A0A087WZL6_HUMAN Loading...

Catenin alpha 1

AlphaFold DB , UniProt , Accession A0A087WZL6, Species HUMAN (Homo sapiens, Human), Gene CTNNA1, Length 64 aa.

						>A0A087WZL6_HUMAN|A0A087WZL6|CTNNA1
MTKKTRDLRRQLRKAVMDHVSDSFLETNVPLLVLIEAAKNGNEKEVKEYAQVFREHANKLIEGI
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	60.2	Low	83.5	Confident	217 Å²	217	135.3 Å²	135.3	100%	1.069	63%	0.625	S	S	*	*				0	-2.7	0	-66.4	-160.6	93.9	0	0	114.8	T5	M1-T5 PolarHBondContact O-OG1 3.26Å
2	T	69.9	Low	83.7	Confident	123 Å²	123	132.8 Å²	132.8	76%	0.755	62%	0.619	S	S	*	*	H	α-helix	trans	-78.3	-26.9	-178.7	28.1	0	0	0	0	115.3	T5 R6	T2-T5 PolarHBondContact O-OG1 3.47Å; T2-R6 WeakPolarHBondContact O-CB 3.32Å; T2-R6 PolarHBondContact O-N 3.07Å; T2-R6 VanDerWaalsContact O-N 3.14Å
3	K	80.9	Confident	83.8	Confident	148 Å²	148	135.6 Å²	135.6	64%	0.643	62%	0.62	S	S	*	*	H	α-helix	trans	-67.1	-46.9	178.9	-109	-177.8	177.6	179.5	0	112.8	R6 D7	K3-R6 WeakPolarHBondContact O-CB 3.36Å; K3-R6 PolarHBondContact O-N 3.37Å; K3-D7 PolarHBondContact O-N 3.08Å
4	K	82.7	Confident	84.1	Confident	179 Å²	179	135.3 Å²	135.3	78%	0.778	62%	0.617	S	S	*	*	H	α-helix	trans	-64.5	-41.4	-178.3	-68.7	-167.2	176.5	-173.6	0	112.4	D7 L8	K4-D7 PolarHBondContact O-N 2.92Å; K4-L8 WeakPolarHBondContact O-CB 3.32Å; K4-L8 PolarHBondContact O-N 3.41Å
5	T	86.7	Confident	83.8	Confident	79 Å²	79	130.3 Å²	130.3	49%	0.485	61%	0.609	S	S	.	*	H	α-helix	trans	-68	-35.8	175.4	26.3	0	0	0	0	112.6	M1 T2 R9	M1-T5 PolarHBondContact O-OG1 3.26Å; T2-T5 PolarHBondContact O-OG1 3.47Å; T5-R9 WeakPolarHBondContact O-CB 3.49Å; T5-R9 PolarHBondContact O-N 3.27Å
6	R	87.7	Confident	83.3	Confident	143 Å²	143	128.1 Å²	128.1	54%	0.54	61%	0.607	S	S	.	*	H	α-helix	trans	-64.9	-43.5	172.7	-176.2	-170.6	67.7	177.6	5.5	112	T2 K3 R9 R10	T2-R6 WeakPolarHBondContact O-CB 3.32Å; T2-R6 PolarHBondContact O-N 3.07Å; T2-R6 VanDerWaalsContact O-N 3.14Å; K3-R6 WeakPolarHBondContact O-CB 3.36Å; K3-R6 PolarHBondContact O-N 3.37Å; R6-R9 PolarHBondContact O-N 3.29Å; R6-R10 PolarHBondContact O-N 3.36Å
7	D	91.4	Very high	82.9	Confident	55 Å²	55	128.3 Å²	128.3	29%	0.294	61%	0.609	S	S	.	*	H	α-helix	trans	-69.5	-39.2	180	-72.7	-19.8	0	0	0	111.8	K3 K4 R9 R10 Q11	K3-D7 PolarHBondContact O-N 3.08Å; K4-D7 PolarHBondContact O-N 2.92Å; D7-R9 PolarHBondContact O-N 3.41Å; D7-R10 WeakPolarHBondContact O-CB 3.31Å; D7-R10 PolarHBondContact O-N 3.11Å; D7-R10 VanDerWaalsContact O-N 3.15Å; D7-R10 IonicContact OD1-NH1 3.35Å; D7-R10 PolarHBondContact OD1-NH1 2.99Å; D7-Q11 WeakPolarHBondContact O-CG 3.45Å; D7-Q11 PolarHBondContact O-N 3.38Å
8	L	88.5	Confident	82.6	Confident	95 Å²	95	125.4 Å²	125.4	50%	0.497	60%	0.598	S	S	.	*	H	α-helix	trans	-59.5	-45.7	172	-178.7	63.8	0	0	0	111.5	K4 R10 Q11 L12	K4-L8 WeakPolarHBondContact O-CB 3.32Å; K4-L8 PolarHBondContact O-N 3.41Å; L8-R10 VanDerWaalsContact C-N 3.25Å; L8-R10 PolarHBondContact O-N 3.02Å; L8-Q11 PolarHBondContact O-N 3.48Å; L8-L12 HydrophobicContact CD1-CD1 4.44Å; L8-L12 HydrophobicContact CD1-CG 4.49Å; L8-L12 HydrophobicContact CG-CD1 4.14Å; L8-L12 WeakPolarHBondContact O-CG 3.28Å; L8-L12 PolarHBondContact O-N 3.45Å
9	R	86.9	Confident	82.2	Confident	152 Å²	152	123.9 Å²	123.9	57%	0.574	59%	0.59	S	S	*	*	H	α-helix	trans	-61.1	-35.3	176.2	-167.8	-179.2	-65.6	156.3	-2.1	112	T5 R6 D7 R13	T5-R9 WeakPolarHBondContact O-CB 3.49Å; T5-R9 PolarHBondContact O-N 3.27Å; R6-R9 PolarHBondContact O-N 3.29Å; D7-R9 PolarHBondContact O-N 3.41Å; R9-R13 WeakPolarHBondContact O-CG 3.27Å; R9-R13 PolarHBondContact O-N 3.33Å
10	R	92.3	Very high	81.5	Confident	168 Å²	168	120.7 Å²	120.7	63%	0.634	58%	0.578	S	S	*	*	H	α-helix	trans	-67.8	-44.1	175.2	-165.6	-179.5	99.8	-131.9	9.9	111.6	R6 D7 L8 R13 K14	R6-R10 PolarHBondContact O-N 3.36Å; D7-R10 WeakPolarHBondContact O-CB 3.31Å; D7-R10 PolarHBondContact O-N 3.11Å; D7-R10 VanDerWaalsContact O-N 3.15Å; D7-R10 IonicContact OD1-NH1 3.35Å; D7-R10 PolarHBondContact OD1-NH1 2.99Å; L8-R10 VanDerWaalsContact C-N 3.25Å; L8-R10 PolarHBondContact O-N 3.02Å; R10-R13 PolarHBondContact O-N 3.28Å; R10-K14 PolarHBondContact O-N 3.25Å
11	Q	91.2	Very high	81.2	Confident	129 Å²	129	118 Å²	118	60%	0.603	57%	0.573	S	S	*	*	H	α-helix	trans	-63.6	-43.7	178.4	-73.3	177.2	-1.1	0	0	111.9	D7 L8 R13 K14 A15	D7-Q11 WeakPolarHBondContact O-CG 3.45Å; D7-Q11 PolarHBondContact O-N 3.38Å; L8-Q11 PolarHBondContact O-N 3.48Å; Q11-R13 PolarHBondContact O-N 2.88Å; Q11-K14 PolarHBondContact O-N 2.94Å; Q11-A15 PolarHBondContact O-N 3.18Å
12	L	86.1	Confident	81.8	Confident	106 Å²	106	113.3 Å²	113.3	56%	0.555	55%	0.552	S	S	*	*	H	α-helix	trans	-61.9	-43.8	176.7	-71.1	168.9	0	0	0	112.1	L8 K14 A15 V16	L8-L12 HydrophobicContact CD1-CD1 4.44Å; L8-L12 HydrophobicContact CD1-CG 4.49Å; L8-L12 HydrophobicContact CG-CD1 4.14Å; L8-L12 WeakPolarHBondContact O-CG 3.28Å; L8-L12 PolarHBondContact O-N 3.45Å; L12-K14 VanDerWaalsContact C-N 3.3Å; L12-K14 PolarHBondContact O-N 3.19Å; L12-A15 PolarHBondContact O-N 3.49Å; L12-V16 WeakPolarHBondContact O-CG2 3.41Å; L12-V16 PolarHBondContact O-N 3.4Å
13	R	85.4	Confident	81.6	Confident	169 Å²	169	108.8 Å²	108.8	64%	0.638	53%	0.525	S	S	*	.	H	α-helix	trans	-62.1	-38.8	174.9	-73.4	177.8	-169.5	172.2	-1.3	112.5	R9 R10 Q11 M17	R9-R13 WeakPolarHBondContact O-CG 3.27Å; R9-R13 PolarHBondContact O-N 3.33Å; R10-R13 PolarHBondContact O-N 3.28Å; Q11-R13 PolarHBondContact O-N 2.88Å; R13-M17 WeakPolarHBondContact O-CB 3.48Å; R13-M17 PolarHBondContact O-N 3.29Å
14	K	87.5	Confident	80.7	Confident	131 Å²	131	107.3 Å²	107.3	57%	0.57	52%	0.519	S	S	*	.	H	α-helix	trans	-66.8	-44.8	177.8	-166.4	-177.6	174.7	-171.8	0	111	R10 Q11 L12 V16 M17 D18	R10-K14 PolarHBondContact O-N 3.25Å; Q11-K14 PolarHBondContact O-N 2.94Å; L12-K14 VanDerWaalsContact C-N 3.3Å; L12-K14 PolarHBondContact O-N 3.19Å; K14-V16 VanDerWaalsContact C-N 3.32Å; K14-V16 PolarHBondContact O-N 3.12Å; K14-M17 PolarHBondContact O-N 2.92Å; K14-M17 VanDerWaalsContact O-N 3.13Å; K14-D18 WeakPolarHBondContact O-CB 3.04Å; K14-D18 PolarHBondContact O-N 3.34Å
15	A	80.3	Confident	79.9	Confident	60 Å²	60	104.9 Å²	104.9	50%	0.496	51%	0.514	S	S	.	.	H	α-helix	trans	-60.1	-40.7	177.4	0	0	0	0	0	112.7	Q11 L12 H19	Q11-A15 PolarHBondContact O-N 3.18Å; L12-A15 PolarHBondContact O-N 3.49Å; A15-H19 WeakPolarHBondContact O-CB 3.47Å; A15-H19 PolarHBondContact O-N 2.98Å
16	V	75.1	Confident	78.7	Confident	96 Å²	96	107.3 Å²	107.3	58%	0.582	52%	0.52	S	S	*	.	H	α-helix	trans	-65.5	-44	174	174.1	0	0	0	0	111.1	L12 K14 H19 V20	L12-V16 WeakPolarHBondContact O-CG2 3.41Å; L12-V16 PolarHBondContact O-N 3.4Å; K14-V16 VanDerWaalsContact C-N 3.32Å; K14-V16 PolarHBondContact O-N 3.12Å; V16-H19 PolarHBondContact O-N 3.35Å; V16-V20 HydrophobicContact CG1-CG2 4.36Å; V16-V20 WeakPolarHBondContact O-CB 3.32Å; V16-V20 VanDerWaalsContact O-CG2 3.27Å; V16-V20 WeakPolarHBondContact O-CG2 3.47Å; V16-V20 PolarHBondContact O-N 3.05Å
17	M	76.4	Confident	77.5	Confident	131 Å²	131	102.4 Å²	102.4	65%	0.645	51%	0.506	S	S	*	.	H	α-helix	trans	-65.3	-41.2	178.9	-173.2	179.7	-65.1	0	0	112.6	R13 K14 H19 V20 S21	R13-M17 WeakPolarHBondContact O-CB 3.48Å; R13-M17 PolarHBondContact O-N 3.29Å; K14-M17 PolarHBondContact O-N 2.92Å; K14-M17 VanDerWaalsContact O-N 3.13Å; M17-H19 VanDerWaalsContact C-N 3.35Å; M17-V20 PolarHBondContact O-N 3Å; M17-S21 VanDerWaalsContact O-CB 3.27Å; M17-S21 WeakPolarHBondContact O-CB 3.27Å; M17-S21 PolarHBondContact O-N 3.22Å
18	D	77.8	Confident	76.3	Confident	76 Å²	76	104.8 Å²	104.8	41%	0.406	52%	0.518	S	S	.	.	H	α-helix	trans	-62.5	-45	175.9	-66.4	-16.5	0	0	0	109.2	K14 V20 S21 D22	K14-D18 WeakPolarHBondContact O-CB 3.04Å; K14-D18 PolarHBondContact O-N 3.34Å; D18-V20 PolarHBondContact O-N 3.2Å; D18-S21 PolarHBondContact O-N 3.18Å; D18-D22 WeakPolarHBondContact O-CB 3.46Å; D18-D22 PolarHBondContact O-N 3.09Å
19	H	74.4	Confident	75.8	Confident	97 Å²	97	103.4 Å²	103.4	45%	0.449	51%	0.514	S	S	.	.	H	α-helix	trans	-64.2	-41.4	176.9	-174.9	52	0	0	0	113.6	A15 V16 M17 S23	A15-H19 WeakPolarHBondContact O-CB 3.47Å; A15-H19 PolarHBondContact O-N 2.98Å; V16-H19 PolarHBondContact O-N 3.35Å; M17-H19 VanDerWaalsContact C-N 3.35Å; H19-S23 VanDerWaalsContact O-CB 3.25Å; H19-S23 WeakPolarHBondContact O-CB 3.15Å; H19-S23 PolarHBondContact O-N 3.18Å; H19-S23 PolarHBondContact O-OG 3.48Å
20	V	69.2	Low	75.4	Confident	59 Å²	59	97.2 Å²	97.2	36%	0.358	49%	0.493	S	S	.	.	H	α-helix	trans	-65.9	-43.9	174.3	170.8	0	0	0	0	110.3	V16 M17 D18 D22 S23 F24	V16-V20 HydrophobicContact CG1-CG2 4.36Å; V16-V20 WeakPolarHBondContact O-CB 3.32Å; V16-V20 VanDerWaalsContact O-CG2 3.27Å; V16-V20 WeakPolarHBondContact O-CG2 3.47Å; V16-V20 PolarHBondContact O-N 3.05Å; M17-V20 PolarHBondContact O-N 3Å; D18-V20 PolarHBondContact O-N 3.2Å; V20-D22 PolarHBondContact O-N 2.83Å; V20-S23 PolarHBondContact O-N 3.12Å; V20-F24 HydrophobicContact CG1-CD2 3.75Å; V20-F24 HydrophobicContact CG1-CE2 4.06Å; V20-F24 WeakPolarHBondContact O-CB 3.4Å; V20-F24 VanDerWaalsContact O-CD2 3.22Å; V20-F24 WeakPolarHBondContact O-CD2 3.46Å; V20-F24 PolarHBondContact O-N 3.46Å
21	S	73.8	Confident	74.8	Confident	66 Å²	66	92.5 Å²	92.5	46%	0.462	48%	0.48	S	S	.	.	H	α-helix	trans	-62.3	-42.7	179.5	-164.7	0	0	0	0	111.9	M17 D18 L25	M17-S21 VanDerWaalsContact O-CB 3.27Å; M17-S21 WeakPolarHBondContact O-CB 3.27Å; M17-S21 PolarHBondContact O-N 3.22Å; D18-S21 PolarHBondContact O-N 3.18Å; S21-L25 WeakPolarHBondContact O-CB 3.27Å; S21-L25 WeakPolarHBondContact O-CD1 3.33Å; S21-L25 WeakPolarHBondContact O-CG 3.22Å; S21-L25 PolarHBondContact O-N 3.48Å
22	D	73.8	Confident	74.3	Confident	118 Å²	118	91.6 Å²	91.6	63%	0.631	48%	0.479	S	S	*	.	H	α-helix	trans	-67.5	-42.1	177.2	-72.4	-14.7	0	0	0	111.7	D18 V20 F24	D18-D22 WeakPolarHBondContact O-CB 3.46Å; D18-D22 PolarHBondContact O-N 3.09Å; V20-D22 PolarHBondContact O-N 2.83Å; D22-F24 VanDerWaalsContact C-N 3.35Å; D22-F24 PolarHBondContact O-N 3.15Å
23	S	66.1	Low	74.2	Confident	28 Å²	28	89 Å²	89	20%	0.196	47%	0.468	C	S	.	.	H	α-helix	trans	-71.9	-28.4	-177.9	-57	0	0	0	0	112.8	H19 V20 T27	H19-S23 VanDerWaalsContact O-CB 3.25Å; H19-S23 WeakPolarHBondContact O-CB 3.15Å; H19-S23 PolarHBondContact O-N 3.18Å; H19-S23 PolarHBondContact O-OG 3.48Å; V20-S23 PolarHBondContact O-N 3.12Å; S23-T27 WeakPolarHBondContact O-CG2 3.48Å
24	F	62.3	Low	74	Confident	117 Å²	117	82.5 Å²	82.5	51%	0.513	45%	0.445	S	S	.	.	H	α-helix	trans	-97.5	-6.1	-177.1	-79.4	-97.7	0	0	0	115	V20 D22 E26 T27 L60	V20-F24 HydrophobicContact CG1-CD2 3.75Å; V20-F24 HydrophobicContact CG1-CE2 4.06Å; V20-F24 WeakPolarHBondContact O-CB 3.4Å; V20-F24 VanDerWaalsContact O-CD2 3.22Å; V20-F24 WeakPolarHBondContact O-CD2 3.46Å; V20-F24 PolarHBondContact O-N 3.46Å; D22-F24 VanDerWaalsContact C-N 3.35Å; D22-F24 PolarHBondContact O-N 3.15Å; F24-E26 VanDerWaalsContact C-N 3.34Å; F24-E26 PolarHBondContact O-N 3.33Å; F24-T27 HydrophobicContact CB-CG2 4.49Å; F24-T27 HydrophobicContact CD1-CG2 4.1Å; F24-T27 HydrophobicContact CG-CG2 4.38Å; F24-L60 HydrophobicContact CD2-CD2 4.41Å; F24-L60 HydrophobicContact CE2-CD2 4.2Å; F24-L60 HydrophobicContact CZ-CD2 4.42Å
25	L	64.1	Low	73.6	Confident	127 Å²	127	79.8 Å²	79.8	67%	0.665	44%	0.436	S	S	*	.	T	Hydrogen-bonded Turn	trans	-67.2	-29.4	178.9	-99.9	161.4	0	0	0	113.4	S21	S21-L25 WeakPolarHBondContact O-CB 3.27Å; S21-L25 WeakPolarHBondContact O-CD1 3.33Å; S21-L25 WeakPolarHBondContact O-CG 3.22Å; S21-L25 PolarHBondContact O-N 3.48Å
26	E	61.7	Low	73.7	Confident	131 Å²	131	81.3 Å²	81.3	61%	0.612	43%	0.433	S	S	*	.	T	Hydrogen-bonded Turn	trans	-136.5	35.3	-174.6	-67.1	-168.5	179.5	0	0	114.4	F24 N28 V29 P30	F24-E26 VanDerWaalsContact C-N 3.34Å; F24-E26 PolarHBondContact O-N 3.33Å; E26-N28 PolarHBondContact O-N 3.25Å; E26-N28 VanDerWaalsContact O-N 3.09Å; E26-V29 HydrophobicContact CB-CB 4.35Å; E26-V29 HydrophobicContact CB-CG2 3.79Å; E26-V29 HydrophobicContact CG-CG2 4.14Å; E26-V29 PolarHBondContact O-N 2.88Å; E26-P30 WeakPolarHBondContact O-CD 3.4Å
27	T	64	Low	74	Confident	39 Å²	39	77 Å²	77	24%	0.239	41%	0.407	C	S	.	.	T	Hydrogen-bonded Turn	trans	-59.5	-25.5	-177	50.2	0	0	0	0	115	S23 F24 L60	S23-T27 WeakPolarHBondContact O-CG2 3.48Å; F24-T27 HydrophobicContact CB-CG2 4.49Å; F24-T27 HydrophobicContact CD1-CG2 4.1Å; F24-T27 HydrophobicContact CG-CG2 4.38Å; T27-L60 HydrophobicContact CG2-CD1 4.03Å; T27-L60 HydrophobicContact CG2-CD2 4.09Å
28	N	66.1	Low	74.2	Confident	105 Å²	105	73.4 Å²	73.4	56%	0.561	40%	0.399	S	S	*	.	T	Hydrogen-bonded Turn	trans	-91.4	-14.8	-176.9	-63	-36.3	0	0	0	113.4	E26 L31 L32	E26-N28 PolarHBondContact O-N 3.25Å; E26-N28 VanDerWaalsContact O-N 3.09Å; N28-L31 PolarHBondContact O-N 2.9Å; N28-L32 HydrophobicContact CB-CD1 4.37Å; N28-L32 WeakPolarHBondContact O-CB 3.46Å; N28-L32 VanDerWaalsContact O-CG 3.28Å; N28-L32 WeakPolarHBondContact O-CG 3.43Å; N28-L32 PolarHBondContact O-N 3.43Å
29	V	77.3	Confident	74.4	Confident	67 Å²	67	77 Å²	77	41%	0.406	41%	0.411	S	S	.	.	H	α-helix	trans	-63.4	-47.2	-173.7	177.1	0	0	0	0	111.7	E26 L31 L32 V33	E26-V29 HydrophobicContact CB-CB 4.35Å; E26-V29 HydrophobicContact CB-CG2 3.79Å; E26-V29 HydrophobicContact CG-CG2 4.14Å; E26-V29 PolarHBondContact O-N 2.88Å; V29-L31 VanDerWaalsContact C-N 3.26Å; V29-L31 PolarHBondContact O-N 3.27Å; V29-L32 PolarHBondContact O-N 3.44Å; V29-V33 HydrophobicContact CG1-CG2 4.35Å; V29-V33 WeakPolarHBondContact O-CG2 3.41Å; V29-V33 PolarHBondContact O-N 3.34Å
30	P	78.5	Confident	75.1	Confident	22 Å²	22	77.6 Å²	77.6	14%	0.143	42%	0.417	C	S	.	.	H	α-helix	trans	-64.5	-31.3	179.2	-21.3	34.6	0	0	0	112.9	E26 L34 F53 H56	E26-P30 WeakPolarHBondContact O-CD 3.4Å; P30-L34 WeakPolarHBondContact O-CB 3.25Å; P30-L34 PolarHBondContact O-N 2.99Å; P30-F53 HydrophobicContact CB-CB 4.33Å; P30-F53 HydrophobicContact CB-CD2 4.14Å; P30-H56 HydrophobicContact CG-CB 4.18Å
31	L	79.6	Confident	75.9	Confident	68 Å²	68	77.6 Å²	77.6	36%	0.356	43%	0.429	S	S	.	.	H	α-helix	trans	-72.5	-42.5	176.2	-176.9	59.7	0	0	0	111.9	N28 V29 L34 I35 F53	N28-L31 PolarHBondContact O-N 2.9Å; V29-L31 VanDerWaalsContact C-N 3.26Å; V29-L31 PolarHBondContact O-N 3.27Å; L31-L34 PolarHBondContact O-N 2.93Å; L31-I35 HydrophobicContact CD1-CD1 4.32Å; L31-I35 HydrophobicContact CG-CD1 4.04Å; L31-I35 VanDerWaalsContact O-CG1 3.27Å; L31-I35 WeakPolarHBondContact O-CG1 3.38Å; L31-I35 PolarHBondContact O-N 3.29Å; L31-F53 HydrophobicContact CB-CD2 4.06Å; L31-F53 HydrophobicContact CB-CE2 3.82Å; L31-F53 HydrophobicContact CD1-CD2 4.48Å; L31-F53 HydrophobicContact CD1-CE2 4.09Å; L31-F53 HydrophobicContact CD1-CZ 4.29Å; L31-F53 HydrophobicContact CG-CE2 4.4Å
32	L	80.8	Confident	76.4	Confident	110 Å²	110	77.2 Å²	77.2	58%	0.576	42%	0.422	S	S	*	.	H	α-helix	trans	-65	-41	178.3	-71.4	172.2	0	0	0	111.9	N28 V29 L34 I35 E36	N28-L32 HydrophobicContact CB-CD1 4.37Å; N28-L32 WeakPolarHBondContact O-CB 3.46Å; N28-L32 VanDerWaalsContact O-CG 3.28Å; N28-L32 WeakPolarHBondContact O-CG 3.43Å; N28-L32 PolarHBondContact O-N 3.43Å; V29-L32 PolarHBondContact O-N 3.44Å; L32-L34 VanDerWaalsContact C-N 3.35Å; L32-I35 PolarHBondContact O-N 2.82Å; L32-E36 PolarHBondContact O-N 2.94Å
33	V	83.2	Confident	77	Confident	53 Å²	53	78.7 Å²	78.7	32%	0.321	43%	0.425	S	S	.	.	H	α-helix	trans	-63.9	-40.8	175.8	175.2	0	0	0	0	111.2	V29 E36 A37 Y49	V29-V33 HydrophobicContact CG1-CG2 4.35Å; V29-V33 WeakPolarHBondContact O-CG2 3.41Å; V29-V33 PolarHBondContact O-N 3.34Å; V33-E36 PolarHBondContact O-N 3.48Å; V33-A37 PolarHBondContact O-N 3.37Å; V33-Y49 HydrophobicContact CG1-CD1 3.52Å; V33-Y49 HydrophobicContact CG1-CD2 3.94Å; V33-Y49 HydrophobicContact CG1-CE1 3.44Å; V33-Y49 VanDerWaalsContact CG1-CE1 3.44Å; V33-Y49 HydrophobicContact CG1-CE2 3.87Å; V33-Y49 HydrophobicContact CG1-CG 3.79Å
34	L	82.6	Confident	78.1	Confident	32 Å²	32	84.5 Å²	84.5	17%	0.168	45%	0.447	C	S	.	.	H	α-helix	trans	-63.7	-42.7	175.5	-179.3	61.7	0	0	0	112.4	P30 L31 L32 E36 A37 A38 V46 A50 F53	P30-L34 WeakPolarHBondContact O-CB 3.25Å; P30-L34 PolarHBondContact O-N 2.99Å; L31-L34 PolarHBondContact O-N 2.93Å; L32-L34 VanDerWaalsContact C-N 3.35Å; L34-E36 VanDerWaalsContact C-N 3.31Å; L34-E36 PolarHBondContact O-N 3.29Å; L34-A37 PolarHBondContact O-N 2.88Å; L34-A38 WeakPolarHBondContact O-CB 3.42Å; L34-A38 PolarHBondContact O-N 3.38Å; L34-V46 HydrophobicContact CD1-CB 4.48Å; L34-V46 HydrophobicContact CD1-CG1 3.99Å; L34-V46 VanDerWaalsContact CD1-O 3.27Å; L34-V46 WeakPolarHBondContact CD1-O 3.36Å; L34-A50 HydrophobicContact CD1-CB 4.15Å; L34-F53 HydrophobicContact CD2-CB 4.44Å
35	I	79.1	Confident	79	Confident	73 Å²	73	82.4 Å²	82.4	37%	0.374	44%	0.439	S	S	.	.	H	α-helix	trans	-62.6	-40.5	176.4	-69.9	165.3	0	0	0	110.7	L31 L32 A38 K39	L31-I35 HydrophobicContact CD1-CD1 4.32Å; L31-I35 HydrophobicContact CG-CD1 4.04Å; L31-I35 VanDerWaalsContact O-CG1 3.27Å; L31-I35 WeakPolarHBondContact O-CG1 3.38Å; L31-I35 PolarHBondContact O-N 3.29Å; L32-I35 PolarHBondContact O-N 2.82Å; I35-A38 PolarHBondContact O-N 2.93Å; I35-K39 HydrophobicContact CG2-CD 4.23Å; I35-K39 WeakPolarHBondContact O-CG 3.27Å; I35-K39 PolarHBondContact O-N 3.46Å
36	E	82.5	Confident	80.1	Confident	93 Å²	93	78.4 Å²	78.4	44%	0.435	42%	0.419	S	S	.	.	H	α-helix	trans	-68.9	-42.2	179.9	-166.2	57.3	-149.3	0	0	112.1	L32 V33 L34 A38 K39 N40	L32-E36 PolarHBondContact O-N 2.94Å; V33-E36 PolarHBondContact O-N 3.48Å; L34-E36 VanDerWaalsContact C-N 3.31Å; L34-E36 PolarHBondContact O-N 3.29Å; E36-A38 VanDerWaalsContact C-N 3.27Å; E36-A38 PolarHBondContact O-N 3.3Å; E36-K39 PolarHBondContact O-N 3.23Å; E36-N40 PolarHBondContact O-N 3.44Å; E36-N40 VanDerWaalsContact O-N 3.08Å; E36-N40 PolarHBondContact O-ND2 2.94Å; E36-N40 VanDerWaalsContact O-ND2 3.07Å; E36-N40 PolarHBondContact OE1-ND2 3.36Å
37	A	81	Confident	81.3	Confident	4 Å²	4	79.4 Å²	79.4	3%	0.033	42%	0.422	C	S	.	.	H	α-helix	trans	-60.2	-38.4	172.8	0	0	0	0	0	112.1	V33 L34 N40 G41 N42 E45 V46 Y49	V33-A37 PolarHBondContact O-N 3.37Å; L34-A37 PolarHBondContact O-N 2.88Å; A37-N40 PolarHBondContact O-N 3.33Å; A37-G41 PolarHBondContact O-N 2.79Å; A37-N42 PolarHBondContact O-N 3Å; A37-E45 HydrophobicContact CB-CB 4.03Å; A37-V46 HydrophobicContact CB-CG2 3.88Å; A37-Y49 HydrophobicContact CB-CD2 3.73Å; A37-Y49 HydrophobicContact CB-CE2 4.12Å
38	A	79.9	Confident	82.4	Confident	57 Å²	57	82.6 Å²	82.6	47%	0.471	43%	0.434	S	S	.	.	H	α-helix	trans	-69	-40	176.7	0	0	0	0	0	112.5	L34 I35 E36 N40 G41 V46	L34-A38 WeakPolarHBondContact O-CB 3.42Å; L34-A38 PolarHBondContact O-N 3.38Å; I35-A38 PolarHBondContact O-N 2.93Å; E36-A38 VanDerWaalsContact C-N 3.27Å; E36-A38 PolarHBondContact O-N 3.3Å; A38-N40 VanDerWaalsContact C-N 3.28Å; A38-N40 PolarHBondContact O-N 3.23Å; A38-G41 PolarHBondContact O-N 3.43Å; A38-G41 VanDerWaalsContact O-N 3.11Å; A38-V46 HydrophobicContact CB-CG2 3.94Å
39	K	82.6	Confident	83.3	Confident	150 Å²	150	81.6 Å²	81.6	65%	0.652	42%	0.423	S	S	*	.	H	α-helix	trans	-61.4	-35.7	174.6	-79.1	173.1	173	178.2	0	112.8	I35 E36 G41	I35-K39 HydrophobicContact CG2-CD 4.23Å; I35-K39 WeakPolarHBondContact O-CG 3.27Å; I35-K39 PolarHBondContact O-N 3.46Å; E36-K39 PolarHBondContact O-N 3.23Å; K39-G41 PolarHBondContact O-N 3.13Å
40	N	88.7	Confident	83.8	Confident	110 Å²	110	80.3 Å²	80.3	59%	0.588	42%	0.419	S	S	*	.	T	Hydrogen-bonded Turn	trans	-80.3	-1	177.6	-67.6	-39.8	0	0	0	113.4	E36 A37 A38 N42	E36-N40 PolarHBondContact O-N 3.44Å; E36-N40 VanDerWaalsContact O-N 3.08Å; E36-N40 PolarHBondContact O-ND2 2.94Å; E36-N40 VanDerWaalsContact O-ND2 3.07Å; E36-N40 PolarHBondContact OE1-ND2 3.36Å; A37-N40 PolarHBondContact O-N 3.33Å; A38-N40 VanDerWaalsContact C-N 3.28Å; A38-N40 PolarHBondContact O-N 3.23Å; N40-N42 PolarHBondContact O-N 3.04Å
41	G	86.4	Confident	84.2	Confident	59 Å²	59	84.6 Å²	84.6	61%	0.608	44%	0.437	S	S	*	.	T	Hydrogen-bonded Turn	trans	68.5	16.9	178.9	0	0	0	0	0	114.1	A37 A38 K39 E43	A37-G41 PolarHBondContact O-N 2.79Å; A38-G41 PolarHBondContact O-N 3.43Å; A38-G41 VanDerWaalsContact O-N 3.11Å; K39-G41 PolarHBondContact O-N 3.13Å; G41-E43 PolarHBondContact O-N 3.03Å; G41-E43 VanDerWaalsContact O-N 3.12Å
42	N	84.9	Confident	84.5	Confident	58 Å²	58	85 Å²	85	31%	0.31	44%	0.443	S	S	.	.			trans	-86.1	84.2	-176.5	-167.7	-15.5	0	0	0	111	A37 N40 K44 E45 V46	A37-N42 PolarHBondContact O-N 3Å; N40-N42 PolarHBondContact O-N 3.04Å; N42-K44 PolarHBondContact O-N 3.38Å; N42-K44 VanDerWaalsContact O-N 3.12Å; N42-K44 PolarHBondContact OD1-N 2.74Å; N42-E45 HydrophobicContact CB-CB 4.07Å; N42-E45 VanDerWaalsContact ND2-CG 3.32Å; N42-E45 WeakPolarHBondContact ND2-CG 3.44Å; N42-E45 PolarHBondContact ND2-OE1 3.11Å; N42-E45 PolarHBondContact ND2-OE2 3.41Å; N42-E45 PolarHBondContact O-N 3.49Å; N42-E45 PolarHBondContact OD1-N 3.35Å; N42-V46 VanDerWaalsContact O-CG2 3.31Å; N42-V46 WeakPolarHBondContact O-CG2 3.48Å; N42-V46 PolarHBondContact O-N 2.89Å
43	E	85.1	Confident	84.7	Confident	150 Å²	150	83.3 Å²	83.3	70%	0.701	43%	0.431	S	S	*	.	H	α-helix	trans	-56.8	-29.8	-175.9	-67.2	-169.2	176.5	0	0	114.4	G41 K47	G41-E43 PolarHBondContact O-N 3.03Å; G41-E43 VanDerWaalsContact O-N 3.12Å; E43-K47 WeakPolarHBondContact O-CG 3.39Å; E43-K47 PolarHBondContact O-N 3.07Å
44	K	89.3	Confident	84.9	Confident	150 Å²	150	88.6 Å²	88.6	65%	0.652	45%	0.445	S	S	*	.	H	α-helix	trans	-72.1	-48.5	179.3	-170.2	-178.3	175	-171.2	0	110.8	N42 V46 K47 E48	N42-K44 PolarHBondContact O-N 3.38Å; N42-K44 VanDerWaalsContact O-N 3.12Å; N42-K44 PolarHBondContact OD1-N 2.74Å; K44-V46 VanDerWaalsContact C-N 3.33Å; K44-V46 PolarHBondContact O-N 3.32Å; K44-K47 PolarHBondContact O-N 3.48Å; K44-E48 PolarHBondContact O-N 3.46Å; K44-E48 VanDerWaalsContact O-N 3.15Å
45	E	82.5	Confident	85	Confident	73 Å²	73	91.7 Å²	91.7	34%	0.341	46%	0.459	S	S	.	.	H	α-helix	trans	-63.7	-39	175.8	-82.8	178.8	-179.7	0	0	111.9	A37 N42 K47 E48 Y49	A37-E45 HydrophobicContact CB-CB 4.03Å; N42-E45 HydrophobicContact CB-CB 4.07Å; N42-E45 VanDerWaalsContact ND2-CG 3.32Å; N42-E45 WeakPolarHBondContact ND2-CG 3.44Å; N42-E45 PolarHBondContact ND2-OE1 3.11Å; N42-E45 PolarHBondContact ND2-OE2 3.41Å; N42-E45 PolarHBondContact O-N 3.49Å; N42-E45 PolarHBondContact OD1-N 3.35Å; E45-K47 VanDerWaalsContact C-N 3.28Å; E45-K47 PolarHBondContact O-N 3.13Å; E45-E48 PolarHBondContact O-N 3.27Å; E45-Y49 HydrophobicContact CB-CD2 3.99Å; E45-Y49 HydrophobicContact CB-CE2 3.81Å; E45-Y49 HydrophobicContact CG-CE2 4.08Å; E45-Y49 WeakPolarHBondContact O-CB 3.38Å; E45-Y49 WeakPolarHBondContact O-CD2 3.41Å; E45-Y49 PolarHBondContact O-N 2.95Å
46	V	85.8	Confident	85.1	Confident	42 Å²	42	90.4 Å²	90.4	26%	0.255	45%	0.451	S	S	.	.	H	α-helix	trans	-57.2	-42.4	175.4	170.8	0	0	0	0	111.3	L34 A37 A38 N42 K44 A50	L34-V46 HydrophobicContact CD1-CB 4.48Å; L34-V46 HydrophobicContact CD1-CG1 3.99Å; L34-V46 VanDerWaalsContact CD1-O 3.27Å; L34-V46 WeakPolarHBondContact CD1-O 3.36Å; A37-V46 HydrophobicContact CB-CG2 3.88Å; A38-V46 HydrophobicContact CB-CG2 3.94Å; N42-V46 VanDerWaalsContact O-CG2 3.31Å; N42-V46 WeakPolarHBondContact O-CG2 3.48Å; N42-V46 PolarHBondContact O-N 2.89Å; K44-V46 VanDerWaalsContact C-N 3.33Å; K44-V46 PolarHBondContact O-N 3.32Å; V46-A50 WeakPolarHBondContact O-CB 3.46Å; V46-A50 PolarHBondContact O-N 3.38Å
47	K	86.9	Confident	85.1	Confident	153 Å²	153	87.4 Å²	87.4	67%	0.665	44%	0.442	S	S	*	.	H	α-helix	trans	-66.9	-40.7	177.4	-75.8	174.7	-179.3	171	0	112.4	E43 K44 E45 Q51	E43-K47 WeakPolarHBondContact O-CG 3.39Å; E43-K47 PolarHBondContact O-N 3.07Å; K44-K47 PolarHBondContact O-N 3.48Å; E45-K47 VanDerWaalsContact C-N 3.28Å; E45-K47 PolarHBondContact O-N 3.13Å; K47-Q51 PolarHBondContact O-N 2.95Å
48	E	88.4	Confident	85.2	Confident	106 Å²	106	91 Å²	91	50%	0.495	46%	0.461	S	S	.	.	H	α-helix	trans	-65.8	-48.2	177.7	-72.3	174.7	-174	0	0	111.1	K44 E45 A50 Q51 V52	K44-E48 PolarHBondContact O-N 3.46Å; K44-E48 VanDerWaalsContact O-N 3.15Å; E45-E48 PolarHBondContact O-N 3.27Å; E48-A50 VanDerWaalsContact C-N 3.34Å; E48-A50 PolarHBondContact O-N 3.3Å; E48-Q51 PolarHBondContact O-N 3.03Å; E48-V52 PolarHBondContact O-N 3.19Å
49	Y	85.1	Confident	85.1	Confident	84 Å²	84	94.7 Å²	94.7	33%	0.329	47%	0.466	S	S	.	.	H	α-helix	trans	-69.9	-28.7	178.4	-67	-55.8	0	0	0	113.3	V33 A37 E45 Q51 V52 F53	V33-Y49 HydrophobicContact CG1-CD1 3.52Å; V33-Y49 HydrophobicContact CG1-CD2 3.94Å; V33-Y49 HydrophobicContact CG1-CE1 3.44Å; V33-Y49 VanDerWaalsContact CG1-CE1 3.44Å; V33-Y49 HydrophobicContact CG1-CE2 3.87Å; V33-Y49 HydrophobicContact CG1-CG 3.79Å; A37-Y49 HydrophobicContact CB-CD2 3.73Å; A37-Y49 HydrophobicContact CB-CE2 4.12Å; E45-Y49 HydrophobicContact CB-CD2 3.99Å; E45-Y49 HydrophobicContact CB-CE2 3.81Å; E45-Y49 HydrophobicContact CG-CE2 4.08Å; E45-Y49 WeakPolarHBondContact O-CB 3.38Å; E45-Y49 WeakPolarHBondContact O-CD2 3.41Å; E45-Y49 PolarHBondContact O-N 2.95Å; Y49-Q51 VanDerWaalsContact C-N 3.27Å; Y49-Q51 PolarHBondContact O-N 3.45Å; Y49-V52 PolarHBondContact O-N 3.02Å; Y49-F53 WeakPolarHBondContact O-CB 3.46Å; Y49-F53 PolarHBondContact O-N 3.47Å
50	A	86.4	Confident	84.6	Confident	40 Å²	40	89.3 Å²	89.3	33%	0.331	44%	0.444	S	S	.	.	H	α-helix	trans	-63.2	-36.7	173.6	0	0	0	0	0	111.6	L34 V46 E48 R54	L34-A50 HydrophobicContact CD1-CB 4.15Å; V46-A50 WeakPolarHBondContact O-CB 3.46Å; V46-A50 PolarHBondContact O-N 3.38Å; E48-A50 VanDerWaalsContact C-N 3.34Å; E48-A50 PolarHBondContact O-N 3.3Å; A50-R54 WeakPolarHBondContact O-CB 3.33Å; A50-R54 PolarHBondContact O-N 2.89Å
51	Q	87.6	Confident	84.1	Confident	111 Å²	111	89.5 Å²	89.5	52%	0.519	44%	0.444	S	S	.	.	H	α-helix	trans	-68	-43.3	175.5	-168.1	177.5	-22.7	0	0	111.4	K47 E48 Y49 R54 E55	K47-Q51 PolarHBondContact O-N 2.95Å; E48-Q51 PolarHBondContact O-N 3.03Å; Y49-Q51 VanDerWaalsContact C-N 3.27Å; Y49-Q51 PolarHBondContact O-N 3.45Å; Q51-R54 PolarHBondContact O-N 3.42Å; Q51-E55 PolarHBondContact NE2-OE1 3.2Å; Q51-E55 PolarHBondContact O-N 3.35Å
52	V	85.9	Confident	83.3	Confident	78 Å²	78	94.5 Å²	94.5	47%	0.473	45%	0.452	S	S	.	.	H	α-helix	trans	-61.4	-44.7	176.2	176.9	0	0	0	0	111.5	E48 Y49 R54 E55 H56	E48-V52 PolarHBondContact O-N 3.19Å; Y49-V52 PolarHBondContact O-N 3.02Å; V52-R54 VanDerWaalsContact C-N 3.33Å; V52-R54 PolarHBondContact O-N 3.43Å; V52-E55 PolarHBondContact O-N 3.07Å; V52-H56 WeakPolarHBondContact O-CB 3.33Å; V52-H56 PolarHBondContact O-N 3.35Å
53	F	85.3	Confident	81.9	Confident	73 Å²	73	93.5 Å²	93.5	32%	0.32	46%	0.455	S	S	.	.	H	α-helix	trans	-60.7	-42.9	175.4	175.2	-101.4	0	0	0	111.6	P30 L31 L34 Y49 H56 A57	P30-F53 HydrophobicContact CB-CB 4.33Å; P30-F53 HydrophobicContact CB-CD2 4.14Å; L31-F53 HydrophobicContact CB-CD2 4.06Å; L31-F53 HydrophobicContact CB-CE2 3.82Å; L31-F53 HydrophobicContact CD1-CD2 4.48Å; L31-F53 HydrophobicContact CD1-CE2 4.09Å; L31-F53 HydrophobicContact CD1-CZ 4.29Å; L31-F53 HydrophobicContact CG-CE2 4.4Å; L34-F53 HydrophobicContact CD2-CB 4.44Å; Y49-F53 WeakPolarHBondContact O-CB 3.46Å; Y49-F53 PolarHBondContact O-N 3.47Å; F53-H56 PolarHBondContact O-N 3.49Å; F53-A57 WeakPolarHBondContact O-CB 3.41Å; F53-A57 PolarHBondContact O-N 3.29Å
54	R	86.1	Confident	80.1	Confident	164 Å²	164	95.4 Å²	95.4	62%	0.619	47%	0.468	S	S	*	.	H	α-helix	trans	-64.8	-42.6	178.4	-167.6	175.7	77.4	166.9	4.3	112.3	A50 Q51 V52 H56 A57 N58	A50-R54 WeakPolarHBondContact O-CB 3.33Å; A50-R54 PolarHBondContact O-N 2.89Å; Q51-R54 PolarHBondContact O-N 3.42Å; V52-R54 VanDerWaalsContact C-N 3.33Å; V52-R54 PolarHBondContact O-N 3.43Å; R54-H56 VanDerWaalsContact C-N 3.35Å; R54-A57 PolarHBondContact O-N 3.28Å; R54-N58 VanDerWaalsContact O-CG 3.26Å; R54-N58 PolarHBondContact O-N 3.15Å; R54-N58 PolarHBondContact O-ND2 3.4Å
55	E	85.4	Confident	79.6	Confident	98 Å²	98	92.7 Å²	92.7	46%	0.458	46%	0.459	S	S	.	.	H	α-helix	trans	-64.8	-39.6	175.3	-77.3	177.3	-166.6	0	0	111.9	Q51 V52 N58 K59	Q51-E55 PolarHBondContact NE2-OE1 3.2Å; Q51-E55 PolarHBondContact O-N 3.35Å; V52-E55 PolarHBondContact O-N 3.07Å; E55-N58 PolarHBondContact O-N 3.47Å; E55-K59 WeakPolarHBondContact O-CG 3.5Å; E55-K59 PolarHBondContact O-N 3.02Å
56	H	81.4	Confident	79.5	Confident	45 Å²	45	93.7 Å²	93.7	21%	0.208	47%	0.465	C	S	.	.	H	α-helix	trans	-62.3	-44.7	173.7	-175.6	78	0	0	0	111.8	P30 V52 F53 R54 N58 K59 L60	P30-H56 HydrophobicContact CG-CB 4.18Å; V52-H56 WeakPolarHBondContact O-CB 3.33Å; V52-H56 PolarHBondContact O-N 3.35Å; F53-H56 PolarHBondContact O-N 3.49Å; R54-H56 VanDerWaalsContact C-N 3.35Å; H56-N58 VanDerWaalsContact C-N 3.35Å; H56-N58 PolarHBondContact O-N 3.18Å; H56-K59 PolarHBondContact O-N 3.4Å; H56-L60 PolarHBondContact O-N 2.95Å
57	A	81.8	Confident	79.1	Confident	31 Å²	31	96.6 Å²	96.6	26%	0.256	48%	0.477	S	S	.	.	H	α-helix	trans	-62.3	-40	176.2	0	0	0	0	0	112.4	F53 R54 L60 I61	F53-A57 WeakPolarHBondContact O-CB 3.41Å; F53-A57 PolarHBondContact O-N 3.29Å; R54-A57 PolarHBondContact O-N 3.28Å; A57-L60 PolarHBondContact O-N 2.95Å; A57-I61 WeakPolarHBondContact O-CG1 3.41Å; A57-I61 PolarHBondContact O-N 2.94Å; A57-I61 VanDerWaalsContact O-N 3.11Å
58	N	83.9	Confident	78.7	Confident	79 Å²	79	93.2 Å²	93.2	42%	0.422	47%	0.466	S	S	.	.	H	α-helix	trans	-64.4	-42.4	176	-72	-17.4	0	0	0	112.1	R54 E55 H56 L60 I61 E62	R54-N58 VanDerWaalsContact O-CG 3.26Å; R54-N58 PolarHBondContact O-N 3.15Å; R54-N58 PolarHBondContact O-ND2 3.4Å; E55-N58 PolarHBondContact O-N 3.47Å; H56-N58 VanDerWaalsContact C-N 3.35Å; H56-N58 PolarHBondContact O-N 3.18Å; N58-L60 VanDerWaalsContact C-N 3.3Å; N58-L60 PolarHBondContact O-N 3.27Å; N58-I61 PolarHBondContact O-N 3.14Å; N58-I61 VanDerWaalsContact O-N 3.13Å; N58-E62 PolarHBondContact O-N 2.92Å
59	K	77.5	Confident	78.1	Confident	134 Å²	134	92.4 Å²	92.4	58%	0.583	46%	0.464	S	S	*	.	H	α-helix	trans	-61.6	-37.1	175.1	-73.3	178.7	-177.5	176.7	0	112.5	E55 H56 I61 E62 G63	E55-K59 WeakPolarHBondContact O-CG 3.5Å; E55-K59 PolarHBondContact O-N 3.02Å; H56-K59 PolarHBondContact O-N 3.4Å; K59-I61 VanDerWaalsContact C-N 3.33Å; K59-E62 PolarHBondContact O-N 3.32Å; K59-G63 PolarHBondContact O-N 3.06Å
60	L	71.9	Confident	77.6	Confident	37 Å²	37	93 Å²	93	19%	0.194	47%	0.473	C	S	.	.	H	α-helix	trans	-64.9	-36.8	174.2	-74.3	170	0	0	0	112.2	F24 T27 H56 A57 N58 I64	F24-L60 HydrophobicContact CD2-CD2 4.41Å; F24-L60 HydrophobicContact CE2-CD2 4.2Å; F24-L60 HydrophobicContact CZ-CD2 4.42Å; T27-L60 HydrophobicContact CG2-CD1 4.03Å; T27-L60 HydrophobicContact CG2-CD2 4.09Å; H56-L60 PolarHBondContact O-N 2.95Å; A57-L60 PolarHBondContact O-N 2.95Å; N58-L60 VanDerWaalsContact C-N 3.3Å; N58-L60 PolarHBondContact O-N 3.27Å; L60-I64 WeakPolarHBondContact O-CG1 3.43Å
61	I	77.4	Confident	77	Confident	114 Å²	114	96.8 Å²	96.8	59%	0.585	48%	0.483	S	S	*	.	H	α-helix	trans	-71.4	-39.6	176.7	-66.4	167.6	0	0	0	111.3	A57 N58 K59 G63 I64	A57-I61 WeakPolarHBondContact O-CG1 3.41Å; A57-I61 PolarHBondContact O-N 2.94Å; A57-I61 VanDerWaalsContact O-N 3.11Å; N58-I61 PolarHBondContact O-N 3.14Å; N58-I61 VanDerWaalsContact O-N 3.13Å; K59-I61 VanDerWaalsContact C-N 3.33Å; I61-G63 PolarHBondContact O-N 3.28Å; I61-I64 PolarHBondContact O-N 3.01Å
62	E	70.3	Confident	76.2	Confident	164 Å²	164	95.7 Å²	95.7	77%	0.766	48%	0.48	S	S	*	.	H	α-helix	trans	-64.7	-22.6	177	-74.5	-179.5	176.7	0	0	113.5	N58 K59	N58-E62 PolarHBondContact O-N 2.92Å; K59-E62 PolarHBondContact O-N 3.32Å
63	G	56.1	Low	75.4	Confident	37 Å²	37	97.2 Å²	97.2	38%	0.381	48%	0.481	S	S	.	.	T	Hydrogen-bonded Turn	trans	-83.7	-1.6	177.5	0	0	0	0	0	115.7	K59 I61	K59-G63 PolarHBondContact O-N 3.06Å; I61-G63 PolarHBondContact O-N 3.28Å
64	I	47.2	Very low	74.5	Confident	190 Å²	190	99.4 Å²	99.4	97%	0.974	50%	0.495	S	S	*	.			trans	-105.4	0	-179.6	-60.1	171.2	0	0	0	110.1	L60 I61	L60-I64 WeakPolarHBondContact O-CG1 3.43Å; I61-I64 PolarHBondContact O-N 3.01Å

Retrieved 64 of 64 residues in 158.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).