A0A087WZM8_HUMAN Loading...

Transmembrane protein 254

AlphaFold DB , UniProt , Accession A0A087WZM8, Species HUMAN (Homo sapiens, Human), Gene TMEM254, Length 101 aa.

						>A0A087WZM8_HUMAN|A0A087WZM8|TMEM254
MATAAGATYFQRGSLFWFTVITLSFGYYTPQQRSETLSKKKERKKIEAKNGDPNDCSEFLRGLSSGLRVSLIRTLGPWAPSLSTWWTTITPSCAMGIGLPG
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	42	Very low	52	Low	250 Å²	250	110.5 Å²	110.5	100%	1.232	64%	0.644	S	S	*	*				0	98.9	0	-65.2	-158.1	-164.6	0	0	108.7
2	A	48.7	Very low	52.7	Low	93 Å²	93	113.6 Å²	113.6	77%	0.769	64%	0.637	S	S	*	*			trans	-127.9	19.3	-175.6	0	0	0	0	0	112.8
3	T	47.8	Very low	54.1	Low	125 Å²	125	107.1 Å²	107.1	77%	0.767	61%	0.611	S	S	*	*	H	α-helix	trans	-94.7	-19.4	-174.5	-50.1	0	0	0	0	113
4	A	51.9	Low	55.4	Low	81 Å²	81	105.1 Å²	105.1	67%	0.669	61%	0.607	S	S	*	*	H	α-helix	trans	-76.1	-33.5	-176.1	0	0	0	0	0	113.2	T8	A4-T8 WeakPolarHBondContact O-CG2 3.3Å
5	A	52.3	Low	56.6	Low	61 Å²	61	104.7 Å²	104.7	50%	0.504	60%	0.601	S	S	.	*	H	α-helix	trans	-71.8	-47.4	-177.2	0	0	0	0	0	112.1	A7 T8 Y9	A5-A7 VanDerWaalsContact C-N 3.34Å; A5-A7 PolarHBondContact O-N 2.55Å; A5-T8 PolarHBondContact O-N 3.34Å; A5-T8 VanDerWaalsContact O-N 3.14Å; A5-T8 PolarHBondContact O-OG1 3.44Å; A5-Y9 WeakPolarHBondContact O-CD2 3.27Å; A5-Y9 PolarHBondContact O-N 3.2Å
6	G	53.1	Low	58	Low	38 Å²	38	106.4 Å²	106.4	39%	0.392	60%	0.6	S	S	.	*	H	α-helix	trans	-61.4	-37.8	-177.4	0	0	0	0	0	113.9	T8 Y9 F10	G6-T8 VanDerWaalsContact C-N 3.31Å; G6-T8 PolarHBondContact O-N 3.03Å; G6-Y9 PolarHBondContact O-N 3.41Å; G6-F10 PolarHBondContact O-N 3.44Å; G6-F10 VanDerWaalsContact O-N 3.14Å
7	A	53	Low	59	Low	59 Å²	59	110.1 Å²	110.1	49%	0.488	60%	0.602	S	S	.	*	H	α-helix	trans	-62.2	-38.3	176.7	0	0	0	0	0	112.1	A5 F10 Q11	A5-A7 VanDerWaalsContact C-N 3.34Å; A5-A7 PolarHBondContact O-N 2.55Å; A7-F10 PolarHBondContact O-N 3.1Å; A7-Q11 VanDerWaalsContact O-CB 3.32Å; A7-Q11 WeakPolarHBondContact O-CB 3.35Å; A7-Q11 PolarHBondContact O-N 2.77Å
8	T	54.2	Low	59.9	Low	44 Å²	44	111.6 Å²	111.6	27%	0.27	60%	0.602	S	S	.	*	H	α-helix	trans	-70.7	-32.2	178.7	66.2	0	0	0	0	112.8	A4 A5 G6 R12	A4-T8 WeakPolarHBondContact O-CG2 3.3Å; A5-T8 PolarHBondContact O-N 3.34Å; A5-T8 VanDerWaalsContact O-N 3.14Å; A5-T8 PolarHBondContact O-OG1 3.44Å; G6-T8 VanDerWaalsContact C-N 3.31Å; G6-T8 PolarHBondContact O-N 3.03Å; T8-R12 VanDerWaalsContact O-CB 3.31Å; T8-R12 WeakPolarHBondContact O-CB 3.35Å; T8-R12 WeakPolarHBondContact O-CD 3.35Å; T8-R12 WeakPolarHBondContact O-CG 3.07Å; T8-R12 PolarHBondContact O-N 3.2Å
9	Y	54.2	Low	61	Low	170 Å²	170	109.4 Å²	109.4	67%	0.667	59%	0.593	S	S	*	*	H	α-helix	trans	-68.7	-43.9	174.3	-84.1	-85.2	0	0	0	111.8	A5 G6 Q11 R12 G13	A5-Y9 WeakPolarHBondContact O-CD2 3.27Å; A5-Y9 PolarHBondContact O-N 3.2Å; G6-Y9 PolarHBondContact O-N 3.41Å; Y9-Q11 VanDerWaalsContact C-N 3.34Å; Y9-Q11 PolarHBondContact O-N 3.38Å; Y9-R12 PolarHBondContact O-N 2.94Å; Y9-G13 PolarHBondContact O-N 3.26Å
10	F	55.8	Low	62.1	Low	175 Å²	175	106.7 Å²	106.7	77%	0.768	58%	0.58	S	S	*	*	H	α-helix	trans	-62.2	-41.4	174.4	-94.3	-83.2	0	0	0	112.3	G6 A7 G13 S14	G6-F10 PolarHBondContact O-N 3.44Å; G6-F10 VanDerWaalsContact O-N 3.14Å; A7-F10 PolarHBondContact O-N 3.1Å; F10-G13 PolarHBondContact O-N 2.8Å; F10-S14 WeakPolarHBondContact O-CB 3.45Å; F10-S14 PolarHBondContact O-N 3.45Å
11	Q	58.9	Low	63	Low	119 Å²	119	105.6 Å²	105.6	56%	0.556	57%	0.573	S	S	*	*	H	α-helix	trans	-67.5	-40.8	178.8	-162.7	-173.7	-39.9	0	0	112.1	A7 Y9 S14 L15	A7-Q11 VanDerWaalsContact O-CB 3.32Å; A7-Q11 WeakPolarHBondContact O-CB 3.35Å; A7-Q11 PolarHBondContact O-N 2.77Å; Y9-Q11 VanDerWaalsContact C-N 3.34Å; Y9-Q11 PolarHBondContact O-N 3.38Å; Q11-S14 PolarHBondContact O-N 2.89Å; Q11-L15 HydrophobicContact CG-CD1 4.34Å; Q11-L15 WeakPolarHBondContact O-CD1 2.97Å; Q11-L15 WeakPolarHBondContact O-CG 3.3Å; Q11-L15 PolarHBondContact O-N 2.82Å
12	R	60.6	Low	64.7	Low	148 Å²	148	97 Å²	97	56%	0.558	53%	0.534	S	S	*	.	H	α-helix	trans	-65.8	-42.5	176.4	-73.6	167.7	-171.1	-152.8	3.2	111.8	T8 Y9 L15 F16	T8-R12 VanDerWaalsContact O-CB 3.31Å; T8-R12 WeakPolarHBondContact O-CB 3.35Å; T8-R12 WeakPolarHBondContact O-CD 3.35Å; T8-R12 WeakPolarHBondContact O-CG 3.07Å; T8-R12 PolarHBondContact O-N 3.2Å; Y9-R12 PolarHBondContact O-N 2.94Å; R12-L15 PolarHBondContact O-N 3.42Å; R12-F16 WeakPolarHBondContact O-CB 3.39Å; R12-F16 PolarHBondContact O-N 2.78Å
13	G	70.6	Confident	66	Low	29 Å²	29	95.9 Å²	95.9	30%	0.299	52%	0.515	S	S	.	.	H	α-helix	trans	-61.4	-46.3	174.2	0	0	0	0	0	111.9	Y9 F10 L15 F16 W17	Y9-G13 PolarHBondContact O-N 3.26Å; F10-G13 PolarHBondContact O-N 2.8Å; G13-L15 PolarHBondContact O-N 3.3Å; G13-F16 WeakPolarHBondContact O-CB 3.37Å; G13-F16 PolarHBondContact O-N 2.89Å; G13-W17 PolarHBondContact O-N 2.78Å
14	S	72.9	Confident	67.2	Low	80 Å²	80	92.5 Å²	92.5	56%	0.559	50%	0.496	S	S	*	.	H	α-helix	trans	-61.8	-42.3	179.3	-172.9	0	0	0	0	112.7	F10 Q11 F18	F10-S14 WeakPolarHBondContact O-CB 3.45Å; F10-S14 PolarHBondContact O-N 3.45Å; Q11-S14 PolarHBondContact O-N 2.89Å; S14-F18 WeakPolarHBondContact O-CB 3.47Å; S14-F18 PolarHBondContact O-N 2.9Å
15	L	73.4	Confident	67.9	Low	99 Å²	99	95.3 Å²	95.3	52%	0.518	49%	0.494	S	S	.	.	H	α-helix	trans	-66.2	-39.4	177.1	-78.3	159.5	0	0	0	111.9	Q11 R12 G13 T19	Q11-L15 HydrophobicContact CG-CD1 4.34Å; Q11-L15 WeakPolarHBondContact O-CD1 2.97Å; Q11-L15 WeakPolarHBondContact O-CG 3.3Å; Q11-L15 PolarHBondContact O-N 2.82Å; R12-L15 PolarHBondContact O-N 3.42Å; G13-L15 PolarHBondContact O-N 3.3Å; L15-T19 WeakPolarHBondContact O-CB 3.2Å; L15-T19 PolarHBondContact O-N 3.44Å; L15-T19 PolarHBondContact O-OG1 2.81Å
16	F	78.1	Confident	68.6	Low	132 Å²	132	93.8 Å²	93.8	58%	0.579	48%	0.484	S	S	*	.	H	α-helix	trans	-61.9	-52.6	175.8	178.7	-99.4	0	0	0	111.1	R12 G13 F18 T19 V20	R12-F16 WeakPolarHBondContact O-CB 3.39Å; R12-F16 PolarHBondContact O-N 2.78Å; G13-F16 WeakPolarHBondContact O-CB 3.37Å; G13-F16 PolarHBondContact O-N 2.89Å; F16-F18 PolarHBondContact O-N 3.25Å; F16-T19 WeakPolarHBondContact O-CB 3.42Å; F16-T19 PolarHBondContact O-N 3.08Å; F16-V20 HydrophobicContact CD1-CG2 4.39Å; F16-V20 HydrophobicContact CE1-CG2 4.04Å; F16-V20 HydrophobicContact CE2-CG2 4.39Å; F16-V20 HydrophobicContact CZ-CG2 4.04Å; F16-V20 WeakPolarHBondContact O-CG2 3.2Å; F16-V20 PolarHBondContact O-N 3.42Å
17	W	75.7	Confident	68.6	Low	168 Å²	168	97.6 Å²	97.6	64%	0.636	49%	0.487	S	S	*	.	H	α-helix	trans	-62.4	-40.7	177.9	-75.5	108.7	0	0	0	112.6	G13 T19 V20 I21	G13-W17 PolarHBondContact O-N 2.78Å; W17-T19 VanDerWaalsContact C-N 3.3Å; W17-T19 PolarHBondContact O-N 2.93Å; W17-V20 PolarHBondContact O-N 3.34Å; W17-I21 WeakPolarHBondContact O-CB 3.46Å; W17-I21 WeakPolarHBondContact O-CD1 3.4Å; W17-I21 WeakPolarHBondContact O-CG1 3.09Å; W17-I21 PolarHBondContact O-N 3.41Å
18	F	75.8	Confident	68.6	Low	138 Å²	138	103.8 Å²	103.8	61%	0.605	50%	0.499	S	S	*	.	H	α-helix	trans	-62.4	-38.3	176.2	-169	-92.5	0	0	0	112.3	S14 F16 T22	S14-F18 WeakPolarHBondContact O-CB 3.47Å; S14-F18 PolarHBondContact O-N 2.9Å; F16-F18 PolarHBondContact O-N 3.25Å; F18-T22 WeakPolarHBondContact O-CB 3.33Å; F18-T22 PolarHBondContact O-N 2.77Å; F18-T22 PolarHBondContact O-OG1 2.91Å
19	T	79.5	Confident	68.4	Low	70 Å²	70	105.7 Å²	105.7	43%	0.429	51%	0.511	S	S	.	.	H	α-helix	trans	-66.3	-45.5	175	-56.6	0	0	0	0	110.8	L15 F16 W17 I21 T22 L23	L15-T19 WeakPolarHBondContact O-CB 3.2Å; L15-T19 PolarHBondContact O-N 3.44Å; L15-T19 PolarHBondContact O-OG1 2.81Å; F16-T19 WeakPolarHBondContact O-CB 3.42Å; F16-T19 PolarHBondContact O-N 3.08Å; W17-T19 VanDerWaalsContact C-N 3.3Å; W17-T19 PolarHBondContact O-N 2.93Å; T19-I21 VanDerWaalsContact C-N 3.34Å; T19-I21 PolarHBondContact O-N 3.5Å; T19-T22 PolarHBondContact O-N 3.29Å; T19-L23 WeakPolarHBondContact O-CB 3.35Å; T19-L23 PolarHBondContact O-N 2.95Å
20	V	82.8	Confident	68.2	Low	54 Å²	54	102.1 Å²	102.1	33%	0.327	51%	0.508	S	S	.	.	H	α-helix	trans	-61.7	-41.2	177.7	172.1	0	0	0	0	111.5	F16 W17 S24	F16-V20 HydrophobicContact CD1-CG2 4.39Å; F16-V20 HydrophobicContact CE1-CG2 4.04Å; F16-V20 HydrophobicContact CE2-CG2 4.39Å; F16-V20 HydrophobicContact CZ-CG2 4.04Å; F16-V20 WeakPolarHBondContact O-CG2 3.2Å; F16-V20 PolarHBondContact O-N 3.42Å; W17-V20 PolarHBondContact O-N 3.34Å; V20-S24 WeakPolarHBondContact O-CB 3.47Å; V20-S24 PolarHBondContact O-N 3.43Å; V20-S24 PolarHBondContact O-OG 3.05Å
21	I	81.1	Confident	67.9	Low	85 Å²	85	100.3 Å²	100.3	44%	0.436	50%	0.502	S	S	.	.	H	α-helix	trans	-65	-50.1	176.3	-68.4	162.8	0	0	0	110.3	W17 T19 L23 S24 F25	W17-I21 WeakPolarHBondContact O-CB 3.46Å; W17-I21 WeakPolarHBondContact O-CD1 3.4Å; W17-I21 WeakPolarHBondContact O-CG1 3.09Å; W17-I21 PolarHBondContact O-N 3.41Å; T19-I21 VanDerWaalsContact C-N 3.34Å; T19-I21 PolarHBondContact O-N 3.5Å; I21-L23 VanDerWaalsContact C-N 3.29Å; I21-L23 PolarHBondContact O-N 3.19Å; I21-S24 PolarHBondContact O-N 2.91Å; I21-F25 HydrophobicContact CG2-CD2 3.62Å; I21-F25 HydrophobicContact CG2-CE2 3.67Å; I21-F25 VanDerWaalsContact O-CD2 3.27Å; I21-F25 WeakPolarHBondContact O-CD2 3.4Å; I21-F25 PolarHBondContact O-N 2.91Å
22	T	78.4	Confident	67.1	Low	68 Å²	68	101.5 Å²	101.5	42%	0.417	51%	0.508	S	S	.	.	H	α-helix	trans	-62.2	-38.3	179.6	-57.1	0	0	0	0	111.7	F18 T19 G26	F18-T22 WeakPolarHBondContact O-CB 3.33Å; F18-T22 PolarHBondContact O-N 2.77Å; F18-T22 PolarHBondContact O-OG1 2.91Å; T19-T22 PolarHBondContact O-N 3.29Å; T22-G26 WeakPolarHBondContact O-CA 3.37Å; T22-G26 PolarHBondContact O-N 3.2Å
23	L	76.8	Confident	66.2	Low	70 Å²	70	103.8 Å²	103.8	37%	0.366	52%	0.516	S	S	.	.	H	α-helix	trans	-67.3	-45.1	175.8	-164.9	68.7	0	0	0	110.6	T19 I21 G26 Y27	T19-L23 WeakPolarHBondContact O-CB 3.35Å; T19-L23 PolarHBondContact O-N 2.95Å; I21-L23 VanDerWaalsContact C-N 3.29Å; I21-L23 PolarHBondContact O-N 3.19Å; L23-G26 PolarHBondContact O-N 3.25Å; L23-Y27 HydrophobicContact CD1-CD2 3.75Å; L23-Y27 HydrophobicContact CD1-CE2 3.51Å; L23-Y27 HydrophobicContact CG-CD2 3.75Å; L23-Y27 HydrophobicContact CG-CE2 3.85Å; L23-Y27 WeakPolarHBondContact O-CB 3.31Å; L23-Y27 VanDerWaalsContact O-CD2 3.3Å; L23-Y27 WeakPolarHBondContact O-CD2 3.21Å; L23-Y27 PolarHBondContact O-N 2.73Å
24	S	72.3	Confident	64.9	Low	54 Å²	54	105.8 Å²	105.8	38%	0.378	53%	0.526	S	S	.	.	H	α-helix	trans	-59.1	-53.7	176.9	-59.8	0	0	0	0	110.4	V20 I21 G26 Y27 Y28	V20-S24 WeakPolarHBondContact O-CB 3.47Å; V20-S24 PolarHBondContact O-N 3.43Å; V20-S24 PolarHBondContact O-OG 3.05Å; I21-S24 PolarHBondContact O-N 2.91Å; S24-G26 PolarHBondContact O-N 3.04Å; S24-Y27 PolarHBondContact O-N 2.96Å; S24-Y28 WeakPolarHBondContact O-CD2 3.39Å; S24-Y28 PolarHBondContact O-N 2.84Å
25	F	67.5	Low	63.7	Low	141 Å²	141	108.4 Å²	108.4	62%	0.618	53%	0.529	S	S	*	.	H	α-helix	trans	-60.3	-44.3	175.9	-79.3	-73.3	0	0	0	111.8	I21 Y27 Y28 T29	I21-F25 HydrophobicContact CG2-CD2 3.62Å; I21-F25 HydrophobicContact CG2-CE2 3.67Å; I21-F25 VanDerWaalsContact O-CD2 3.27Å; I21-F25 WeakPolarHBondContact O-CD2 3.4Å; I21-F25 PolarHBondContact O-N 2.91Å; F25-Y27 VanDerWaalsContact C-N 3.3Å; F25-Y27 PolarHBondContact O-N 3.5Å; F25-Y28 CarbonylContact O-C 3.49Å; F25-Y28 PolarHBondContact O-N 3.43Å; F25-Y28 VanDerWaalsContact O-N 3.1Å; F25-T29 WeakPolarHBondContact O-CB 3.49Å; F25-T29 PolarHBondContact O-N 2.94Å; F25-T29 PolarHBondContact O-OG1 3.01Å
26	G	65.4	Low	62	Low	28 Å²	28	109.1 Å²	109.1	29%	0.289	54%	0.538	S	S	.	.	H	α-helix	trans	-60.8	-35.3	178.2	0	0	0	0	0	113.8	T22 L23 S24 P30	T22-G26 WeakPolarHBondContact O-CA 3.37Å; T22-G26 PolarHBondContact O-N 3.2Å; L23-G26 PolarHBondContact O-N 3.25Å; S24-G26 PolarHBondContact O-N 3.04Å; G26-P30 WeakPolarHBondContact O-CD 3.49Å
27	Y	54.8	Low	60.1	Low	118 Å²	118	107.9 Å²	107.9	46%	0.463	54%	0.537	S	S	.	.	H	α-helix	trans	-78.8	-23.9	174	-91.8	-91.2	0	0	0	113.6	L23 S24 F25 P30	L23-Y27 HydrophobicContact CD1-CD2 3.75Å; L23-Y27 HydrophobicContact CD1-CE2 3.51Å; L23-Y27 HydrophobicContact CG-CD2 3.75Å; L23-Y27 HydrophobicContact CG-CE2 3.85Å; L23-Y27 WeakPolarHBondContact O-CB 3.31Å; L23-Y27 VanDerWaalsContact O-CD2 3.3Å; L23-Y27 WeakPolarHBondContact O-CD2 3.21Å; L23-Y27 PolarHBondContact O-N 2.73Å; S24-Y27 PolarHBondContact O-N 2.96Å; F25-Y27 VanDerWaalsContact C-N 3.3Å; F25-Y27 PolarHBondContact O-N 3.5Å; Y27-P30 WeakPolarHBondContact O-CD 3.48Å; Y27-P30 WeakPolarHBondContact O-CG 3.08Å
28	Y	52.6	Low	58.4	Low	190 Å²	190	103.9 Å²	103.9	75%	0.745	53%	0.534	S	S	*	.	H	α-helix	trans	-86	-15.6	170.2	-77.4	-70.4	0	0	0	113.3	S24 F25	S24-Y28 WeakPolarHBondContact O-CD2 3.39Å; S24-Y28 PolarHBondContact O-N 2.84Å; F25-Y28 CarbonylContact O-C 3.49Å; F25-Y28 PolarHBondContact O-N 3.43Å; F25-Y28 VanDerWaalsContact O-N 3.1Å
29	T	49.9	Very low	56.7	Low	83 Å²	83	107.2 Å²	107.2	51%	0.509	55%	0.549	S	S	.	.	T	Hydrogen-bonded Turn	trans	-94.3	5.8	179.8	-37.7	0	0	0	0	116.5	F25 Q31	F25-T29 WeakPolarHBondContact O-CB 3.49Å; F25-T29 PolarHBondContact O-N 2.94Å; F25-T29 PolarHBondContact O-OG1 3.01Å; T29-Q31 PolarHBondContact O-N 2.78Å
30	P	49.1	Very low	55	Low	95 Å²	95	112.8 Å²	112.8	62%	0.617	57%	0.567	S	S	*	*	T	Hydrogen-bonded Turn	trans	-77.8	-11.1	170.9	30.2	-26.5	0	0	0	112.3	G26 Y27	G26-P30 WeakPolarHBondContact O-CD 3.49Å; Y27-P30 WeakPolarHBondContact O-CD 3.48Å; Y27-P30 WeakPolarHBondContact O-CG 3.08Å
31	Q	48.9	Very low	53.1	Low	138 Å²	138	119.2 Å²	119.2	65%	0.645	59%	0.59	S	S	*	*	S	Bend	trans	-101.5	-19.7	-175.5	-146	-170.7	-20.9	0	0	115.1	T29 S34	T29-Q31 PolarHBondContact O-N 2.78Å; Q31-S34 PolarHBondContact O-OG 3.34Å
32	Q	43.6	Very low	51.3	Low	144 Å²	144	122.1 Å²	122.1	67%	0.673	60%	0.602	S	S	*	*	S	Bend	trans	-89.8	-14.6	-175.5	-94.7	-117.2	-34.7	0	0	115.2	T36	Q32-T36 PolarHBondContact O-OG1 3.45Å
33	R	41.3	Very low	49.8	Very low	195 Å²	195	129 Å²	129	74%	0.736	62%	0.621	S	S	*	*	H	α-helix	trans	-90.2	-11.2	176.5	-165.1	169.7	-178.2	154.3	1.9	113.7
34	S	43.6	Very low	48.1	Very low	71 Å²	71	135.5 Å²	135.5	50%	0.497	65%	0.646	S	S	.	*	H	α-helix	trans	-82.2	-23.5	174.9	39.5	0	0	0	0	112.9	Q31 S38	Q31-S34 PolarHBondContact O-OG 3.34Å; S34-S38 VanDerWaalsContact O-CB 3.3Å; S34-S38 WeakPolarHBondContact O-CB 3.22Å
35	E	46.4	Very low	46.8	Very low	135 Å²	135	141.7 Å²	141.7	63%	0.631	67%	0.666	S	S	*	*	H	α-helix	trans	-91.8	-31.4	-177.4	-71.5	-176.2	80.4	0	0	114.1
36	T	37.4	Very low	45.7	Very low	115 Å²	115	142.2 Å²	142.2	71%	0.706	67%	0.674	S	S	*	*	H	α-helix	trans	-91	-10.6	-174.4	54	0	0	0	0	114.8	Q32	Q32-T36 PolarHBondContact O-OG1 3.45Å
37	L	39.5	Very low	44.9	Very low	106 Å²	106	148.5 Å²	148.5	56%	0.555	70%	0.695	S	S	*	*	S	Bend	trans	-112.2	5.4	172.7	-125.9	158.2	0	0	0	113.1
38	S	40.3	Very low	44.1	Very low	83 Å²	83	147.6 Å²	147.6	58%	0.58	71%	0.713	S	S	*	*	G	3₁₀ helix	trans	-77.9	-24.4	176	179.4	0	0	0	0	112.9	S34 K40	S34-S38 VanDerWaalsContact O-CB 3.3Å; S34-S38 WeakPolarHBondContact O-CB 3.22Å; S38-K40 PolarHBondContact O-N 2.85Å
39	K	39.9	Very low	43.9	Very low	208 Å²	208	146.7 Å²	146.7	90%	0.904	71%	0.713	S	S	*	*	G	3₁₀ helix	trans	-74.4	-4.4	178.7	-72.5	-72.2	-178.6	177.6	0	115.3
40	K	42.9	Very low	43.7	Very low	188 Å²	188	150 Å²	150	82%	0.817	73%	0.727	S	S	*	*	G	3₁₀ helix	trans	-115.4	-0.8	-179.5	-163	166.7	179.4	-179.6	0	115.5	S38	S38-K40 PolarHBondContact O-N 2.85Å
41	K	44.2	Very low	43.4	Very low	188 Å²	188	149.3 Å²	149.3	82%	0.817	74%	0.737	S	S	*	*			trans	-133.4	64.1	178.5	-147.9	170.6	-175.5	178.4	0	112
42	E	43.2	Very low	43.4	Very low	147 Å²	147	147.2 Å²	147.2	69%	0.687	73%	0.73	S	S	*	*			trans	-55.2	139.8	162.4	-152.5	-166.1	106.6	0	0	110.1
43	R	46.4	Very low	43.7	Very low	213 Å²	213	146 Å²	146	80%	0.804	74%	0.735	S	S	*	*			trans	64.9	87.8	164.3	-48.5	-152.6	-170.1	-149.1	0.2	117.9
44	K	41.6	Very low	43.9	Very low	205 Å²	205	141.1 Å²	141.1	89%	0.891	72%	0.723	S	S	*	*				-147.7	95.5	118.6	-111.7	-178.7	-175.8	-172.3	0	109.6	I46	K44-I46 PolarHBondContact O-N 3.28Å
45	K	43.5	Very low	44.4	Very low	185 Å²	185	143.9 Å²	143.9	80%	0.804	73%	0.733	S	S	*	*			trans	-35.1	125.2	151.2	174.8	177.2	-176.6	178.6	0	109.2
46	I	44.9	Very low	44.4	Very low	151 Å²	151	140.3 Å²	140.3	77%	0.774	72%	0.722	S	S	*	*				-165.3	125.8	129.8	-77	129.1	0	0	0	106.1	K44 A48	K44-I46 PolarHBondContact O-N 3.28Å; I46-A48 PolarHBondContact O-N 2.79Å
47	E	47.9	Very low	44.9	Very low	160 Å²	160	136.9 Å²	136.9	75%	0.748	70%	0.703	S	S	*	*			trans	-44.9	127.3	165.4	-71.4	158.2	68.9	0	0	111.7
48	A	39.9	Very low	45.4	Very low	100 Å²	100	137 Å²	137	83%	0.826	70%	0.7	S	S	*	*			trans	-133.1	106.6	152.5	0	0	0	0	0	106.8	I46	I46-A48 PolarHBondContact O-N 2.79Å
49	K	48.3	Very low	45.7	Very low	171 Å²	171	139.1 Å²	139.1	74%	0.743	70%	0.699	S	S	*	*			trans	-59.5	144.4	174.6	-64.1	-160.5	172.7	-174	0	110
50	N	45.7	Very low	46.2	Very low	153 Å²	153	133.5 Å²	133.5	82%	0.818	68%	0.679	S	S	*	*			trans	58.2	86.8	163.2	-57.6	-48.2	0	0	0	115.2	D52	N50-D52 PolarHBondContact O-N 3.32Å; N50-D52 VanDerWaalsContact O-N 3.08Å
51	G	41.2	Very low	46.6	Very low	80 Å²	80	132.2 Å²	132.2	83%	0.825	67%	0.669	S	S	*	*			trans	-68.5	101.3	165.8	0	0	0	0	0	110.2
52	D	50	Low	47	Very low	93 Å²	93	125.3 Å²	125.3	50%	0.497	65%	0.651	S	S	.	*			trans	-52.2	141.9	175.1	-176.8	-104.7	0	0	0	112.4	N50 N54	N50-D52 PolarHBondContact O-N 3.32Å; N50-D52 VanDerWaalsContact O-N 3.08Å; D52-N54 PolarHBondContact O-N 2.7Å; D52-N54 WeakPolarHBondContact OD1-CB 3.32Å; D52-N54 PolarHBondContact OD1-N 2.86Å; D52-N54 PolarHBondContact OD1-ND2 3.4Å
53	P	48.5	Very low	47.4	Very low	120 Å²	120	121.9 Å²	121.9	78%	0.779	64%	0.637	S	S	*	*	T	Hydrogen-bonded Turn	trans	-66	23.2	178.2	26.1	-33.2	0	0	0	115.2
54	N	47.3	Very low	47.6	Very low	91 Å²	91	113.8 Å²	113.8	49%	0.487	61%	0.613	S	S	.	*	T	Hydrogen-bonded Turn	trans	-81.1	-13.2	176	-107.6	-62.9	0	0	0	115.4	D52 C56 S57 E58	D52-N54 PolarHBondContact O-N 2.7Å; D52-N54 WeakPolarHBondContact OD1-CB 3.32Å; D52-N54 PolarHBondContact OD1-N 2.86Å; D52-N54 PolarHBondContact OD1-ND2 3.4Å; N54-C56 PolarHBondContact O-N 2.96Å; N54-S57 WeakPolarHBondContact O-CB 3.49Å; N54-S57 PolarHBondContact O-N 2.65Å; N54-S57 PolarHBondContact O-OG 2.73Å; N54-S57 WeakPolarHBondContact OD1-CB 3.32Å; N54-S57 PolarHBondContact OD1-OG 3.49Å; N54-E58 PolarHBondContact O-N 3.48Å
55	D	52.7	Low	48.2	Very low	130 Å²	130	107.6 Å²	107.6	70%	0.695	60%	0.595	S	S	*	*	H	α-helix	trans	-61.4	-30.3	-179.7	-81.8	-68.1	0	0	0	112.5	S57 F59	D55-S57 VanDerWaalsContact C-N 3.32Å; D55-S57 PolarHBondContact O-N 3.27Å; D55-F59 PolarHBondContact O-N 3.14Å
56	C	46.1	Very low	48.7	Very low	59 Å²	59	100.9 Å²	100.9	40%	0.399	58%	0.579	S	S	.	*	H	α-helix	trans	-68.6	-30.7	173.3	-72.1	0	0	0	0	112.6	N54 L60	N54-C56 PolarHBondContact O-N 2.96Å; C56-L60 VanDerWaalsContact O-CB 3.32Å; C56-L60 WeakPolarHBondContact O-CB 3.47Å; C56-L60 WeakPolarHBondContact O-CD1 3.31Å; C56-L60 WeakPolarHBondContact O-CG 3.04Å; C56-L60 PolarHBondContact O-N 2.85Å
57	S	49.9	Very low	49	Very low	43 Å²	43	98.8 Å²	98.8	30%	0.301	57%	0.569	S	S	.	*	H	α-helix	trans	-74.6	-37.4	-176.7	87.1	0	0	0	0	111.3	N54 D55 R61	N54-S57 WeakPolarHBondContact O-CB 3.49Å; N54-S57 PolarHBondContact O-N 2.65Å; N54-S57 PolarHBondContact O-OG 2.73Å; N54-S57 WeakPolarHBondContact OD1-CB 3.32Å; N54-S57 PolarHBondContact OD1-OG 3.49Å; D55-S57 VanDerWaalsContact C-N 3.32Å; D55-S57 PolarHBondContact O-N 3.27Å; S57-R61 WeakPolarHBondContact O-CB 2.8Å; S57-R61 PolarHBondContact O-N 3.43Å
58	E	49.8	Very low	49.1	Very low	108 Å²	108	97 Å²	97	51%	0.505	56%	0.555	S	S	.	*	H	α-helix	trans	-67.3	-40.8	176.3	-71.1	-100.3	111.3	0	0	111.3	N54 R61 G62	N54-E58 PolarHBondContact O-N 3.48Å; E58-R61 PolarHBondContact O-N 3.37Å; E58-R61 IonicContact OE1-CZ 3.06Å; E58-R61 IonicContact OE1-NH1 2.86Å; E58-R61 PolarHBondContact OE1-NH1 2.94Å; E58-R61 IonicContact OE1-NH2 2.7Å; E58-R61 PolarHBondContact OE1-NH2 3.47Å; E58-G62 PolarHBondContact O-N 3.35Å
59	F	46.6	Very low	49.7	Very low	128 Å²	128	95.8 Å²	95.8	56%	0.561	54%	0.537	S	S	*	.	H	α-helix	trans	-68.7	-43	176.8	-153.6	-96.7	0	0	0	111.7	D55 R61 G62 L63	D55-F59 PolarHBondContact O-N 3.14Å; F59-R61 VanDerWaalsContact C-N 3.3Å; F59-R61 PolarHBondContact O-N 3.43Å; F59-G62 PolarHBondContact O-N 3.42Å; F59-L63 HydrophobicContact CD1-CD1 3.6Å; F59-L63 HydrophobicContact CD1-CG 4.09Å; F59-L63 HydrophobicContact CE1-CD1 3.7Å; F59-L63 HydrophobicContact CE1-CD2 4.5Å; F59-L63 HydrophobicContact CE1-CG 4.13Å; F59-L63 WeakPolarHBondContact O-CB 3.14Å; F59-L63 VanDerWaalsContact O-CG 3.31Å; F59-L63 WeakPolarHBondContact O-CG 3.45Å; F59-L63 PolarHBondContact O-N 2.95Å
60	L	49.4	Very low	49.8	Very low	90 Å²	90	90.9 Å²	90.9	47%	0.471	53%	0.525	S	S	.	.	H	α-helix	trans	-64.2	-33.2	171.5	-73.3	170.3	0	0	0	112.2	C56 S64	C56-L60 VanDerWaalsContact O-CB 3.32Å; C56-L60 WeakPolarHBondContact O-CB 3.47Å; C56-L60 WeakPolarHBondContact O-CD1 3.31Å; C56-L60 WeakPolarHBondContact O-CG 3.04Å; C56-L60 PolarHBondContact O-N 2.85Å; L60-S64 WeakPolarHBondContact O-CA 3.44Å; L60-S64 WeakPolarHBondContact O-CB 3.45Å; L60-S64 PolarHBondContact O-N 3.03Å
61	R	51.5	Low	49.9	Very low	161 Å²	161	87.3 Å²	87.3	61%	0.608	51%	0.505	S	S	*	.	H	α-helix	trans	-71.3	-37.7	176.1	-160.7	168.1	90.4	-137	-4.3	111.5	S57 E58 F59 S65	S57-R61 WeakPolarHBondContact O-CB 2.8Å; S57-R61 PolarHBondContact O-N 3.43Å; E58-R61 PolarHBondContact O-N 3.37Å; E58-R61 IonicContact OE1-CZ 3.06Å; E58-R61 IonicContact OE1-NH1 2.86Å; E58-R61 PolarHBondContact OE1-NH1 2.94Å; E58-R61 IonicContact OE1-NH2 2.7Å; E58-R61 PolarHBondContact OE1-NH2 3.47Å; F59-R61 VanDerWaalsContact C-N 3.3Å; F59-R61 PolarHBondContact O-N 3.43Å; R61-S65 PolarHBondContact O-N 2.96Å
62	G	52.1	Low	50.5	Low	43 Å²	43	89.1 Å²	89.1	44%	0.443	50%	0.495	S	S	.	.	H	α-helix	trans	-69.8	-40	172.6	0	0	0	0	0	113.3	E58 F59 S65 G66	E58-G62 PolarHBondContact O-N 3.35Å; F59-G62 PolarHBondContact O-N 3.42Å; G62-S65 PolarHBondContact O-OG 2.97Å; G62-G66 PolarHBondContact O-N 2.99Å
63	L	51.1	Low	50.8	Low	76 Å²	76	94.1 Å²	94.1	40%	0.398	51%	0.506	S	S	.	.	H	α-helix	trans	-68.7	-39.2	172.6	-72.3	173.6	0	0	0	111.4	F59 L67	F59-L63 HydrophobicContact CD1-CD1 3.6Å; F59-L63 HydrophobicContact CD1-CG 4.09Å; F59-L63 HydrophobicContact CE1-CD1 3.7Å; F59-L63 HydrophobicContact CE1-CD2 4.5Å; F59-L63 HydrophobicContact CE1-CG 4.13Å; F59-L63 WeakPolarHBondContact O-CB 3.14Å; F59-L63 VanDerWaalsContact O-CG 3.31Å; F59-L63 WeakPolarHBondContact O-CG 3.45Å; F59-L63 PolarHBondContact O-N 2.95Å; L63-L67 WeakPolarHBondContact O-CB 3.13Å; L63-L67 PolarHBondContact O-N 3.06Å
64	S	52.2	Low	50.9	Low	42 Å²	42	92.4 Å²	92.4	29%	0.294	49%	0.494	S	S	.	.	H	α-helix	trans	-62.1	-46.4	175.4	-175.2	0	0	0	0	110.4	L60 G66 L67 R68	L60-S64 WeakPolarHBondContact O-CA 3.44Å; L60-S64 WeakPolarHBondContact O-CB 3.45Å; L60-S64 PolarHBondContact O-N 3.03Å; S64-G66 PolarHBondContact O-N 3.32Å; S64-L67 PolarHBondContact O-N 2.87Å; S64-R68 WeakPolarHBondContact O-CB 3.3Å; S64-R68 WeakPolarHBondContact O-CG 3.23Å; S64-R68 PolarHBondContact O-N 2.75Å; S64-R68 PolarHBondContact OG-NE 3.41Å
65	S	52.6	Low	50.7	Low	75 Å²	75	91.4 Å²	91.4	52%	0.524	49%	0.488	S	S	.	.	H	α-helix	trans	-61.9	-41.2	-178.8	66.8	0	0	0	0	113	R61 G62 V69	R61-S65 PolarHBondContact O-N 2.96Å; G62-S65 PolarHBondContact O-OG 2.97Å; S65-V69 VanDerWaalsContact O-CG2 3.3Å; S65-V69 WeakPolarHBondContact O-CG2 3.32Å; S65-V69 PolarHBondContact O-N 3.26Å
66	G	54.2	Low	50.7	Low	44 Å²	44	87.1 Å²	87.1	45%	0.454	48%	0.475	S	S	.	.	H	α-helix	trans	-73.6	-43.4	176.4	0	0	0	0	0	113.8	G62 S64 V69 S70	G62-G66 PolarHBondContact O-N 2.99Å; S64-G66 PolarHBondContact O-N 3.32Å; G66-V69 PolarHBondContact O-N 3.34Å; G66-S70 WeakPolarHBondContact O-CB 3.44Å; G66-S70 PolarHBondContact O-N 3.14Å
67	L	51.6	Low	51	Low	108 Å²	108	89.4 Å²	89.4	57%	0.565	49%	0.489	S	S	*	.	H	α-helix	trans	-67.6	-35.4	179	-166.7	79.2	0	0	0	111.3	L63 S64 S70 L71	L63-L67 WeakPolarHBondContact O-CB 3.13Å; L63-L67 PolarHBondContact O-N 3.06Å; S64-L67 PolarHBondContact O-N 2.87Å; L67-S70 PolarHBondContact O-N 3.38Å; L67-L71 WeakPolarHBondContact O-CA 3.05Å; L67-L71 WeakPolarHBondContact O-CB 3.27Å; L67-L71 PolarHBondContact O-N 2.73Å
68	R	51.2	Low	50.9	Low	121 Å²	121	95.1 Å²	95.1	46%	0.457	50%	0.504	S	S	.	.	H	α-helix	trans	-67	-42.2	177	-63.7	-90.6	177	-156.4	-1.1	111.1	S64 L71 I72	S64-R68 WeakPolarHBondContact O-CB 3.3Å; S64-R68 WeakPolarHBondContact O-CG 3.23Å; S64-R68 PolarHBondContact O-N 2.75Å; S64-R68 PolarHBondContact OG-NE 3.41Å; R68-L71 PolarHBondContact O-N 3.45Å; R68-I72 WeakPolarHBondContact O-CB 3.47Å; R68-I72 WeakPolarHBondContact O-CD1 3.11Å; R68-I72 WeakPolarHBondContact O-CG1 3.33Å; R68-I72 PolarHBondContact O-N 2.81Å
69	V	51.7	Low	50.9	Low	76 Å²	76	92 Å²	92	46%	0.461	50%	0.497	S	S	.	.	H	α-helix	trans	-67.6	-38.9	177.1	173.8	0	0	0	0	111.2	S65 G66 R73	S65-V69 VanDerWaalsContact O-CG2 3.3Å; S65-V69 WeakPolarHBondContact O-CG2 3.32Å; S65-V69 PolarHBondContact O-N 3.26Å; G66-V69 PolarHBondContact O-N 3.34Å; V69-R73 PolarHBondContact O-N 2.95Å; V69-R73 VanDerWaalsContact O-N 3.1Å
70	S	49.7	Very low	51.1	Low	68 Å²	68	91.4 Å²	91.4	48%	0.476	51%	0.506	S	S	.	.	H	α-helix	trans	-68.2	-41.1	173.9	-167.2	0	0	0	0	112	G66 L67 R73 T74	G66-S70 WeakPolarHBondContact O-CB 3.44Å; G66-S70 PolarHBondContact O-N 3.14Å; L67-S70 PolarHBondContact O-N 3.38Å; S70-R73 PolarHBondContact O-N 2.8Å; S70-T74 WeakPolarHBondContact O-CB 3.34Å; S70-T74 VanDerWaalsContact O-CG2 3.23Å; S70-T74 WeakPolarHBondContact O-CG2 3.1Å; S70-T74 PolarHBondContact O-N 3.38Å; S70-T74 PolarHBondContact O-OG1 3.31Å
71	L	48.3	Very low	51.1	Low	77 Å²	77	91.2 Å²	91.2	40%	0.403	51%	0.512	S	S	.	.	H	α-helix	trans	-66.3	-41.8	176.8	-169	73.9	0	0	0	111.4	L67 R68 T74 L75	L67-L71 WeakPolarHBondContact O-CA 3.05Å; L67-L71 WeakPolarHBondContact O-CB 3.27Å; L67-L71 PolarHBondContact O-N 2.73Å; R68-L71 PolarHBondContact O-N 3.45Å; L71-T74 VanDerWaalsContact CA-OG1 3.3Å; L71-T74 WeakPolarHBondContact CA-OG1 3.28Å; L71-T74 PolarHBondContact O-N 3.1Å; L71-T74 PolarHBondContact O-OG1 2.73Å; L71-T74 VanDerWaalsContact O-OG1 3.06Å; L71-L75 HydrophobicContact CD1-CD1 3.57Å; L71-L75 HydrophobicContact CG-CD1 4.11Å; L71-L75 VanDerWaalsContact O-CB 3.27Å; L71-L75 WeakPolarHBondContact O-CB 3.3Å; L71-L75 PolarHBondContact O-N 3.38Å
72	I	55	Low	51	Low	119 Å²	119	86.6 Å²	86.6	61%	0.61	50%	0.499	S	S	*	.	H	α-helix	trans	-66.6	-37.9	176.7	-68.7	162.1	0	0	0	111	R68 G76	R68-I72 WeakPolarHBondContact O-CB 3.47Å; R68-I72 WeakPolarHBondContact O-CD1 3.11Å; R68-I72 WeakPolarHBondContact O-CG1 3.33Å; R68-I72 PolarHBondContact O-N 2.81Å; I72-G76 VanDerWaalsContact O-CA 3.28Å; I72-G76 WeakPolarHBondContact O-CA 3.37Å; I72-G76 PolarHBondContact O-N 2.86Å
73	R	56.2	Low	51	Low	197 Å²	197	88.1 Å²	88.1	74%	0.743	50%	0.503	S	S	*	.	H	α-helix	trans	-66.3	-37.2	172.6	-88.4	-162.2	-167.8	92.4	0.3	112.9	V69 S70	V69-R73 PolarHBondContact O-N 2.95Å; V69-R73 VanDerWaalsContact O-N 3.1Å; S70-R73 PolarHBondContact O-N 2.8Å
74	T	49.3	Very low	51	Low	84 Å²	84	89.3 Å²	89.3	52%	0.515	51%	0.513	S	S	.	.	H	α-helix	trans	-82.6	-30	-177.6	53.9	0	0	0	0	113.1	S70 L71	S70-T74 WeakPolarHBondContact O-CB 3.34Å; S70-T74 VanDerWaalsContact O-CG2 3.23Å; S70-T74 WeakPolarHBondContact O-CG2 3.1Å; S70-T74 PolarHBondContact O-N 3.38Å; S70-T74 PolarHBondContact O-OG1 3.31Å; L71-T74 VanDerWaalsContact CA-OG1 3.3Å; L71-T74 WeakPolarHBondContact CA-OG1 3.28Å; L71-T74 PolarHBondContact O-N 3.1Å; L71-T74 PolarHBondContact O-OG1 2.73Å; L71-T74 VanDerWaalsContact O-OG1 3.06Å
75	L	43.8	Very low	50.4	Low	70 Å²	70	95.7 Å²	95.7	37%	0.366	53%	0.531	S	S	.	.	H	α-helix	trans	-100.2	-8.4	178	-92.4	75.1	0	0	0	114.6	L71 P77 W78 A79 L82	L71-L75 HydrophobicContact CD1-CD1 3.57Å; L71-L75 HydrophobicContact CG-CD1 4.11Å; L71-L75 VanDerWaalsContact O-CB 3.27Å; L71-L75 WeakPolarHBondContact O-CB 3.3Å; L71-L75 PolarHBondContact O-N 3.38Å; L75-P77 VanDerWaalsContact O-N 3.14Å; L75-W78 PolarHBondContact O-N 2.83Å; L75-A79 PolarHBondContact O-N 3.49Å; L75-L82 HydrophobicContact CD2-CD1 3.69Å
76	G	52.1	Low	50.1	Low	41 Å²	41	100.4 Å²	100.4	42%	0.423	54%	0.538	S	S	.	.	G	3₁₀ helix	trans	-48.5	-37.1	178.1	0	0	0	0	0	115.1	I72 W78 A79	I72-G76 VanDerWaalsContact O-CA 3.28Å; I72-G76 WeakPolarHBondContact O-CA 3.37Å; I72-G76 PolarHBondContact O-N 2.86Å; G76-W78 VanDerWaalsContact C-N 3.3Å; G76-W78 PolarHBondContact O-N 3.15Å; G76-A79 WeakPolarHBondContact O-CB 3.04Å
77	P	52.8	Low	50	Low	107 Å²	107	103.3 Å²	103.3	70%	0.695	55%	0.547	S	S	*	.	G	3₁₀ helix	trans	-73.9	-13.9	175.9	-17.7	31.7	0	0	0	115.1	L75	L75-P77 VanDerWaalsContact O-N 3.14Å
78	W	48.6	Very low	49.8	Very low	162 Å²	162	103.4 Å²	103.4	61%	0.614	55%	0.552	S	S	*	*	G	3₁₀ helix	trans	-101.6	6.2	179.7	-80.4	58.4	0	0	0	112.9	L75 G76 P80 S81	L75-W78 PolarHBondContact O-N 2.83Å; G76-W78 VanDerWaalsContact C-N 3.3Å; G76-W78 PolarHBondContact O-N 3.15Å; W78-P80 WeakPolarHBondContact O-CD 3.35Å; W78-S81 PolarHBondContact O-N 3.37Å
79	A	49.7	Very low	49.8	Very low	42 Å²	42	103.1 Å²	103.1	35%	0.347	56%	0.558	S	S	.	*	T	Hydrogen-bonded Turn	trans	-66.5	-16.9	-168.4	0	0	0	0	0	118.6	L75 G76 S81 S83	L75-A79 PolarHBondContact O-N 3.49Å; G76-A79 WeakPolarHBondContact O-CB 3.04Å; A79-S81 PolarHBondContact O-N 3.49Å; A79-S83 PolarHBondContact O-OG 3.4Å
80	P	50.6	Low	49.4	Very low	116 Å²	116	104.3 Å²	104.3	75%	0.753	57%	0.566	S	S	*	*	T	Hydrogen-bonded Turn	trans	-65.8	-26.9	176.6	-20	31.9	0	0	0	112.9	W78	W78-P80 WeakPolarHBondContact O-CD 3.35Å
81	S	49.5	Very low	49.3	Very low	87 Å²	87	106.2 Å²	106.2	61%	0.608	58%	0.577	S	S	*	*	T	Hydrogen-bonded Turn	trans	-95.4	-18.7	-172.6	112.3	0	0	0	0	114.6	W78 A79	W78-S81 PolarHBondContact O-N 3.37Å; A79-S81 PolarHBondContact O-N 3.49Å
82	L	49.5	Very low	49.3	Very low	63 Å²	63	108 Å²	108	33%	0.33	60%	0.595	S	S	.	*	T	Hydrogen-bonded Turn	trans	-97.1	-18.5	-175.4	-89.3	155.4	0	0	0	113.7	L75 T84 W85 W86	L75-L82 HydrophobicContact CD2-CD1 3.69Å; L82-T84 VanDerWaalsContact C-N 3.27Å; L82-T84 PolarHBondContact O-N 3.49Å; L82-W85 PolarHBondContact O-N 3.28Å; L82-W86 PolarHBondContact O-N 2.99Å; L82-W86 VanDerWaalsContact O-N 3.1Å
83	S	52	Low	49	Very low	76 Å²	76	108.8 Å²	108.8	53%	0.531	61%	0.61	S	S	.	*	H	α-helix	trans	-62.4	-35.6	177.6	-59.2	0	0	0	0	111.9	A79 W85 W86 T87	A79-S83 PolarHBondContact O-OG 3.4Å; S83-W85 VanDerWaalsContact C-N 3.35Å; S83-W85 PolarHBondContact O-N 3.39Å; S83-W86 PolarHBondContact O-N 3.28Å; S83-T87 PolarHBondContact O-N 3.26Å; S83-T87 PolarHBondContact O-OG1 3.1Å
84	T	50	Low	48.4	Very low	100 Å²	100	104.2 Å²	104.2	61%	0.613	62%	0.615	S	S	*	*	H	α-helix	trans	-69.8	-29.7	178.7	-24.7	0	0	0	0	113.1	L82 T87 T88	L82-T84 VanDerWaalsContact C-N 3.27Å; L82-T84 PolarHBondContact O-N 3.49Å; T84-T87 PolarHBondContact O-OG1 2.93Å; T84-T88 PolarHBondContact O-OG1 3.34Å
85	W	40.3	Very low	48.2	Very low	177 Å²	177	109.5 Å²	109.5	67%	0.67	64%	0.636	S	S	*	*	H	α-helix	trans	-83.1	-35	178.4	-159	-21	0	0	0	110.9	L82 S83 T87 T88	L82-W85 PolarHBondContact O-N 3.28Å; S83-W85 VanDerWaalsContact C-N 3.35Å; S83-W85 PolarHBondContact O-N 3.39Å; W85-T87 VanDerWaalsContact C-N 3.3Å; W85-T87 PolarHBondContact O-N 3.48Å; W85-T88 PolarHBondContact O-N 3.29Å; W85-T88 VanDerWaalsContact O-N 3.15Å
86	W	45.4	Very low	48.3	Very low	173 Å²	173	109.6 Å²	109.6	66%	0.655	65%	0.654	S	S	*	*	H	α-helix	trans	-64.1	-31.7	176.2	-106.7	72.3	0	0	0	113.4	L82 S83 T88	L82-W86 PolarHBondContact O-N 2.99Å; L82-W86 VanDerWaalsContact O-N 3.1Å; S83-W86 PolarHBondContact O-N 3.28Å; W86-T88 VanDerWaalsContact C-N 3.3Å; W86-T88 PolarHBondContact O-N 3.44Å
87	T	52.2	Low	47.7	Very low	105 Å²	105	115.9 Å²	115.9	64%	0.644	68%	0.676	S	S	*	*	H	α-helix	trans	-72.8	-17.3	174.6	21.8	0	0	0	0	114.4	S83 T84 W85	S83-T87 PolarHBondContact O-N 3.26Å; S83-T87 PolarHBondContact O-OG1 3.1Å; T84-T87 PolarHBondContact O-OG1 2.93Å; W85-T87 VanDerWaalsContact C-N 3.3Å; W85-T87 PolarHBondContact O-N 3.48Å
88	T	49	Very low	47.3	Very low	111 Å²	111	114.1 Å²	114.1	68%	0.681	68%	0.677	S	S	*	*	H	α-helix	trans	-86.5	-21.5	178.8	-53	0	0	0	0	112.9	T84 W85 W86	T84-T88 PolarHBondContact O-OG1 3.34Å; W85-T88 PolarHBondContact O-N 3.29Å; W85-T88 VanDerWaalsContact O-N 3.15Å; W86-T88 VanDerWaalsContact C-N 3.3Å; W86-T88 PolarHBondContact O-N 3.44Å
89	I	50.1	Low	46.6	Very low	114 Å²	114	114.5 Å²	114.5	59%	0.585	69%	0.691	S	S	*	*	H	α-helix	trans	-93.3	-13.2	-170.7	-62.7	175.7	0	0	0	113.5	P91	I89-P91 WeakPolarHBondContact O-CD 3.45Å
90	T	42.5	Very low	46.7	Very low	102 Å²	102	118.4 Å²	118.4	63%	0.626	71%	0.712	S	S	*	*			trans	-97.1	94.3	168.1	32	0	0	0	0	111
91	P	49.4	Very low	46	Very low	108 Å²	108	120 Å²	120	70%	0.701	75%	0.75	S	S	*	*			trans	-73.4	134.2	156.6	32.7	-29.5	0	0	0	107.9	I89	I89-P91 WeakPolarHBondContact O-CD 3.45Å
92	S	47.9	Very low	45.8	Very low	113 Å²	113	121.7 Å²	121.7	79%	0.79	76%	0.757	S	S	*	*	S	Bend	trans	71	85.6	167.5	-57.5	0	0	0	0	116.9
93	C	48	Very low	45.6	Very low	137 Å²	137	124.7 Å²	124.7	93%	0.926	78%	0.779	S	S	*	*			trans	-169.3	62.9	141.6	-89.6	0	0	0	0	109.2
94	A	42.7	Very low	45.3	Very low	101 Å²	101	127.4 Å²	127.4	84%	0.835	79%	0.793	S	S	*	*			trans	-143.3	81.7	163	0	0	0	0	0	108.3
95	M	45.2	Very low	45	Very low	194 Å²	194	129.1 Å²	129.1	96%	0.956	80%	0.804	S	S	*	*			trans	-61.2	131.8	164.8	-152.7	97.3	164.6	0	0	108.4
96	G	46.4	Very low	45.3	Very low	73 Å²	73	126.1 Å²	126.1	75%	0.753	81%	0.812	S	S	*	*			trans	56.2	96.1	149.3	0	0	0	0	0	118
97	I	40.7	Very low	45.3	Very low	173 Å²	173	122.9 Å²	122.9	89%	0.887	82%	0.822	S	S	*	*			trans	-132.4	123.9	146.8	-34.5	-175.9	0	0	0	106.9
98	G	43.8	Very low	44.8	Very low	70 Å²	70	124.2 Å²	124.2	72%	0.722	84%	0.835	S	S	*	*	P	Polyproline II helix	trans	-61.2	146.2	-164.2	0	0	0	0	0	115.3
99	L	33.5	Very low	44.4	Very low	170 Å²	170	125.2 Å²	125.2	89%	0.89	85%	0.847	S	S	*	*	P	Polyproline II helix	trans	-89.1	120.3	157.9	-90.8	147.5	0	0	0	108.4
100	P	51.2	Low	44	Very low	124 Å²	124	126.2 Å²	126.2	81%	0.805	87%	0.869	S	S	*	*	P	Polyproline II helix	trans	-94.1	131.3	146.7	33.1	-22.8	0	0	0	108.6
101	G	36.4	Very low	44.1	Very low	149 Å²	149	128.4 Å²	128.4	100%	1.536	89%	0.891	S	S	*	*			trans	134.3	0	173.1	0	0	0	0	0	112.9

Retrieved 101 of 101 residues in 26.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).