHBondContact O-N 3.39Å; A14-C18 WeakPolarHBondContact O-CB 3.38Å; A14-C18 PolarHBondContact O-N 3.24Å
15	G	85.9	Confident	81.3	Confident	36 Å²	36	93.8 Å²	93.8	37%	0.371	54%	0.544	S	S	.	.	H	α-helix	trans	-64.4	-44	174	0	0	0	0	0	113.2	N11 R12 V13 C18 S19	N11-G15 PolarHBondContact O-N 3.01Å; R12-G15 PolarHBondContact O-N 3.33Å; V13-G15 VanDerWaalsContact C-N 3.3Å; V13-G15 PolarHBondContact O-N 3.27Å; G15-C18 PolarHBondContact O-N 3.29Å; G15-S19 PolarHBondContact O-N 2.93Å; G15-S19 PolarHBondContact O-OG 2.88Å
16	M	91.3	Very high	82.6	Confident	128 Å²	128	95.3 Å²	95.3	63%	0.631	54%	0.544	S	S	*	.	H	α-helix	trans	-62.9	-45.4	176.3	-75.1	-179.9	176.1	0	0	111.8	R12 V13 C18 S19 L20	R12-M16 WeakPolarHBondContact O-CG 3.31Å; R12-M16 PolarHBondContact O-N 3.5Å; V13-M16 PolarHBondContact O-N 3.43Å; M16-C18 VanDerWaalsContact C-N 3.33Å; M16-C18 PolarHBondContact O-N 3.02Å; M16-S19 PolarHBondContact O-N 3.29Å; M16-L20 WeakPolarHBondContact O-CD1 3.29Å; M16-L20 PolarHBondContact O-N 3Å
17	V	90.6	Very high	83.8	Confident	72 Å²	72	95.1 Å²	95.1	44%	0.436	54%	0.538	S	S	.	.	H	α-helix	trans	-61.6	-43.4	177.9	172.6	0	0	0	0	110.4	V13 S19 L20 W21	V13-V17 HydrophobicContact CG1-CG2 4.28Å; V13-V17 WeakPolarHBondContact O-CB 3.26Å; V13-V17 VanDerWaalsContact O-CG2 3.26Å; V13-V17 WeakPolarHBondContact O-CG2 3.48Å; V13-V17 PolarHBondContact O-N 3.18Å; V17-S19 PolarHBondContact O-N 3.46Å; V17-L20 PolarHBondContact O-N 2.99Å; V17-W21 VanDerWaalsContact O-CD1 3.24Å; V17-W21 PolarHBondContact O-N 3.49Å
18	C	89.8	Confident	84.9	Confident	78 Å²	78	95 Å²	95	53%	0.527	53%	0.533	S	S	.	.	H	α-helix	trans	-59.5	-47.4	176.3	-167.9	0	0	0	0	111.8	A14 G15 M16 L20 W21 V22	A14-C18 WeakPolarHBondContact O-CB 3.38Å; A14-C18 PolarHBondContact O-N 3.24Å; G15-C18 PolarHBondContact O-N 3.29Å; M16-C18 VanDerWaalsContact C-N 3.33Å; M16-C18 PolarHBondContact O-N 3.02Å; C18-L20 PolarHBondContact O-N 3.24Å; C18-W21 PolarHBondContact O-N 3.44Å; C18-V22 WeakPolarHBondContact O-CG2 3.13Å; C18-V22 PolarHBondContact O-N 3.22Å
19	S	90.4	Very high	86	Confident	71 Å²	71	94 Å²	94	50%	0.497	53%	0.534	S	S	.	.	H	α-helix	trans	-61.4	-41.3	176.7	-64	0	0	0	0	112.6	G15 M16 V17 V22 L23	G15-S19 PolarHBondContact O-N 2.93Å; G15-S19 PolarHBondContact O-OG 2.88Å; M16-S19 PolarHBondContact O-N 3.29Å; V17-S19 PolarHBondContact O-N 3.46Å; S19-V22 PolarHBondContact O-N 2.93Å; S19-L23 WeakPolarHBondContact O-CB 3.31Å; S19-L23 VanDerWaalsContact O-CG 3.31Å; S19-L23 WeakPolarHBondContact O-CG 3.48Å; S19-L23 PolarHBondContact O-N 3.39Å
20	L	93.2	Very high	86.7	Confident	106 Å²	106	93.2 Å²	93.2	56%	0.555	53%	0.53	S	S	*	.	H	α-helix	trans	-62.6	-43.8	175.2	-95.9	91.7	0	0	0	111.9	M16 V17 C18 V22 L23 L24	M16-L20 WeakPolarHBondContact O-CD1 3.29Å; M16-L20 PolarHBondContact O-N 3Å; V17-L20 PolarHBondContact O-N 2.99Å; C18-L20 PolarHBondContact O-N 3.24Å; L20-V22 PolarHBondContact O-N 3.39Å; L20-L23 PolarHBondContact O-N 2.9Å; L20-L24 WeakPolarHBondContact O-CB 3.31Å; L20-L24 PolarHBondContact O-N 2.98Å
21	W	95.6	Very high	87.1	Confident	168 Å²	168	93.8 Å²	93.8	64%	0.636	53%	0.531	S	S	*	.	H	α-helix	trans	-60.5	-44.7	177.2	-91.2	100	0	0	0	111.9	V17 C18 L24 L25	V17-W21 VanDerWaalsContact O-CD1 3.24Å; V17-W21 PolarHBondContact O-N 3.49Å; C18-W21 PolarHBondContact O-N 3.44Å; W21-L24 PolarHBondContact O-N 2.92Å; W21-L25 VanDerWaalsContact O-CG 3.31Å; W21-L25 WeakPolarHBondContact O-CG 3.44Å; W21-L25 PolarHBondContact O-N 3.36Å
22	V	95.1	Very high	87.2	Confident	81 Å²	81	94 Å²	94	49%	0.491	53%	0.532	S	S	.	.	H	α-helix	trans	-62.9	-45.5	176.9	174.9	0	0	0	0	110.9	C18 S19 L20 L24 L25 V26	C18-V22 WeakPolarHBondContact O-CG2 3.13Å; C18-V22 PolarHBondContact O-N 3.22Å; S19-V22 PolarHBondContact O-N 2.93Å; L20-V22 PolarHBondContact O-N 3.39Å; V22-L24 VanDerWaalsContact C-N 3.34Å; V22-L24 PolarHBondContact O-N 3.29Å; V22-L25 PolarHBondContact O-N 2.83Å; V22-V26 HydrophobicContact CG1-CG2 4.3Å; V22-V26 WeakPolarHBondContact O-CB 3.27Å; V22-V26 VanDerWaalsContact O-CG2 3.27Å; V22-V26 WeakPolarHBondContact O-CG2 3.47Å; V22-V26 PolarHBondContact O-N 2.92Å
23	L	93.7	Very high	86.7	Confident	121 Å²	121	92.7 Å²	92.7	63%	0.634	53%	0.533	S	S	*	.	H	α-helix	trans	-60.2	-41.9	177	-75.4	166	0	0	0	112.2	S19 L20 S27	S19-L23 WeakPolarHBondContact O-CB 3.31Å; S19-L23 VanDerWaalsContact O-CG 3.31Å; S19-L23 WeakPolarHBondContact O-CG 3.48Å; S19-L23 PolarHBondContact O-N 3.39Å; L20-L23 PolarHBondContact O-N 2.9Å; L23-S27 WeakPolarHBondContact O-CB 3.4Å; L23-S27 PolarHBondContact O-N 3.43Å
24	L	91.3	Very high	85.6	Confident	103 Å²	103	93.3 Å²	93.3	54%	0.539	54%	0.536	S	S	.	.	H	α-helix	trans	-64.6	-42.5	176.6	-94.8	156.6	0	0	0	112.5	L20 W21 V22 S28	L20-L24 WeakPolarHBondContact O-CB 3.31Å; L20-L24 PolarHBondContact O-N 2.98Å; W21-L24 PolarHBondContact O-N 2.92Å; V22-L24 VanDerWaalsContact C-N 3.34Å; V22-L24 PolarHBondContact O-N 3.29Å; L24-S28 VanDerWaalsContact O-CB 3.28Å; L24-S28 WeakPolarHBondContact O-CB 3.28Å; L24-S28 PolarHBondContact O-N 2.78Å; L24-S28 PolarHBondContact O-OG 2.82Å
25	L	92.9	Very high	84.4	Confident	103 Å²	103	92.1 Å²	92.1	54%	0.539	53%	0.53	S	S	.	.	H	α-helix	trans	-64.5	-47	176.5	-72	169.9	0	0	0	111.1	W21 V22 S28 V29	W21-L25 VanDerWaalsContact O-CG 3.31Å; W21-L25 WeakPolarHBondContact O-CG 3.44Å; W21-L25 PolarHBondContact O-N 3.36Å; V22-L25 PolarHBondContact O-N 2.83Å; L25-S28 PolarHBondContact O-N 2.88Å; L25-V29 VanDerWaalsContact O-CG2 3.31Å; L25-V29 WeakPolarHBondContact O-CG2 3.14Å; L25-V29 PolarHBondContact O-N 3.34Å
26	V	89.4	Confident	82.9	Confident	77 Å²	77	101.5 Å²	101.5	47%	0.467	55%	0.554	S	S	.	*	H	α-helix	trans	-62.7	-44.3	177.4	172.8	0	0	0	0	110.8	V22 V29 L30	V22-V26 HydrophobicContact CG1-CG2 4.3Å; V22-V26 WeakPolarHBondContact O-CB 3.27Å; V22-V26 VanDerWaalsContact O-CG2 3.27Å; V22-V26 WeakPolarHBondContact O-CG2 3.47Å; V22-V26 PolarHBondContact O-N 2.92Å; V26-V29 PolarHBondContact O-N 3.49Å; V26-L30 HydrophobicContact CG1-CD1 3.84Å; V26-L30 WeakPolarHBondContact O-CB 3.34Å; V26-L30 WeakPolarHBondContact O-CG 3.36Å; V26-L30 PolarHBondContact O-N 3.27Å
27	S	85.8	Confident	81.1	Confident	72 Å²	72	98.5 Å²	98.5	50%	0.503	56%	0.555	S	S	.	*	H	α-helix	trans	-62.5	-41.2	175.6	-174.2	0	0	0	0	111.8	L23 L30 A31	L23-S27 WeakPolarHBondContact O-CB 3.4Å; L23-S27 PolarHBondContact O-N 3.43Å; S27-L30 PolarHBondContact O-N 2.78Å; S27-A31 WeakPolarHBondContact O-CB 3.45Å; S27-A31 PolarHBondContact O-N 3.4Å
28	S	83.9	Confident	79.6	Confident	69 Å²	69	102.7 Å²	102.7	48%	0.483	57%	0.57	S	S	.	*	H	α-helix	trans	-67.9	-39.2	177.9	-61.6	0	0	0	0	112.2	L24 L25 A31 L32	L24-S28 VanDerWaalsContact O-CB 3.28Å; L24-S28 WeakPolarHBondContact O-CB 3.28Å; L24-S28 PolarHBondContact O-N 2.78Å; L24-S28 PolarHBondContact O-OG 2.82Å; L25-S28 PolarHBondContact O-N 2.88Å; S28-A31 CarbonylContact O-C 3.57Å; S28-A31 PolarHBondContact O-N 2.92Å; S28-L32 VanDerWaalsContact O-CB 3.27Å; S28-L32 WeakPolarHBondContact O-CB 3.14Å; S28-L32 PolarHBondContact O-N 3.37Å
29	V	84.8	Confident	77.7	Confident	93 Å²	93	105.2 Å²	105.2	56%	0.564	59%	0.588	S	S	*	*	H	α-helix	trans	-65.7	-44.5	174.2	171.1	0	0	0	0	110.4	L25 V26 A31 L32 E33	L25-V29 VanDerWaalsContact O-CG2 3.31Å; L25-V29 WeakPolarHBondContact O-CG2 3.14Å; L25-V29 PolarHBondContact O-N 3.34Å; V26-V29 PolarHBondContact O-N 3.49Å; V29-A31 VanDerWaalsContact C-N 3.34Å; V29-A31 PolarHBondContact O-N 3.2Å; V29-L32 WeakPolarHBondContact O-CB 3.17Å; V29-L32 PolarHBondContact O-N 2.96Å; V29-E33 WeakPolarHBondContact O-CG 3.18Å; V29-E33 PolarHBondContact O-N 3.49Å
30	L	81.1	Confident	76.1	Confident	103 Å²	103	106.6 Å²	106.6	54%	0.539	60%	0.597	S	S	.	*	H	α-helix	trans	-61.3	-43	173.8	-78.4	164.5	0	0	0	111.4	V26 S27 L32 E33 V34	V26-L30 HydrophobicContact CG1-CD1 3.84Å; V26-L30 WeakPolarHBondContact O-CB 3.34Å; V26-L30 WeakPolarHBondContact O-CG 3.36Å; V26-L30 PolarHBondContact O-N 3.27Å; S27-L30 PolarHBondContact O-N 2.78Å; L30-L32 VanDerWaalsContact C-N 3.31Å; L30-L32 PolarHBondContact O-N 3.39Å; L30-E33 PolarHBondContact O-N 2.74Å; L30-V34 WeakPolarHBondContact O-CB 3.47Å; L30-V34 WeakPolarHBondContact O-CG2 3.27Å; L30-V34 PolarHBondContact O-N 3.3Å
31	A	78.9	Confident	74.3	Confident	57 Å²	57	104.9 Å²	104.9	47%	0.471	61%	0.605	S	S	.	*	H	α-helix	trans	-71.1	-24.6	176.6	0	0	0	0	0	112.6	S27 S28 V29 G35	S27-A31 WeakPolarHBondContact O-CB 3.45Å; S27-A31 PolarHBondContact O-N 3.4Å; S28-A31 CarbonylContact O-C 3.57Å; S28-A31 PolarHBondContact O-N 2.92Å; V29-A31 VanDerWaalsContact C-N 3.34Å; V29-A31 PolarHBondContact O-N 3.2Å; A31-G35 WeakPolarHBondContact O-CA 3.36Å; A31-G35 PolarHBondContact O-N 2.77Å
32	L	74.1	Confident	72.2	Confident	128 Å²	128	107.6 Å²	107.6	67%	0.67	62%	0.615	S	S	*	*	H	α-helix	trans	-73.1	-41.8	172.4	-163.8	89.3	0	0	0	110.5	S28 V29 L30	S28-L32 VanDerWaalsContact O-CB 3.27Å; S28-L32 WeakPolarHBondContact O-CB 3.14Å; S28-L32 PolarHBondContact O-N 3.37Å; V29-L32 WeakPolarHBondContact O-CB 3.17Å; V29-L32 PolarHBondContact O-N 2.96Å; L30-L32 VanDerWaalsContact C-N 3.31Å; L30-L32 PolarHBondContact O-N 3.39Å
33	E	67.1	Low	70.1	Confident	143 Å²	143	108.9 Å²	108.9	67%	0.668	63%	0.625	S	S	*	*	H	α-helix	trans	-69.1	-43.5	175.3	-73.2	-68.4	117.3	0	0	111.7	V29 L30	V29-E33 WeakPolarHBondContact O-CG 3.18Å; V29-E33 PolarHBondContact O-N 3.49Å; L30-E33 PolarHBondContact O-N 2.74Å
34	V	60.2	Low	68.4	Low	93 Å²	93	107.5 Å²	107.5	56%	0.564	63%	0.631	S	S	*	*	H	α-helix	trans	-81.6	-32.2	-179.1	176.1	0	0	0	0	111.9	L30 R36 G37	L30-V34 WeakPolarHBondContact O-CB 3.47Å; L30-V34 WeakPolarHBondContact O-CG2 3.27Å; L30-V34 PolarHBondContact O-N 3.3Å; V34-R36 PolarHBondContact O-N 2.69Å; V34-G37 WeakPolarHBondContact O-CA 3.06Å; V34-G37 PolarHBondContact O-N 2.82Å
35	G	56.8	Low	66.9	Low	33 Å²	33	108 Å²	108	34%	0.34	64%	0.639	S	S	.	*	H	α-helix	trans	-72.1	-13.1	179.6	0	0	0	0	0	113.8	A31 G37	A31-G35 WeakPolarHBondContact O-CA 3.36Å; A31-G35 PolarHBondContact O-N 2.77Å; G35-G37 PolarHBondContact O-N 3.33Å
36	R	54.7	Low	65.4	Low	233 Å²	233	108.7 Å²	108.7	88%	0.879	65%	0.649	S	S	*	*	T	Hydrogen-bonded Turn	trans	-67.5	-11.8	161	-104.1	172.7	63.4	152.8	-2.3	113.4	V34	V34-R36 PolarHBondContact O-N 2.69Å
37	G	54	Low	64	Low	64 Å²	64	110.9 Å²	110.9	66%	0.66	66%	0.659	S	S	*	*	S	Bend	trans	-102.8	-16.4	176.5	0	0	0	0	0	115.1	V34 G35	V34-G37 WeakPolarHBondContact O-CA 3.06Å; V34-G37 PolarHBondContact O-N 2.82Å; G35-G37 PolarHBondContact O-N 3.33Å
38	E	58.3	Low	62.6	Low	160 Å²	160	112.6 Å²	112.6	75%	0.748	67%	0.671	S	S	*	*			trans	-114.9	23.8	-170.9	-145.4	177.3	94	0	0	114.8	S40	E38-S40 PolarHBondContact O-N 3.38Å
39	C	51.1	Low	61.4	Low	132 Å²	132	115.7 Å²	115.7	89%	0.892	68%	0.682	S	S	*	*			trans	-87.8	34.8	158.5	-70.1	0	0	0	0	112.5
40	S	55.2	Low	60.1	Low	100 Å²	100	123 Å²	123	70%	0.699	72%	0.716	S	S	*	*			trans	-121.8	36.3	163.3	-169.8	0	0	0	0	111.4	E38 R42	E38-S40 PolarHBondContact O-N 3.38Å; S40-R42 PolarHBondContact O-N 2.93Å
41	G	55.3	Low	59	Low	70 Å²	70	124 Å²	124	72%	0.722	73%	0.725	S	S	*	*			trans	-71.9	62	159.3	0	0	0	0	0	110.8	P43	G41-P43 WeakPolarHBondContact O-CD 3.36Å
42	R	52.4	Low	58	Low	224 Å²	224	127.5 Å²	127.5	85%	0.845	74%	0.738	S	S	*	*			trans	-90.3	107.1	162.6	-150.7	171.5	-178.5	165.1	-1.4	104.6	S40 A44	S40-R42 PolarHBondContact O-N 2.93Å; R42-A44 VanDerWaalsContact C-N 3.34Å; R42-A44 PolarHBondContact O-N 2.9Å
43	P	51.5	Low	57.1	Low	109 Å²	109	127.5 Å²	127.5	71%	0.708	74%	0.742	S	S	*	*			trans	-58.8	110.8	164.3	25.3	-30	0	0	0	104.9	G41 T45	G41-P43 WeakPolarHBondContact O-CD 3.36Å; P43-T45 PolarHBondContact O-N 2.79Å
44	A	56.5	Low	56.5	Low	92 Å²	92	126.6 Å²	126.6	76%	0.76	75%	0.747	S	S	*	*			trans	-62.4	94.3	169.5	0	0	0	0	0	105.5	R42 P46	R42-A44 VanDerWaalsContact C-N 3.34Å; R42-A44 PolarHBondContact O-N 2.9Å; A44-P46 WeakPolarHBondContact O-CD 3.18Å
45	T	60.6	Low	56.2	Low	113 Å²	113	128.7 Å²	128.7	69%	0.693	76%	0.758	S	S	*	*			trans	-58.4	116.6	157.6	47.2	0	0	0	0	104.9	P43 D47	P43-T45 PolarHBondContact O-N 2.79Å; T45-D47 PolarHBondContact O-N 2.81Å
46	P	61.9	Low	56.2	Low	117 Å²	117	135.1 Å²	135.1	76%	0.76	79%	0.786	S	S	*	*			trans	-70.4	80.9	159.7	31.2	-29.1	0	0	0	105.4	A44 S48	A44-P46 WeakPolarHBondContact O-CD 3.18Å; P46-S48 PolarHBondContact O-N 3.03Å
47	D	60.7	Low	56.3	Low	124 Å²	124	128.1 Å²	128.1	66%	0.663	78%	0.779	S	S	*	*			trans	-68.7	91.9	151.6	-158.8	-74.1	0	0	0	104	T45	T45-D47 PolarHBondContact O-N 2.81Å
48	S	54.8	Low	56.5	Low	108 Å²	108	133 Å²	133	76%	0.755	79%	0.788	S	S	*	*			trans	-126.7	62.5	166.3	-63.1	0	0	0	0	105.8	P46	P46-S48 PolarHBondContact O-N 3.03Å
49	D	60	Low	56.3	Low	134 Å²	134	130.8 Å²	130.8	72%	0.717	79%	0.792	S	S	*	*			trans	-80.8	92.2	150.7	-80.4	-67.4	0	0	0	108
50	L	55.7	Low	56.8	Low	246 Å²	246	130.6 Å²	130.6	100%	1.288	78%	0.783	S	S	*	*			trans	173.7	0	136.8	-121.4	98.3	0	0	0	111.8

Retrieved 50 of 50 residues in 215.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).