A0A087WZR1_HUMAN Loading...

Interferon alpha inducible protein 27

AlphaFold DB , UniProt , Accession A0A087WZR1, Species HUMAN (Homo sapiens, Human), Gene IFI27, Length 119 aa.

						>A0A087WZR1_HUMAN|A0A087WZR1|IFI27
MEASALTSSAVTSVAKVVRVASGSAVVLPLARIATVVIGGVAAVPMVLSAMGFTAAGIASSSIAAKMMSAAAIANGGGVASGSLVATLQSLGATGLSGLTKFILGSIGSAIAAVIARFY
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	37.4	Very low	37.2	Very low	233 Å²	233	106.8 Å²	106.8	100%	1.148	66%	0.656	S	S	*	*				0	48.6	0	-151.4	153.6	167.3	0	0	108.9
2	E	34.8	Very low	37.2	Very low	161 Å²	161	105.7 Å²	105.7	75%	0.752	65%	0.649	S	S	*	*			trans	-130.4	-1.6	-163.1	-66.9	-77	90.4	0	0	112.7	L6	E2-L6 WeakPolarHBondContact O-CD1 3.31Å
3	A	30.2	Very low	37.4	Very low	82 Å²	82	103.5 Å²	103.5	68%	0.678	64%	0.641	S	S	*	*	S	Bend	trans	-87.8	-20	-177.8	0	0	0	0	0	113.2
4	S	37.5	Very low	37.7	Very low	94 Å²	94	102.5 Å²	102.5	66%	0.657	63%	0.634	S	S	*	*	H	α-helix	trans	-83.7	-20.5	-173	-47.8	0	0	0	0	113.6
5	A	36.8	Very low	37.7	Very low	68 Å²	68	99.1 Å²	99.1	56%	0.562	62%	0.62	S	S	*	*	H	α-helix	trans	-78.6	-37.1	179.9	0	0	0	0	0	112.6	T7 S8 S9	A5-T7 VanDerWaalsContact C-N 3.32Å; A5-T7 PolarHBondContact O-N 3.4Å; A5-S8 PolarHBondContact O-N 3.41Å; A5-S9 PolarHBondContact O-N 3.47Å
6	L	38.7	Very low	37.6	Very low	134 Å²	134	103.3 Å²	103.3	70%	0.702	63%	0.626	S	S	*	*	H	α-helix	trans	-69	-31	177	-75.2	107.2	0	0	0	112.5	E2 A10	E2-L6 WeakPolarHBondContact O-CD1 3.31Å; L6-A10 WeakPolarHBondContact O-CB 3.16Å; L6-A10 PolarHBondContact O-N 3.31Å
7	T	40.6	Very low	37.8	Very low	94 Å²	94	103.4 Å²	103.4	58%	0.577	63%	0.627	S	S	*	*	H	α-helix	trans	-70.6	-33.1	177.7	-135.8	0	0	0	0	112	A5 V11	A5-T7 VanDerWaalsContact C-N 3.32Å; A5-T7 PolarHBondContact O-N 3.4Å; T7-V11 WeakPolarHBondContact O-CB 3.1Å; T7-V11 WeakPolarHBondContact O-CG2 3.22Å; T7-V11 PolarHBondContact O-N 3.11Å; T7-V11 VanDerWaalsContact O-N 3.16Å
8	S	36	Very low	38	Very low	73 Å²	73	102.1 Å²	102.1	51%	0.51	62%	0.619	S	S	.	*	H	α-helix	trans	-77	-38.1	-177	-156.3	0	0	0	0	113.1	A5 T12	A5-S8 PolarHBondContact O-N 3.41Å; S8-T12 PolarHBondContact O-N 3.32Å; S8-T12 VanDerWaalsContact O-N 3.16Å; S8-T12 PolarHBondContact O-OG1 3.42Å
9	S	37.6	Very low	38.1	Very low	84 Å²	84	108.2 Å²	108.2	59%	0.587	63%	0.63	S	S	*	*	H	α-helix	trans	-72.5	-31.9	175.5	-70	0	0	0	0	113.2	A5 S13	A5-S9 PolarHBondContact O-N 3.47Å; S9-S13 PolarHBondContact O-N 3.31Å; S9-S13 PolarHBondContact O-OG 3.31Å
10	A	39.6	Very low	38.3	Very low	56 Å²	56	109.1 Å²	109.1	46%	0.463	64%	0.636	S	S	.	*	H	α-helix	trans	-70.4	-44.3	174.8	0	0	0	0	0	111.6	L6 T12 S13 V14	L6-A10 WeakPolarHBondContact O-CB 3.16Å; L6-A10 PolarHBondContact O-N 3.31Å; A10-T12 VanDerWaalsContact C-N 3.33Å; A10-T12 PolarHBondContact O-N 3.08Å; A10-S13 PolarHBondContact O-N 2.95Å; A10-V14 WeakPolarHBondContact O-CG2 3.33Å; A10-V14 PolarHBondContact O-N 3.43Å
11	V	39.8	Very low	38.4	Very low	96 Å²	96	106.1 Å²	106.1	58%	0.582	63%	0.625	S	S	*	*	H	α-helix	trans	-60.9	-40.9	176.5	156.1	0	0	0	0	112	T7 V14 A15	T7-V11 WeakPolarHBondContact O-CB 3.1Å; T7-V11 WeakPolarHBondContact O-CG2 3.22Å; T7-V11 PolarHBondContact O-N 3.11Å; T7-V11 VanDerWaalsContact O-N 3.16Å; V11-V14 PolarHBondContact O-N 3.18Å; V11-A15 WeakPolarHBondContact O-CB 3.18Å; V11-A15 PolarHBondContact O-N 3.05Å
12	T	37.6	Very low	38.5	Very low	93 Å²	93	100.1 Å²	100.1	57%	0.571	61%	0.606	S	S	*	*	H	α-helix	trans	-69.3	-35.9	-179.8	-54.8	0	0	0	0	112.2	S8 A10 A15 K16	S8-T12 PolarHBondContact O-N 3.32Å; S8-T12 VanDerWaalsContact O-N 3.16Å; S8-T12 PolarHBondContact O-OG1 3.42Å; A10-T12 VanDerWaalsContact C-N 3.33Å; A10-T12 PolarHBondContact O-N 3.08Å; T12-A15 PolarHBondContact O-N 3.19Å; T12-K16 PolarHBondContact O-N 3.21Å; T12-K16 VanDerWaalsContact O-N 3.16Å
13	S	39.9	Very low	39	Very low	78 Å²	78	95.7 Å²	95.7	55%	0.545	60%	0.604	S	S	.	*	H	α-helix	trans	-70.4	-39.9	176	-61.7	0	0	0	0	112	S9 A10 K16 V17	S9-S13 PolarHBondContact O-N 3.31Å; S9-S13 PolarHBondContact O-OG 3.31Å; A10-S13 PolarHBondContact O-N 2.95Å; S13-K16 PolarHBondContact O-N 2.96Å; S13-V17 WeakPolarHBondContact O-CG2 2.9Å; S13-V17 PolarHBondContact O-N 3.41Å; S13-V17 VanDerWaalsContact O-N 3.09Å
14	V	41.2	Very low	39.1	Very low	89 Å²	89	95.9 Å²	95.9	54%	0.539	60%	0.6	S	S	.	*	H	α-helix	trans	-64.2	-40.9	173.9	167.7	0	0	0	0	111.2	A10 V11 K16 V17 V18	A10-V14 WeakPolarHBondContact O-CG2 3.33Å; A10-V14 PolarHBondContact O-N 3.43Å; V11-V14 PolarHBondContact O-N 3.18Å; V14-K16 VanDerWaalsContact C-N 3.33Å; V14-K16 PolarHBondContact O-N 3.18Å; V14-V17 PolarHBondContact O-N 2.85Å; V14-V18 HydrophobicContact CG1-CG2 4.43Å; V14-V18 WeakPolarHBondContact O-CB 3.22Å; V14-V18 WeakPolarHBondContact O-CG2 3.48Å; V14-V18 PolarHBondContact O-N 2.83Å
15	A	38.4	Very low	39.4	Very low	52 Å²	52	96.5 Å²	96.5	43%	0.43	61%	0.611	S	S	.	*	H	α-helix	trans	-64	-36.4	177.3	0	0	0	0	0	112.8	V11 T12 R19	V11-A15 WeakPolarHBondContact O-CB 3.18Å; V11-A15 PolarHBondContact O-N 3.05Å; T12-A15 PolarHBondContact O-N 3.19Å; A15-R19 WeakPolarHBondContact O-CG 3.31Å; A15-R19 PolarHBondContact O-N 3.47Å
16	K	35.5	Very low	39.6	Very low	165 Å²	165	99.5 Å²	99.5	72%	0.717	62%	0.622	S	S	*	*	H	α-helix	trans	-71.2	-37.6	176.7	-158.6	180	-178.6	82.5	0	111.9	T12 S13 V14 R19 V20	T12-K16 PolarHBondContact O-N 3.21Å; T12-K16 VanDerWaalsContact O-N 3.16Å; S13-K16 PolarHBondContact O-N 2.96Å; V14-K16 VanDerWaalsContact C-N 3.33Å; V14-K16 PolarHBondContact O-N 3.18Å; K16-R19 PolarHBondContact O-N 2.73Å; K16-V20 PolarHBondContact O-N 3.17Å
17	V	41.7	Very low	39.8	Very low	105 Å²	105	96.2 Å²	96.2	64%	0.636	61%	0.607	S	S	*	*	H	α-helix	trans	-65.5	-42	173.5	163.9	0	0	0	0	111.6	S13 V14 V20	S13-V17 WeakPolarHBondContact O-CG2 2.9Å; S13-V17 PolarHBondContact O-N 3.41Å; S13-V17 VanDerWaalsContact O-N 3.09Å; V14-V17 PolarHBondContact O-N 2.85Å; V17-V20 PolarHBondContact O-N 2.82Å
18	V	41.2	Very low	39.8	Very low	80 Å²	80	97.4 Å²	97.4	49%	0.485	61%	0.609	S	S	.	*	H	α-helix	trans	-65.8	-38.3	177.5	166.2	0	0	0	0	111.8	V14 V20 A21	V14-V18 HydrophobicContact CG1-CG2 4.43Å; V14-V18 WeakPolarHBondContact O-CB 3.22Å; V14-V18 WeakPolarHBondContact O-CG2 3.48Å; V14-V18 PolarHBondContact O-N 2.83Å; V18-V20 VanDerWaalsContact C-N 3.33Å; V18-V20 PolarHBondContact O-N 3.3Å; V18-A21 PolarHBondContact O-N 2.82Å
19	R	39.7	Very low	40.1	Very low	218 Å²	218	98 Å²	98	82%	0.823	61%	0.611	S	S	*	*	H	α-helix	trans	-65	-32.3	176	-83	-110.1	-170.2	122.9	0.2	113.4	A15 K16 A21	A15-R19 WeakPolarHBondContact O-CG 3.31Å; A15-R19 PolarHBondContact O-N 3.47Å; K16-R19 PolarHBondContact O-N 2.73Å; R19-A21 VanDerWaalsContact C-N 3.25Å; R19-A21 PolarHBondContact O-N 3.46Å
20	V	41.1	Very low	40.3	Very low	126 Å²	126	99.9 Å²	99.9	76%	0.764	61%	0.614	S	S	*	*	H	α-helix	trans	-69.1	-23.8	176.1	164.3	0	0	0	0	112.2	K16 V17 V18	K16-V20 PolarHBondContact O-N 3.17Å; V17-V20 PolarHBondContact O-N 2.82Å; V18-V20 VanDerWaalsContact C-N 3.33Å; V18-V20 PolarHBondContact O-N 3.3Å
21	A	40.7	Very low	40.4	Very low	48 Å²	48	98.6 Å²	98.6	40%	0.397	60%	0.604	S	S	.	*	T	Hydrogen-bonded Turn	trans	-88.2	-7.7	-177	0	0	0	0	0	114.6	V18 R19 G23	V18-A21 PolarHBondContact O-N 2.82Å; R19-A21 VanDerWaalsContact C-N 3.25Å; R19-A21 PolarHBondContact O-N 3.46Å; A21-G23 PolarHBondContact O-N 2.83Å
22	S	40.7	Very low	40.5	Very low	107 Å²	107	102 Å²	102	75%	0.748	61%	0.606	S	S	*	*	T	Hydrogen-bonded Turn	trans	-82.7	11.3	-174.2	-166.7	0	0	0	0	114.6
23	G	44.9	Very low	40.7	Very low	68 Å²	68	102.4 Å²	102.4	70%	0.701	60%	0.603	S	S	*	*	T	Hydrogen-bonded Turn	trans	-95.4	-15.4	-170.8	0	0	0	0	0	117.2	A21	A21-G23 PolarHBondContact O-N 2.83Å
24	S	32.6	Very low	40.8	Very low	85 Å²	85	100.7 Å²	100.7	59%	0.594	59%	0.594	S	S	*	*			trans	-139.1	119.9	-173.1	-72.3	0	0	0	0	112.4	V26 V27	S24-V26 PolarHBondContact O-N 3.45Å; S24-V27 WeakPolarHBondContact O-CG2 3.48Å; S24-V27 PolarHBondContact O-N 2.84Å; S24-V27 VanDerWaalsContact O-N 3.13Å
25	A	42.9	Very low	41	Very low	108 Å²	108	99.9 Å²	99.9	89%	0.893	59%	0.589	S	S	*	*	T	Hydrogen-bonded Turn	trans	-63.3	10.9	-174	0	0	0	0	0	116.2
26	V	42	Very low	41.3	Very low	131 Å²	131	102.3 Å²	102.3	79%	0.794	60%	0.599	S	S	*	*	T	Hydrogen-bonded Turn	trans	-114.5	-13.1	178.4	-171.3	0	0	0	0	112.4	S24	S24-V26 PolarHBondContact O-N 3.45Å
27	V	41.7	Very low	41.7	Very low	65 Å²	65	98.5 Å²	98.5	39%	0.394	59%	0.589	S	S	.	*	S	Bend	trans	-84.7	-7.8	179.7	-114.6	0	0	0	0	114.1	S24 L30 A31	S24-V27 WeakPolarHBondContact O-CG2 3.48Å; S24-V27 PolarHBondContact O-N 2.84Å; S24-V27 VanDerWaalsContact O-N 3.13Å; V27-L30 PolarHBondContact O-N 2.88Å; V27-A31 WeakPolarHBondContact O-CB 3.24Å; V27-A31 PolarHBondContact O-N 2.82Å
28	L	41.4	Very low	42	Very low	119 Å²	119	98.6 Å²	98.6	62%	0.623	59%	0.585	S	S	*	*	H	α-helix	trans	-56.5	-41.3	-171.5	-148.3	70.4	0	0	0	114.7	R32	L28-R32 WeakPolarHBondContact O-CB 3.37Å; L28-R32 WeakPolarHBondContact O-CG 3.42Å; L28-R32 PolarHBondContact O-N 3.4Å
29	P	41.8	Very low	42.2	Very low	85 Å²	85	96.6 Å²	96.6	55%	0.552	58%	0.58	S	S	*	*	H	α-helix	trans	-78.9	-40.2	-179.6	28.7	-31.2	0	0	0	112.7	R32 I33	P29-R32 PolarHBondContact O-N 3.26Å; P29-I33 WeakPolarHBondContact O-CD1 2.99Å; P29-I33 WeakPolarHBondContact O-CG1 3.21Å; P29-I33 PolarHBondContact O-N 3.13Å
30	L	42.2	Very low	42.3	Very low	124 Å²	124	87.6 Å²	87.6	65%	0.649	56%	0.555	S	S	*	*	H	α-helix	trans	-74.9	-35.8	-177.5	-168.9	61.9	0	0	0	111.9	V27 I33 A34	V27-L30 PolarHBondContact O-N 2.88Å; L30-I33 PolarHBondContact O-N 3.15Å; L30-A34 WeakPolarHBondContact O-CB 3.43Å; L30-A34 PolarHBondContact O-N 2.92Å
31	A	42.2	Very low	42.4	Very low	29 Å²	29	86.4 Å²	86.4	24%	0.24	55%	0.548	C	S	.	.	H	α-helix	trans	-69.4	-37.8	172.2	0	0	0	0	0	111.5	V27 A34 T35	V27-A31 WeakPolarHBondContact O-CB 3.24Å; V27-A31 PolarHBondContact O-N 2.82Å; A31-A34 PolarHBondContact O-N 3.49Å; A31-T35 WeakPolarHBondContact O-CB 3.11Å; A31-T35 VanDerWaalsContact O-CG2 3.29Å; A31-T35 WeakPolarHBondContact O-CG2 2.95Å; A31-T35 PolarHBondContact O-N 2.77Å; A31-T35 PolarHBondContact O-OG1 3.36Å
32	R	41.8	Very low	42.7	Very low	168 Å²	168	87.2 Å²	87.2	63%	0.634	56%	0.555	S	S	*	*	H	α-helix	trans	-59.4	-48.2	171	-76.2	-91.7	-175	120.9	0.8	110.7	L28 P29 A34 T35 V36	L28-R32 WeakPolarHBondContact O-CB 3.37Å; L28-R32 WeakPolarHBondContact O-CG 3.42Å; L28-R32 PolarHBondContact O-N 3.4Å; P29-R32 PolarHBondContact O-N 3.26Å; R32-A34 PolarHBondContact O-N 3.13Å; R32-T35 WeakPolarHBondContact CA-OG1 3.02Å; R32-T35 PolarHBondContact O-N 2.89Å; R32-T35 PolarHBondContact O-OG1 3.39Å; R32-V36 WeakPolarHBondContact O-CB 3.34Å; R32-V36 VanDerWaalsContact O-CG2 3.24Å; R32-V36 WeakPolarHBondContact O-CG2 3.01Å; R32-V36 PolarHBondContact O-N 3.44Å
33	I	41.3	Very low	42.5	Very low	100 Å²	100	84.3 Å²	84.3	51%	0.513	54%	0.537	S	S	.	.	H	α-helix	trans	-60.3	-46	176.2	-66.6	159.7	0	0	0	110.6	P29 L30 T35 V36 V37	P29-I33 WeakPolarHBondContact O-CD1 2.99Å; P29-I33 WeakPolarHBondContact O-CG1 3.21Å; P29-I33 PolarHBondContact O-N 3.13Å; L30-I33 PolarHBondContact O-N 3.15Å; I33-T35 PolarHBondContact O-N 2.88Å; I33-V36 PolarHBondContact O-N 3.45Å; I33-V37 HydrophobicContact CG2-CG2 4.22Å; I33-V37 WeakPolarHBondContact O-CB 3.15Å; I33-V37 WeakPolarHBondContact O-CG2 3.34Å; I33-V37 PolarHBondContact O-N 3.35Å
34	A	42.3	Very low	42.2	Very low	43 Å²	43	85.4 Å²	85.4	36%	0.355	53%	0.53	S	S	.	.	H	α-helix	trans	-63.2	-41	177.9	0	0	0	0	0	112.2	L30 A31 R32 V37 I38	L30-A34 WeakPolarHBondContact O-CB 3.43Å; L30-A34 PolarHBondContact O-N 2.92Å; A31-A34 PolarHBondContact O-N 3.49Å; R32-A34 PolarHBondContact O-N 3.13Å; A34-V37 PolarHBondContact O-N 3.24Å; A34-I38 VanDerWaalsContact O-CB 3.28Å; A34-I38 WeakPolarHBondContact O-CB 3.21Å; A34-I38 WeakPolarHBondContact O-CD1 3.34Å; A34-I38 WeakPolarHBondContact O-CG1 3.37Å; A34-I38 PolarHBondContact O-N 2.84Å
35	T	45.5	Very low	42.6	Very low	71 Å²	71	84.8 Å²	84.8	44%	0.436	52%	0.524	S	S	.	.	H	α-helix	trans	-70	-31.2	175.1	57.2	0	0	0	0	113.1	A31 R32 I33 G39	A31-T35 WeakPolarHBondContact O-CB 3.11Å; A31-T35 VanDerWaalsContact O-CG2 3.29Å; A31-T35 WeakPolarHBondContact O-CG2 2.95Å; A31-T35 PolarHBondContact O-N 2.77Å; A31-T35 PolarHBondContact O-OG1 3.36Å; R32-T35 WeakPolarHBondContact CA-OG1 3.02Å; R32-T35 PolarHBondContact O-N 2.89Å; R32-T35 PolarHBondContact O-OG1 3.39Å; I33-T35 PolarHBondContact O-N 2.88Å; T35-G39 VanDerWaalsContact O-CA 3.28Å; T35-G39 WeakPolarHBondContact O-CA 3.36Å; T35-G39 PolarHBondContact O-N 3.33Å
36	V	44.1	Very low	42.7	Very low	103 Å²	103	86.5 Å²	86.5	62%	0.624	52%	0.516	S	S	*	.	H	α-helix	trans	-73.6	-34.1	173.2	167.9	0	0	0	0	110.9	R32 I33 G40	R32-V36 WeakPolarHBondContact O-CB 3.34Å; R32-V36 VanDerWaalsContact O-CG2 3.24Å; R32-V36 WeakPolarHBondContact O-CG2 3.01Å; R32-V36 PolarHBondContact O-N 3.44Å; I33-V36 PolarHBondContact O-N 3.45Å; V36-G40 WeakPolarHBondContact O-CA 3.29Å; V36-G40 PolarHBondContact O-N 2.86Å
37	V	44.1	Very low	42.7	Very low	85 Å²	85	84.7 Å²	84.7	52%	0.515	51%	0.505	S	S	.	.	H	α-helix	trans	-73.9	-44.7	175.2	171.7	0	0	0	0	110.6	I33 A34 G40 V41	I33-V37 HydrophobicContact CG2-CG2 4.22Å; I33-V37 WeakPolarHBondContact O-CB 3.15Å; I33-V37 WeakPolarHBondContact O-CG2 3.34Å; I33-V37 PolarHBondContact O-N 3.35Å; A34-V37 PolarHBondContact O-N 3.24Å; V37-G40 PolarHBondContact O-N 3.23Å; V37-V41 WeakPolarHBondContact O-CB 3.28Å; V37-V41 WeakPolarHBondContact O-CG2 3.34Å; V37-V41 PolarHBondContact O-N 2.75Å
38	I	47	Very low	42.6	Very low	107 Å²	107	85.9 Å²	85.9	55%	0.549	51%	0.508	S	S	.	.	H	α-helix	trans	-70.3	-43.4	177.5	-64.1	163.4	0	0	0	110.5	A34 G40 V41 A42	A34-I38 VanDerWaalsContact O-CB 3.28Å; A34-I38 WeakPolarHBondContact O-CB 3.21Å; A34-I38 WeakPolarHBondContact O-CD1 3.34Å; A34-I38 WeakPolarHBondContact O-CG1 3.37Å; A34-I38 PolarHBondContact O-N 2.84Å; I38-G40 VanDerWaalsContact C-N 3.33Å; I38-V41 PolarHBondContact O-N 3.02Å; I38-A42 WeakPolarHBondContact O-CB 3.45Å; I38-A42 PolarHBondContact O-N 2.8Å
39	G	46.8	Very low	42.6	Very low	38 Å²	38	83.9 Å²	83.9	39%	0.392	50%	0.504	S	S	.	.	H	α-helix	trans	-67.2	-33.8	174	0	0	0	0	0	112.5	T35 A42 A43	T35-G39 VanDerWaalsContact O-CA 3.28Å; T35-G39 WeakPolarHBondContact O-CA 3.36Å; T35-G39 PolarHBondContact O-N 3.33Å; G39-A42 PolarHBondContact O-N 3.36Å; G39-A43 WeakPolarHBondContact O-CB 3.28Å; G39-A43 PolarHBondContact O-N 2.79Å
40	G	40.5	Very low	42.7	Very low	29 Å²	29	84 Å²	84	30%	0.299	51%	0.513	S	S	.	.	H	α-helix	trans	-67.5	-44.5	171.6	0	0	0	0	0	111.7	V36 V37 I38 A42 A43 V44	V36-G40 WeakPolarHBondContact O-CA 3.29Å; V36-G40 PolarHBondContact O-N 2.86Å; V37-G40 PolarHBondContact O-N 3.23Å; I38-G40 VanDerWaalsContact C-N 3.33Å; G40-A42 VanDerWaalsContact C-N 3.27Å; G40-A42 PolarHBondContact O-N 3.45Å; G40-A43 PolarHBondContact O-N 2.8Å; G40-V44 WeakPolarHBondContact O-CB 3.12Å; G40-V44 WeakPolarHBondContact O-CG2 3.33Å; G40-V44 PolarHBondContact O-N 3.44Å
41	V	44.4	Very low	42.7	Very low	101 Å²	101	85.2 Å²	85.2	61%	0.612	52%	0.517	S	S	*	.	H	α-helix	trans	-70.1	-22.9	176.3	171.8	0	0	0	0	112.3	V37 I38 P45	V37-V41 WeakPolarHBondContact O-CB 3.28Å; V37-V41 WeakPolarHBondContact O-CG2 3.34Å; V37-V41 PolarHBondContact O-N 2.75Å; I38-V41 PolarHBondContact O-N 3.02Å; V41-P45 WeakPolarHBondContact O-CD 3.39Å; V41-P45 VanDerWaalsContact O-CG 3.31Å; V41-P45 WeakPolarHBondContact O-CG 3.19Å
42	A	46.1	Very low	42.9	Very low	65 Å²	65	86.4 Å²	86.4	54%	0.537	53%	0.532	S	S	.	.	H	α-helix	trans	-86.2	-28.1	171	0	0	0	0	0	113.5	I38 G39 G40 P45	I38-A42 WeakPolarHBondContact O-CB 3.45Å; I38-A42 PolarHBondContact O-N 2.8Å; G39-A42 PolarHBondContact O-N 3.36Å; G40-A42 VanDerWaalsContact C-N 3.27Å; G40-A42 PolarHBondContact O-N 3.45Å; A42-P45 WeakPolarHBondContact O-CD 3.49Å
43	A	36.9	Very low	43	Very low	46 Å²	46	85.9 Å²	85.9	38%	0.38	54%	0.535	S	S	.	.	H	α-helix	trans	-86.7	-26.4	176.6	0	0	0	0	0	113	G39 G40 M46 V47	G39-A43 WeakPolarHBondContact O-CB 3.28Å; G39-A43 PolarHBondContact O-N 2.79Å; G40-A43 PolarHBondContact O-N 2.8Å; A43-M46 PolarHBondContact O-N 2.94Å; A43-M46 VanDerWaalsContact O-N 3.17Å; A43-V47 WeakPolarHBondContact O-CB 3.4Å; A43-V47 VanDerWaalsContact O-CG2 3.31Å; A43-V47 WeakPolarHBondContact O-CG2 3.2Å; A43-V47 PolarHBondContact O-N 3.37Å
44	V	38	Very low	43	Very low	91 Å²	91	85.7 Å²	85.7	55%	0.552	54%	0.538	S	S	*	.	H	α-helix	trans	-58.7	-44.6	175.9	161.8	0	0	0	0	111.4	G40 M46 L48	G40-V44 WeakPolarHBondContact O-CB 3.12Å; G40-V44 WeakPolarHBondContact O-CG2 3.33Å; G40-V44 PolarHBondContact O-N 3.44Å; V44-M46 VanDerWaalsContact C-N 3.34Å; V44-M46 PolarHBondContact O-N 2.81Å; V44-L48 WeakPolarHBondContact O-CB 3.16Å; V44-L48 PolarHBondContact O-N 3.38Å
45	P	42.7	Very low	42.9	Very low	72 Å²	72	89.1 Å²	89.1	47%	0.468	57%	0.567	S	S	.	*	H	α-helix	trans	-64.7	-35.2	174.2	-21.2	30.9	0	0	0	113.2	V41 A42 S49	V41-P45 WeakPolarHBondContact O-CD 3.39Å; V41-P45 VanDerWaalsContact O-CG 3.31Å; V41-P45 WeakPolarHBondContact O-CG 3.19Å; A42-P45 WeakPolarHBondContact O-CD 3.49Å; P45-S49 WeakPolarHBondContact O-CB 3.47Å; P45-S49 PolarHBondContact O-N 2.73Å
46	M	44.1	Very low	42.6	Very low	144 Å²	144	89.5 Å²	89.5	71%	0.709	58%	0.577	S	S	*	*	H	α-helix	trans	-74.7	-40.4	179.5	-77.3	-75.5	-141	0	0	112.1	A43 V44 A50	A43-M46 PolarHBondContact O-N 2.94Å; A43-M46 VanDerWaalsContact O-N 3.17Å; V44-M46 VanDerWaalsContact C-N 3.34Å; V44-M46 PolarHBondContact O-N 2.81Å; M46-A50 WeakPolarHBondContact O-CB 3.4Å; M46-A50 PolarHBondContact O-N 3.44Å
47	V	42.4	Very low	42.5	Very low	93 Å²	93	86.9 Å²	86.9	56%	0.564	57%	0.571	S	S	*	*	H	α-helix	trans	-73	-33.5	175.6	176.2	0	0	0	0	110.6	A43 M51	A43-V47 WeakPolarHBondContact O-CB 3.4Å; A43-V47 VanDerWaalsContact O-CG2 3.31Å; A43-V47 WeakPolarHBondContact O-CG2 3.2Å; A43-V47 PolarHBondContact O-N 3.37Å; V47-M51 HydrophobicContact CG1-CG 4.44Å; V47-M51 WeakPolarHBondContact O-CB 3.5Å; V47-M51 WeakPolarHBondContact O-CG 2.93Å; V47-M51 PolarHBondContact O-N 3.25Å
48	L	39	Very low	42.7	Very low	90 Å²	90	90.6 Å²	90.6	47%	0.471	59%	0.586	S	S	.	*	H	α-helix	trans	-74.8	-31.7	174	-172.8	62.1	0	0	0	112.8	V44 M51 F53	V44-L48 WeakPolarHBondContact O-CB 3.16Å; V44-L48 PolarHBondContact O-N 3.38Å; L48-M51 CarbonylContact O-C 3.45Å; L48-F53 HydrophobicContact CD1-CB 4.36Å; L48-F53 HydrophobicContact CD1-CD2 4.27Å; L48-F53 HydrophobicContact CG-CB 4.24Å; L48-F53 PolarHBondContact O-N 3.04Å
49	S	42.4	Very low	42.5	Very low	77 Å²	77	89.7 Å²	89.7	54%	0.538	59%	0.594	S	S	.	*	H	α-helix	trans	-75.6	-35.7	172.6	-171.5	0	0	0	0	111.7	P45	P45-S49 WeakPolarHBondContact O-CB 3.47Å; P45-S49 PolarHBondContact O-N 2.73Å
50	A	42.9	Very low	42.1	Very low	89 Å²	89	93.2 Å²	93.2	74%	0.736	61%	0.613	S	S	*	*	H	α-helix	trans	-71	-32.1	170.2	0	0	0	0	0	112.6	M46 G52	M46-A50 WeakPolarHBondContact O-CB 3.4Å; M46-A50 PolarHBondContact O-N 3.44Å; A50-G52 PolarHBondContact O-N 2.72Å
51	M	41.9	Very low	42.5	Very low	148 Å²	148	96.5 Å²	96.5	73%	0.729	63%	0.631	S	S	*	*	T	Hydrogen-bonded Turn	trans	-87.1	33.2	173.4	-72.2	-81	-74.5	0	0	113.1	V47 L48 F53	V47-M51 HydrophobicContact CG1-CG 4.44Å; V47-M51 WeakPolarHBondContact O-CB 3.5Å; V47-M51 WeakPolarHBondContact O-CG 2.93Å; V47-M51 PolarHBondContact O-N 3.25Å; L48-M51 CarbonylContact O-C 3.45Å; M51-F53 PolarHBondContact O-N 2.59Å
52	G	45.8	Very low	42.8	Very low	55 Å²	55	95.1 Å²	95.1	57%	0.567	63%	0.626	S	S	*	*	T	Hydrogen-bonded Turn	trans	78.5	21	156.4	0	0	0	0	0	117.4	A50 T54	A50-G52 PolarHBondContact O-N 2.72Å; G52-T54 VanDerWaalsContact C-N 3.26Å; G52-T54 PolarHBondContact O-N 3.08Å
53	F	44.4	Very low	42.6	Very low	157 Å²	157	99.2 Å²	99.2	69%	0.689	64%	0.638	S	S	*	*			trans	-93.2	48	164.3	-108.4	-86.7	0	0	0	111.7	L48 M51	L48-F53 HydrophobicContact CD1-CB 4.36Å; L48-F53 HydrophobicContact CD1-CD2 4.27Å; L48-F53 HydrophobicContact CG-CB 4.24Å; L48-F53 PolarHBondContact O-N 3.04Å; M51-F53 PolarHBondContact O-N 2.59Å
54	T	41.5	Very low	42.8	Very low	95 Å²	95	101 Å²	101	58%	0.583	65%	0.652	S	S	*	*			trans	-76	140	163.1	-153.8	0	0	0	0	108.5	G52 A56 G57	G52-T54 VanDerWaalsContact C-N 3.26Å; G52-T54 PolarHBondContact O-N 3.08Å; T54-A56 HydrophobicContact CG2-CB 4.33Å; T54-A56 PolarHBondContact O-N 2.87Å; T54-G57 PolarHBondContact O-N 3.08Å; T54-G57 VanDerWaalsContact O-N 3.13Å
55	A	40.2	Very low	42.9	Very low	115 Å²	115	99.6 Å²	99.6	95%	0.95	65%	0.651	S	S	*	*	T	Hydrogen-bonded Turn	trans	-62.1	14.4	-173.4	0	0	0	0	0	115.5
56	A	40.5	Very low	42.8	Very low	79 Å²	79	104.1 Å²	104.1	65%	0.653	66%	0.663	S	S	*	*	T	Hydrogen-bonded Turn	trans	-122	5.3	178.7	0	0	0	0	0	113.9	T54	T54-A56 HydrophobicContact CG2-CB 4.33Å; T54-A56 PolarHBondContact O-N 2.87Å
57	G	40.3	Very low	42.7	Very low	48 Å²	48	105.7 Å²	105.7	50%	0.495	67%	0.671	S	S	.	*			trans	-92.5	-2.6	-175.9	0	0	0	0	0	116.6	T54 A59	T54-G57 PolarHBondContact O-N 3.08Å; T54-G57 VanDerWaalsContact O-N 3.13Å; G57-A59 PolarHBondContact O-N 3.05Å; G57-A59 VanDerWaalsContact O-N 3.15Å
58	I	48.4	Very low	42.5	Very low	164 Å²	164	107.8 Å²	107.8	84%	0.841	68%	0.676	S	S	*	*	T	Hydrogen-bonded Turn	trans	-86.3	49	169.5	-48.7	-67.3	0	0	0	109
59	A	44.1	Very low	42.5	Very low	87 Å²	87	107.3 Å²	107.3	72%	0.719	68%	0.68	S	S	*	*	T	Hydrogen-bonded Turn	trans	-165.3	36.8	174.6	0	0	0	0	0	113.7	G57	G57-A59 PolarHBondContact O-N 3.05Å; G57-A59 VanDerWaalsContact O-N 3.15Å
60	S	37.4	Very low	42.3	Very low	112 Å²	112	107.7 Å²	107.7	78%	0.783	69%	0.688	S	S	*	*			trans	-170.8	132.1	148.2	-160.4	0	0	0	0	110.9
61	S	49.5	Very low	42.1	Very low	98 Å²	98	107 Å²	107	69%	0.685	68%	0.682	S	S	*	*			trans	-42	152.1	163.4	-175.1	0	0	0	0	113.9
62	S	50.6	Low	42.3	Very low	72 Å²	72	103.4 Å²	103.4	50%	0.503	68%	0.676	S	S	.	*			trans	89.7	89.8	150.5	-138.7	0	0	0	0	116.2
63	I	42.5	Very low	42.3	Very low	151 Å²	151	107.7 Å²	107.7	77%	0.774	68%	0.684	S	S	*	*	S	Bend		-139.8	-9.7	94	-92.3	153.2	0	0	0	113.6
64	A	39.8	Very low	42.3	Very low	83 Å²	83	104.1 Å²	104.1	69%	0.686	68%	0.684	S	S	*	*	S	Bend	trans	-77.3	-27.1	173.3	0	0	0	0	0	112.9	K66 M67 M68	A64-K66 VanDerWaalsContact C-N 3.28Å; A64-K66 PolarHBondContact O-N 3.4Å; A64-M67 PolarHBondContact O-N 2.81Å; A64-M68 PolarHBondContact O-N 3.21Å
65	A	39.7	Very low	42.4	Very low	63 Å²	63	107 Å²	107	52%	0.521	70%	0.696	S	S	.	*	T	Hydrogen-bonded Turn	trans	-65.6	-24.5	179.6	0	0	0	0	0	113.9
66	K	41	Very low	42.6	Very low	167 Å²	167	105 Å²	105	73%	0.726	69%	0.686	S	S	*	*	T	Hydrogen-bonded Turn	trans	-95.4	-3.2	-179.3	-81.6	179.5	67.6	-102.4	0	115.1	A64	A64-K66 VanDerWaalsContact C-N 3.28Å; A64-K66 PolarHBondContact O-N 3.4Å
67	M	41.7	Very low	43.1	Very low	176 Å²	176	105.4 Å²	105.4	87%	0.867	70%	0.698	S	S	*	*	T	Hydrogen-bonded Turn	trans	-117.5	-2.7	172.1	-77.3	-140.3	94.8	0	0	114.6	A64	A64-M67 PolarHBondContact O-N 2.81Å
68	M	39.4	Very low	43.3	Very low	138 Å²	138	106.5 Å²	106.5	68%	0.68	71%	0.71	S	S	*	*	S	Bend	trans	-104.3	18.1	157.9	-154.8	173.2	179.9	0	0	111.7	A64 A70	A64-M68 PolarHBondContact O-N 3.21Å; M68-A70 PolarHBondContact O-N 3.43Å
69	S	37.6	Very low	43.4	Very low	80 Å²	80	106 Å²	106	56%	0.559	71%	0.714	S	S	*	*	T	Hydrogen-bonded Turn	trans	-79.2	5.9	168.2	-171.7	0	0	0	0	113.3
70	A	39.2	Very low	43.3	Very low	85 Å²	85	106 Å²	106	70%	0.702	71%	0.713	S	S	*	*	T	Hydrogen-bonded Turn	trans	-125.2	-18.1	-178.7	0	0	0	0	0	114.6	M68	M68-A70 PolarHBondContact O-N 3.43Å
71	A	38.7	Very low	43.7	Very low	74 Å²	74	107.1 Å²	107.1	61%	0.612	72%	0.721	S	S	*	*	T	Hydrogen-bonded Turn	trans	-94.1	-14.4	-179.3	0	0	0	0	0	113.6
72	A	46.7	Very low	43.7	Very low	73 Å²	73	106 Å²	106	60%	0.603	73%	0.725	S	S	*	*	S	Bend	trans	-89.2	-7.2	-176.8	0	0	0	0	0	115
73	I	44.9	Very low	43.5	Very low	144 Å²	144	105 Å²	105	74%	0.738	72%	0.718	S	S	*	*	S	Bend	trans	-104	-16	-171.9	-54.1	179.4	0	0	0	113.1
74	A	43.9	Very low	43.7	Very low	83 Å²	83	104.4 Å²	104.4	69%	0.686	72%	0.716	S	S	*	*	S	Bend	trans	-99.6	-11.3	-174.2	0	0	0	0	0	116.5
75	N	43.6	Very low	44	Very low	156 Å²	156	105.3 Å²	105.3	83%	0.834	71%	0.713	S	S	*	*	S	Bend	trans	-131.1	66.9	176.3	-82.1	-63.9	0	0	0	110.8	G77	N75-G77 PolarHBondContact O-N 3.32Å
76	G	44.4	Very low	44.2	Very low	71 Å²	71	104.9 Å²	104.9	73%	0.732	71%	0.709	S	S	*	*			trans	-44.3	132.6	-175.1	0	0	0	0	0	114.9
77	G	51.2	Low	44.6	Very low	89 Å²	89	100.8 Å²	100.8	92%	0.918	70%	0.698	S	S	*	*	S	Bend	trans	45.6	86.1	150.4	0	0	0	0	0	116.8	N75	N75-G77 PolarHBondContact O-N 3.32Å
78	G	45.1	Very low	45	Very low	71 Å²	71	97.8 Å²	97.8	73%	0.732	69%	0.685	S	S	*	*			trans	162.5	117.5	164.2	0	0	0	0	0	113	A80	G78-A80 PolarHBondContact O-N 3.29Å; G78-A80 VanDerWaalsContact O-N 3.08Å
79	V	50.2	Low	45.6	Very low	154 Å²	154	98.1 Å²	98.1	93%	0.933	69%	0.685	S	S	*	*			trans	-51.4	111.9	172.4	177.3	0	0	0	0	109.7	S81	V79-S81 PolarHBondContact O-N 3.48Å
80	A	41.7	Very low	46	Very low	85 Å²	85	97.6 Å²	97.6	70%	0.702	68%	0.682	S	S	*	*			trans	-70.6	119.8	175.4	0	0	0	0	0	110.5	G78 G82	G78-A80 PolarHBondContact O-N 3.29Å; G78-A80 VanDerWaalsContact O-N 3.08Å; A80-G82 PolarHBondContact O-N 3.07Å; A80-G82 VanDerWaalsContact O-N 3.11Å
81	S	47	Very low	46.5	Very low	136 Å²	136	98.7 Å²	98.7	95%	0.951	68%	0.675	S	S	*	*	T	Hydrogen-bonded Turn	trans	-48.4	107.3	167.5	-171.4	0	0	0	0	110.5	V79	V79-S81 PolarHBondContact O-N 3.48Å
82	G	50	Low	47.2	Very low	74 Å²	74	97 Å²	97	76%	0.763	67%	0.665	S	S	*	*	T	Hydrogen-bonded Turn	trans	155.4	-14.2	-173.7	0	0	0	0	0	115.5	A80	A80-G82 PolarHBondContact O-N 3.07Å; A80-G82 VanDerWaalsContact O-N 3.11Å
83	S	45.2	Very low	47.2	Very low	52 Å²	52	96.9 Å²	96.9	36%	0.364	66%	0.664	S	S	.	*			trans	52.1	94.3	148.3	-155.7	0	0	0	0	120.9	V85 A86 T87	S83-V85 PolarHBondContact O-N 3.36Å; S83-V85 WeakPolarHBondContact OG-CA 3.31Å; S83-V85 VanDerWaalsContact OG-CB 3.31Å; S83-V85 WeakPolarHBondContact OG-CB 3.41Å; S83-V85 PolarHBondContact OG-N 3.16Å; S83-A86 PolarHBondContact O-N 2.92Å; S83-A86 PolarHBondContact OG-N 3.09Å; S83-T87 PolarHBondContact O-N 3.31Å
84	L	46.6	Very low	47.5	Very low	139 Å²	139	94.6 Å²	94.6	73%	0.728	66%	0.657	S	S	*	*	H	α-helix	trans	-49.4	-28.5	150.1	172.8	58.4	0	0	0	112.6	L88	L84-L88 HydrophobicContact CD1-CD1 4.4Å; L84-L88 WeakPolarHBondContact O-CB 3.45Å; L84-L88 PolarHBondContact O-N 3.42Å
85	V	45.7	Very low	47.9	Very low	101 Å²	101	92.6 Å²	92.6	61%	0.612	65%	0.645	S	S	*	*	H	α-helix	trans	-74	-36.6	179	179.9	0	0	0	0	111.8	S83 L88 Q89	S83-V85 PolarHBondContact O-N 3.36Å; S83-V85 WeakPolarHBondContact OG-CA 3.31Å; S83-V85 VanDerWaalsContact OG-CB 3.31Å; S83-V85 WeakPolarHBondContact OG-CB 3.41Å; S83-V85 PolarHBondContact OG-N 3.16Å; V85-L88 PolarHBondContact O-N 3.44Å; V85-Q89 WeakPolarHBondContact O-CB 3.39Å; V85-Q89 PolarHBondContact O-N 3Å
86	A	44.9	Very low	48.3	Very low	54 Å²	54	90.5 Å²	90.5	45%	0.446	63%	0.633	S	S	.	*	H	α-helix	trans	-69.5	-33.9	176.3	0	0	0	0	0	112.2	S83 Q89 S90	S83-A86 PolarHBondContact O-N 2.92Å; S83-A86 PolarHBondContact OG-N 3.09Å; A86-Q89 PolarHBondContact O-N 3.48Å; A86-S90 WeakPolarHBondContact O-CB 3.18Å; A86-S90 PolarHBondContact O-N 2.94Å
87	T	48.9	Very low	48.6	Very low	82 Å²	82	90 Å²	90	50%	0.503	62%	0.618	S	S	.	*	H	α-helix	trans	-69.6	-41.7	172.5	-55	0	0	0	0	111	S83 Q89 S90 L91	S83-T87 PolarHBondContact O-N 3.31Å; T87-Q89 VanDerWaalsContact C-N 3.32Å; T87-Q89 PolarHBondContact O-N 2.84Å; T87-S90 PolarHBondContact O-N 3.31Å; T87-L91 HydrophobicContact CG2-CD1 4.03Å; T87-L91 HydrophobicContact CG2-CG 4.44Å; T87-L91 WeakPolarHBondContact O-CB 3.1Å; T87-L91 WeakPolarHBondContact O-CG 3.46Å; T87-L91 PolarHBondContact O-N 3.23Å
88	L	49.8	Very low	48.8	Very low	113 Å²	113	87.7 Å²	87.7	59%	0.592	60%	0.595	S	S	*	*	H	α-helix	trans	-65.2	-33.9	174.3	-122.5	67.9	0	0	0	112.8	L84 V85 G92	L84-L88 HydrophobicContact CD1-CD1 4.4Å; L84-L88 WeakPolarHBondContact O-CB 3.45Å; L84-L88 PolarHBondContact O-N 3.42Å; V85-L88 PolarHBondContact O-N 3.44Å; L88-G92 WeakPolarHBondContact O-CA 3.35Å; L88-G92 PolarHBondContact O-N 3.43Å
89	Q	52.3	Low	49.3	Very low	144 Å²	144	88.7 Å²	88.7	67%	0.673	58%	0.582	S	S	*	*	H	α-helix	trans	-74.7	-37.6	176.3	-154.2	-179.5	-8.5	0	0	111.7	V85 A86 T87 G92 A93	V85-Q89 WeakPolarHBondContact O-CB 3.39Å; V85-Q89 PolarHBondContact O-N 3Å; A86-Q89 PolarHBondContact O-N 3.48Å; T87-Q89 VanDerWaalsContact C-N 3.32Å; T87-Q89 PolarHBondContact O-N 2.84Å; Q89-G92 PolarHBondContact O-N 3.16Å; Q89-A93 PolarHBondContact O-N 3.16Å
90	S	46.3	Very low	49.4	Very low	70 Å²	70	85 Å²	85	49%	0.49	56%	0.56	S	S	.	*	H	α-helix	trans	-64.6	-44.4	173	-169.1	0	0	0	0	111.2	A86 T87 T94	A86-S90 WeakPolarHBondContact O-CB 3.18Å; A86-S90 PolarHBondContact O-N 2.94Å; T87-S90 PolarHBondContact O-N 3.31Å; S90-T94 PolarHBondContact O-N 3.33Å; S90-T94 VanDerWaalsContact O-N 3.08Å; S90-T94 PolarHBondContact O-OG1 3.37Å
91	L	49	Very low	50.1	Low	107 Å²	107	88.2 Å²	88.2	56%	0.56	56%	0.558	S	S	*	*	H	α-helix	trans	-69.2	-34.6	175.1	-67.7	172.9	0	0	0	112.5	T87 G95	T87-L91 HydrophobicContact CG2-CD1 4.03Å; T87-L91 HydrophobicContact CG2-CG 4.44Å; T87-L91 WeakPolarHBondContact O-CB 3.1Å; T87-L91 WeakPolarHBondContact O-CG 3.46Å; T87-L91 PolarHBondContact O-N 3.23Å; L91-G95 WeakPolarHBondContact O-CA 3.45Å; L91-G95 PolarHBondContact O-N 3.39Å
92	G	53.8	Low	50.8	Low	40 Å²	40	88 Å²	88	41%	0.412	54%	0.541	S	S	.	.	H	α-helix	trans	-66.7	-39.7	177.6	0	0	0	0	0	113.2	L88 Q89 L96	L88-G92 WeakPolarHBondContact O-CA 3.35Å; L88-G92 PolarHBondContact O-N 3.43Å; Q89-G92 PolarHBondContact O-N 3.16Å; G92-L96 WeakPolarHBondContact O-CB 3.43Å
93	A	47.8	Very low	51.5	Low	70 Å²	70	88.5 Å²	88.5	58%	0.579	53%	0.525	S	S	*	.	H	α-helix	trans	-85.4	-39.5	-179.1	0	0	0	0	0	113.4	Q89 S97	Q89-A93 PolarHBondContact O-N 3.16Å; A93-S97 WeakPolarHBondContact O-CB 3.35Å
94	T	50.9	Low	52.7	Low	95 Å²	95	91.7 Å²	91.7	58%	0.583	54%	0.537	S	S	*	.	H	α-helix	trans	-89.9	-34.1	-178.9	54.1	0	0	0	0	113.5	S90 G98	S90-T94 PolarHBondContact O-N 3.33Å; S90-T94 VanDerWaalsContact O-N 3.08Å; S90-T94 PolarHBondContact O-OG1 3.37Å; T94-G98 PolarHBondContact O-N 2.99Å; T94-G98 VanDerWaalsContact O-N 3.08Å
95	G	51.7	Low	53.8	Low	42 Å²	42	87 Å²	87	43%	0.433	52%	0.523	S	S	.	.	H	α-helix	trans	-70.7	-38.8	176.6	0	0	0	0	0	112.9	L91 L99	L91-G95 WeakPolarHBondContact O-CA 3.45Å; L91-G95 PolarHBondContact O-N 3.39Å; G95-L99 WeakPolarHBondContact O-CB 3.32Å; G95-L99 PolarHBondContact O-N 3.48Å
96	L	51.8	Low	55	Low	111 Å²	111	84.9 Å²	84.9	58%	0.581	51%	0.513	S	S	*	.	H	α-helix	trans	-71.1	-36.5	176.7	-168.5	65	0	0	0	111.9	G92 L99 T100	G92-L96 WeakPolarHBondContact O-CB 3.43Å; L96-L99 PolarHBondContact O-N 2.99Å; L96-T100 VanDerWaalsContact O-CB 3.31Å; L96-T100 WeakPolarHBondContact O-CB 3.34Å; L96-T100 PolarHBondContact O-N 2.92Å; L96-T100 PolarHBondContact O-OG1 3.47Å
97	S	50	Low	56.3	Low	61 Å²	61	86.6 Å²	86.6	43%	0.427	51%	0.513	S	S	.	.	H	α-helix	trans	-69.8	-37.9	177.5	-161.6	0	0	0	0	112.4	A93 T100 K101	A93-S97 WeakPolarHBondContact O-CB 3.35Å; S97-T100 PolarHBondContact O-N 3.27Å; S97-K101 WeakPolarHBondContact O-CB 3.42Å; S97-K101 WeakPolarHBondContact O-CG 3.31Å; S97-K101 PolarHBondContact O-N 3.48Å
98	G	55.5	Low	57.4	Low	41 Å²	41	84.5 Å²	84.5	42%	0.423	51%	0.508	S	S	.	.	H	α-helix	trans	-64.1	-45.1	171.2	0	0	0	0	0	112.8	T94 T100 K101 F102	T94-G98 PolarHBondContact O-N 2.99Å; T94-G98 VanDerWaalsContact O-N 3.08Å; G98-T100 PolarHBondContact O-N 3.43Å; G98-K101 PolarHBondContact O-N 2.66Å; G98-F102 WeakPolarHBondContact O-CB 3.24Å; G98-F102 PolarHBondContact O-N 2.86Å
99	L	56.2	Low	58.2	Low	91 Å²	91	82.9 Å²	82.9	48%	0.476	51%	0.506	S	S	.	.	H	α-helix	trans	-64.7	-39.3	176.2	-177.2	60.5	0	0	0	111.9	G95 L96 F102 I103	G95-L99 WeakPolarHBondContact O-CB 3.32Å; G95-L99 PolarHBondContact O-N 3.48Å; L96-L99 PolarHBondContact O-N 2.99Å; L99-F102 PolarHBondContact O-N 2.75Å; L99-I103 HydrophobicContact CD1-CD1 3.93Å; L99-I103 HydrophobicContact CD1-CG1 4.14Å; L99-I103 HydrophobicContact CD2-CD1 4.44Å; L99-I103 HydrophobicContact CG-CD1 3.77Å; L99-I103 HydrophobicContact CG-CG1 4.37Å; L99-I103 WeakPolarHBondContact O-CB 3.29Å; L99-I103 VanDerWaalsContact O-CG1 3.24Å; L99-I103 WeakPolarHBondContact O-CG1 3.1Å; L99-I103 PolarHBondContact O-N 2.81Å
100	T	52.9	Low	58.8	Low	77 Å²	77	78.8 Å²	78.8	47%	0.472	50%	0.497	S	S	.	.	H	α-helix	trans	-66.8	-43.2	178.3	-56.2	0	0	0	0	111	L96 S97 G98 F102 I103 L104	L96-T100 VanDerWaalsContact O-CB 3.31Å; L96-T100 WeakPolarHBondContact O-CB 3.34Å; L96-T100 PolarHBondContact O-N 2.92Å; L96-T100 PolarHBondContact O-OG1 3.47Å; S97-T100 PolarHBondContact O-N 3.27Å; G98-T100 PolarHBondContact O-N 3.43Å; T100-F102 VanDerWaalsContact C-N 3.31Å; T100-F102 PolarHBondContact O-N 2.82Å; T100-I103 PolarHBondContact O-N 3.5Å; T100-L104 WeakPolarHBondContact O-CB 3.24Å; T100-L104 PolarHBondContact O-N 3.45Å
101	K	57	Low	59.9	Low	152 Å²	152	79.9 Å²	79.9	66%	0.661	50%	0.496	S	S	*	.	H	α-helix	trans	-64.9	-34.9	173.7	-74	175.6	-178.1	-72.9	0	112.1	S97 G98 G105	S97-K101 WeakPolarHBondContact O-CB 3.42Å; S97-K101 WeakPolarHBondContact O-CG 3.31Å; S97-K101 PolarHBondContact O-N 3.48Å; G98-K101 PolarHBondContact O-N 2.66Å; K101-G105 WeakPolarHBondContact O-CA 3.44Å; K101-G105 PolarHBondContact O-N 3.49Å
102	F	61.6	Low	60.8	Low	132 Å²	132	77.5 Å²	77.5	58%	0.579	49%	0.492	S	S	*	.	H	α-helix	trans	-70.4	-44.5	176.2	-178.1	-98.6	0	0	0	112.5	G98 L99 T100 G105 S106	G98-F102 WeakPolarHBondContact O-CB 3.24Å; G98-F102 PolarHBondContact O-N 2.86Å; L99-F102 PolarHBondContact O-N 2.75Å; T100-F102 VanDerWaalsContact C-N 3.31Å; T100-F102 PolarHBondContact O-N 2.82Å; F102-G105 PolarHBondContact O-N 2.83Å; F102-S106 VanDerWaalsContact O-CB 3.29Å; F102-S106 WeakPolarHBondContact O-CB 3.46Å; F102-S106 PolarHBondContact O-N 2.84Å; F102-S106 PolarHBondContact O-OG 2.84Å
103	I	64.8	Low	61.2	Low	84 Å²	84	78.4 Å²	78.4	43%	0.431	50%	0.496	S	S	.	.	H	α-helix	trans	-65.6	-47.1	175.9	-69	169.8	0	0	0	109.9	L99 T100 G105 S106 I107	L99-I103 HydrophobicContact CD1-CD1 3.93Å; L99-I103 HydrophobicContact CD1-CG1 4.14Å; L99-I103 HydrophobicContact CD2-CD1 4.44Å; L99-I103 HydrophobicContact CG-CD1 3.77Å; L99-I103 HydrophobicContact CG-CG1 4.37Å; L99-I103 WeakPolarHBondContact O-CB 3.29Å; L99-I103 VanDerWaalsContact O-CG1 3.24Å; L99-I103 WeakPolarHBondContact O-CG1 3.1Å; L99-I103 PolarHBondContact O-N 2.81Å; T100-I103 PolarHBondContact O-N 3.5Å; I103-G105 VanDerWaalsContact C-N 3.34Å; I103-G105 PolarHBondContact O-N 3.47Å; I103-S106 PolarHBondContact O-N 3.41Å; I103-I107 HydrophobicContact CG2-CD1 3.64Å; I103-I107 HydrophobicContact CG2-CG1 4.44Å; I103-I107 WeakPolarHBondContact O-CB 3.44Å; I103-I107 VanDerWaalsContact O-CG1 3.28Å; I103-I107 WeakPolarHBondContact O-CG1 3.44Å; I103-I107 PolarHBondContact O-N 2.81Å
104	L	68.4	Low	62.1	Low	119 Å²	119	79 Å²	79	62%	0.623	49%	0.492	S	S	*	.	H	α-helix	trans	-65.8	-37.4	178.7	-172.3	60.6	0	0	0	111.8	T100 G108	T100-L104 WeakPolarHBondContact O-CB 3.24Å; T100-L104 PolarHBondContact O-N 3.45Å; L104-G108 PolarHBondContact O-N 3.47Å
105	G	71.3	Confident	62.9	Low	42 Å²	42	79.7 Å²	79.7	43%	0.433	49%	0.491	S	S	.	.	H	α-helix	trans	-66.9	-38.2	172.8	0	0	0	0	0	112.7	K101 F102 I103 S109	K101-G105 WeakPolarHBondContact O-CA 3.44Å; K101-G105 PolarHBondContact O-N 3.49Å; F102-G105 PolarHBondContact O-N 2.83Å; I103-G105 VanDerWaalsContact C-N 3.34Å; I103-G105 PolarHBondContact O-N 3.47Å; G105-S109 VanDerWaalsContact O-CB 3.24Å; G105-S109 WeakPolarHBondContact O-CB 3.29Å; G105-S109 PolarHBondContact O-N 2.86Å
106	S	69.6	Low	63.3	Low	56 Å²	56	81 Å²	81	39%	0.392	50%	0.497	S	S	.	.	H	α-helix	trans	-68.1	-44.8	176.5	-61.9	0	0	0	0	111.6	F102 I103 S109 A110	F102-S106 VanDerWaalsContact O-CB 3.29Å; F102-S106 WeakPolarHBondContact O-CB 3.46Å; F102-S106 PolarHBondContact O-N 2.84Å; F102-S106 PolarHBondContact O-OG 2.84Å; I103-S106 PolarHBondContact O-N 3.41Å; S106-S109 PolarHBondContact O-N 2.95Å; S106-A110 WeakPolarHBondContact O-CB 3.45Å; S106-A110 PolarHBondContact O-N 3.22Å
107	I	73.8	Confident	63	Low	90 Å²	90	84.9 Å²	84.9	46%	0.462	50%	0.504	S	S	.	.	H	α-helix	trans	-65.7	-45.1	175.6	-67.7	166.3	0	0	0	110	I103 S109 A110 I111	I103-I107 HydrophobicContact CG2-CD1 3.64Å; I103-I107 HydrophobicContact CG2-CG1 4.44Å; I103-I107 WeakPolarHBondContact O-CB 3.44Å; I103-I107 VanDerWaalsContact O-CG1 3.28Å; I103-I107 WeakPolarHBondContact O-CG1 3.44Å; I103-I107 PolarHBondContact O-N 2.81Å; I107-S109 VanDerWaalsContact C-N 3.32Å; I107-S109 PolarHBondContact O-N 2.94Å; I107-A110 PolarHBondContact O-N 3.41Å; I107-I111 HydrophobicContact CG2-CD1 3.59Å; I107-I111 HydrophobicContact CG2-CG1 4.36Å; I107-I111 VanDerWaalsContact O-CG1 3.23Å; I107-I111 WeakPolarHBondContact O-CG1 3.28Å; I107-I111 PolarHBondContact O-N 3.42Å
108	G	71.5	Confident	63	Low	37 Å²	37	89.6 Å²	89.6	38%	0.381	52%	0.517	S	S	.	.	H	α-helix	trans	-59.9	-40.4	176	0	0	0	0	0	112.6	L104 A112	L104-G108 PolarHBondContact O-N 3.47Å; G108-A112 VanDerWaalsContact O-CB 3.22Å; G108-A112 WeakPolarHBondContact O-CB 3.22Å; G108-A112 PolarHBondContact O-N 2.85Å
109	S	66.1	Low	62.4	Low	79 Å²	79	100.5 Å²	100.5	55%	0.552	55%	0.548	S	S	*	.	H	α-helix	trans	-68.4	-38	175.6	-172.6	0	0	0	0	112.5	G105 S106 I107 A113	G105-S109 VanDerWaalsContact O-CB 3.24Å; G105-S109 WeakPolarHBondContact O-CB 3.29Å; G105-S109 PolarHBondContact O-N 2.86Å; S106-S109 PolarHBondContact O-N 2.95Å; I107-S109 VanDerWaalsContact C-N 3.32Å; I107-S109 PolarHBondContact O-N 2.94Å; S109-A113 VanDerWaalsContact O-CB 3.29Å; S109-A113 WeakPolarHBondContact O-CB 3.16Å; S109-A113 PolarHBondContact O-N 3.2Å
110	A	65.7	Low	62.7	Low	58 Å²	58	101 Å²	101	48%	0.479	55%	0.551	S	S	.	*	H	α-helix	trans	-67.1	-42.3	176.9	0	0	0	0	0	111.4	S106 I107 A113 V114	S106-A110 WeakPolarHBondContact O-CB 3.45Å; S106-A110 PolarHBondContact O-N 3.22Å; I107-A110 PolarHBondContact O-N 3.41Å; A110-A113 PolarHBondContact O-N 3.4Å; A110-V114 WeakPolarHBondContact O-CG2 3.21Å; A110-V114 PolarHBondContact O-N 3.21Å
111	I	68.4	Low	63.2	Low	94 Å²	94	102.2 Å²	102.2	48%	0.482	56%	0.555	S	S	.	*	H	α-helix	trans	-66.5	-44.6	176.6	-64.2	164.8	0	0	0	110.3	I107 A113 V114 I115	I107-I111 HydrophobicContact CG2-CD1 3.59Å; I107-I111 HydrophobicContact CG2-CG1 4.36Å; I107-I111 VanDerWaalsContact O-CG1 3.23Å; I107-I111 WeakPolarHBondContact O-CG1 3.28Å; I107-I111 PolarHBondContact O-N 3.42Å; I111-A113 VanDerWaalsContact C-N 3.32Å; I111-A113 PolarHBondContact O-N 3.04Å; I111-V114 PolarHBondContact O-N 3.4Å; I111-I115 HydrophobicContact CG2-CD1 3.69Å; I111-I115 HydrophobicContact CG2-CG1 4.39Å; I111-I115 VanDerWaalsContact O-CG1 3.3Å; I111-I115 WeakPolarHBondContact O-CG1 3.35Å; I111-I115 PolarHBondContact O-N 3.15Å
112	A	67.8	Low	63.6	Low	56 Å²	56	99.4 Å²	99.4	46%	0.463	55%	0.549	S	S	.	.	H	α-helix	trans	-61.3	-39.6	176.6	0	0	0	0	0	112.2	G108 I115 A116	G108-A112 VanDerWaalsContact O-CB 3.22Å; G108-A112 WeakPolarHBondContact O-CB 3.22Å; G108-A112 PolarHBondContact O-N 2.85Å; A112-I115 PolarHBondContact O-N 2.89Å; A112-A116 WeakPolarHBondContact O-CB 3.23Å; A112-A116 PolarHBondContact O-N 2.93Å
113	A	63.3	Low	63.7	Low	60 Å²	60	97.5 Å²	97.5	50%	0.496	55%	0.548	S	S	.	.	H	α-helix	trans	-67.1	-36.7	176.2	0	0	0	0	0	112.5	S109 A110 I111 R117	S109-A113 VanDerWaalsContact O-CB 3.29Å; S109-A113 WeakPolarHBondContact O-CB 3.16Å; S109-A113 PolarHBondContact O-N 3.2Å; A110-A113 PolarHBondContact O-N 3.4Å; I111-A113 VanDerWaalsContact C-N 3.32Å; I111-A113 PolarHBondContact O-N 3.04Å; A113-R117 WeakPolarHBondContact O-CB 3.4Å; A113-R117 PolarHBondContact O-N 3.01Å; A113-R117 VanDerWaalsContact O-N 3.09Å
114	V	65.8	Low	63.6	Low	83 Å²	83	98.4 Å²	98.4	50%	0.503	56%	0.555	S	S	.	*	H	α-helix	trans	-66.6	-45.5	174	167.9	0	0	0	0	110.5	A110 I111 R117 F118	A110-V114 WeakPolarHBondContact O-CG2 3.21Å; A110-V114 PolarHBondContact O-N 3.21Å; I111-V114 PolarHBondContact O-N 3.4Å; V114-R117 PolarHBondContact O-N 2.92Å; V114-R117 VanDerWaalsContact O-N 3.15Å; V114-F118 HydrophobicContact CG1-CD2 4.28Å; V114-F118 HydrophobicContact CG1-CE2 4.38Å; V114-F118 WeakPolarHBondContact O-CD2 3.3Å; V114-F118 PolarHBondContact O-N 3.38Å
115	I	67.8	Low	63.3	Low	108 Å²	108	97 Å²	97	55%	0.554	55%	0.55	S	S	*	*	H	α-helix	trans	-64.5	-45.2	179.2	-66.3	167.1	0	0	0	110.9	I111 A112 R117 F118 Y119	I111-I115 HydrophobicContact CG2-CD1 3.69Å; I111-I115 HydrophobicContact CG2-CG1 4.39Å; I111-I115 VanDerWaalsContact O-CG1 3.3Å; I111-I115 WeakPolarHBondContact O-CG1 3.35Å; I111-I115 PolarHBondContact O-N 3.15Å; A112-I115 PolarHBondContact O-N 2.89Å; I115-R117 PolarHBondContact O-N 3.21Å; I115-F118 PolarHBondContact O-N 3.09Å; I115-Y119 PolarHBondContact O-N 3.29Å
116	A	60.3	Low	62.7	Low	69 Å²	69	100.9 Å²	100.9	57%	0.57	56%	0.559	S	S	*	*	H	α-helix	trans	-65.2	-18.5	175.9	0	0	0	0	0	113.4	A112 F118	A112-A116 WeakPolarHBondContact O-CB 3.23Å; A112-A116 PolarHBondContact O-N 2.93Å; A116-F118 VanDerWaalsContact C-N 3.33Å
117	R	45	Very low	62.2	Low	193 Å²	193	104.4 Å²	104.4	73%	0.728	57%	0.572	S	S	*	*	T	Hydrogen-bonded Turn	trans	-87.6	-4.6	175.1	179	-101.7	150.9	134.8	-7.9	112.6	A113 V114 I115	A113-R117 WeakPolarHBondContact O-CB 3.4Å; A113-R117 PolarHBondContact O-N 3.01Å; A113-R117 VanDerWaalsContact O-N 3.09Å; V114-R117 PolarHBondContact O-N 2.92Å; V114-R117 VanDerWaalsContact O-N 3.15Å; I115-R117 PolarHBondContact O-N 3.21Å
118	F	50.3	Low	61.3	Low	160 Å²	160	105.6 Å²	105.6	70%	0.702	58%	0.581	S	S	*	*			trans	-113.9	-1.3	175.3	-86.8	-78.5	0	0	0	113.7	V114 I115 A116	V114-F118 HydrophobicContact CG1-CD2 4.28Å; V114-F118 HydrophobicContact CG1-CE2 4.38Å; V114-F118 WeakPolarHBondContact O-CD2 3.3Å; V114-F118 PolarHBondContact O-N 3.38Å; I115-F118 PolarHBondContact O-N 3.09Å; A116-F118 VanDerWaalsContact C-N 3.33Å
119	Y	43.1	Very low	60.3	Low	270 Å²	270	111.8 Å²	111.8	100%	1.059	60%	0.599	S	S	*	*			trans	-111.8	0	172.5	-148.4	-84.9	0	0	0	109.3	I115	I115-Y119 PolarHBondContact O-N 3.29Å

Retrieved 119 of 119 residues in 28.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).