A0A087WZS0_HUMAN Loading...

Ly6/neurotoxin 1

AlphaFold DB , UniProt , Accession A0A087WZS0, Species HUMAN (Homo sapiens, Human), Gene LYNX1, Length 82 aa.

						>A0A087WZS0_HUMAN|A0A087WZS0|LYNX1
MTPLLTLILVVLMGLPLAQALDCHVCAYNGDNCFNPMRCPAMVAYCMTTRTYYTPTRMKVSKSCVPRCFETVYDGYSKHAST
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	62.2	Low	81.3	Confident	209 Å²	209	111.5 Å²	111.5	100%	1.03	62%	0.617	S	S	*	*				0	-50.1	0	-49.8	-173.5	-63.8	0	0	111.5	P3	M1-P3 VanDerWaalsContact C-CD 3.5Å
2	T	72.2	Confident	81.4	Confident	115 Å²	115	111.5 Å²	111.5	71%	0.706	61%	0.614	S	S	*	*	H	α-helix	trans	-59.5	-39.6	178.1	41.6	0	0	0	0	117	L4 L5 T6	T2-L4 PolarHBondContact O-N 3.21Å; T2-L5 PolarHBondContact O-N 3.42Å; T2-T6 PolarHBondContact O-N 3.37Å; T2-T6 PolarHBondContact O-OG1 3.49Å
3	P	79.5	Confident	81	Confident	83 Å²	83	116.1 Å²	116.1	54%	0.539	63%	0.632	S	S	.	*	H	α-helix	trans	-73.4	-29	-174.4	28.8	-35.9	0	0	0	113	M1 T6 L7	M1-P3 VanDerWaalsContact C-CD 3.5Å; P3-T6 VanDerWaalsContact C-OG1 3.28Å; P3-T6 VanDerWaalsContact CA-OG1 3.29Å; P3-T6 WeakPolarHBondContact CA-OG1 3.36Å; P3-T6 PolarHBondContact O-OG1 3.21Å; P3-L7 PolarHBondContact O-N 3.1Å; P3-L7 VanDerWaalsContact O-N 3.1Å
4	L	85.2	Confident	80.1	Confident	123 Å²	123	112.1 Å²	112.1	64%	0.644	63%	0.631	S	S	*	*	H	α-helix	trans	-68.8	-43.5	178	-162	86.3	0	0	0	110.3	T2 T6 L7 I8	T2-L4 PolarHBondContact O-N 3.21Å; L4-T6 VanDerWaalsContact C-N 3.35Å; L4-T6 PolarHBondContact O-N 3.47Å; L4-L7 WeakPolarHBondContact O-CB 3.46Å; L4-L7 PolarHBondContact O-N 2.78Å; L4-I8 HydrophobicContact CD2-CD1 4.36Å; L4-I8 HydrophobicContact CG-CD1 4.23Å; L4-I8 WeakPolarHBondContact O-CD1 3.29Å; L4-I8 VanDerWaalsContact O-CG1 3.25Å; L4-I8 WeakPolarHBondContact O-CG1 3.35Å; L4-I8 PolarHBondContact O-N 3.47Å
5	L	84.1	Confident	79.4	Confident	115 Å²	115	111.2 Å²	111.2	60%	0.602	62%	0.623	S	S	*	*	H	α-helix	trans	-62.7	-41.8	178.3	-155.5	98.9	0	0	0	111.5	T2 L7 I8 L9	T2-L5 PolarHBondContact O-N 3.42Å; L5-L7 VanDerWaalsContact C-N 3.33Å; L5-L7 PolarHBondContact O-N 3.27Å; L5-I8 PolarHBondContact O-N 3.32Å; L5-L9 HydrophobicContact CD2-CD1 4.25Å; L5-L9 WeakPolarHBondContact O-CD1 3.4Å; L5-L9 WeakPolarHBondContact O-CG 3.34Å; L5-L9 PolarHBondContact O-N 3.11Å; L5-L9 VanDerWaalsContact O-N 3.08Å
6	T	84	Confident	78.3	Confident	80 Å²	80	111.3 Å²	111.3	49%	0.491	63%	0.63	S	S	.	*	H	α-helix	trans	-64.8	-36.9	175.5	47.7	0	0	0	0	112.3	T2 P3 L4 L9 V10	T2-T6 PolarHBondContact O-N 3.37Å; T2-T6 PolarHBondContact O-OG1 3.49Å; P3-T6 VanDerWaalsContact C-OG1 3.28Å; P3-T6 VanDerWaalsContact CA-OG1 3.29Å; P3-T6 WeakPolarHBondContact CA-OG1 3.36Å; P3-T6 PolarHBondContact O-OG1 3.21Å; L4-T6 VanDerWaalsContact C-N 3.35Å; L4-T6 PolarHBondContact O-N 3.47Å; T6-L9 PolarHBondContact O-N 3.11Å; T6-V10 WeakPolarHBondContact O-CG2 3.39Å; T6-V10 PolarHBondContact O-N 3.43Å; T6-V10 VanDerWaalsContact O-N 3.11Å
7	L	86.7	Confident	77.2	Confident	119 Å²	119	114.6 Å²	114.6	62%	0.623	65%	0.645	S	S	*	*	H	α-helix	trans	-63.9	-44.6	176.1	-127.2	99.9	0	0	0	111.3	P3 L4 L5 L9 V10 V11	P3-L7 PolarHBondContact O-N 3.1Å; P3-L7 VanDerWaalsContact O-N 3.1Å; L4-L7 WeakPolarHBondContact O-CB 3.46Å; L4-L7 PolarHBondContact O-N 2.78Å; L5-L7 VanDerWaalsContact C-N 3.33Å; L5-L7 PolarHBondContact O-N 3.27Å; L7-L9 VanDerWaalsContact C-N 3.34Å; L7-L9 PolarHBondContact O-N 3.47Å; L7-V10 PolarHBondContact O-N 3.44Å; L7-V11 WeakPolarHBondContact O-CG2 3.19Å; L7-V11 PolarHBondContact O-N 3.17Å
8	I	85.9	Confident	76.3	Confident	86 Å²	86	112.3 Å²	112.3	44%	0.441	64%	0.643	S	S	.	*	H	α-helix	trans	-62.9	-43	-179.3	-65.6	159.9	0	0	0	110.5	L4 L5 V11 L12	L4-I8 HydrophobicContact CD2-CD1 4.36Å; L4-I8 HydrophobicContact CG-CD1 4.23Å; L4-I8 WeakPolarHBondContact O-CD1 3.29Å; L4-I8 VanDerWaalsContact O-CG1 3.25Å; L4-I8 WeakPolarHBondContact O-CG1 3.35Å; L4-I8 PolarHBondContact O-N 3.47Å; L5-I8 PolarHBondContact O-N 3.32Å; I8-V11 PolarHBondContact O-N 3.48Å; I8-L12 HydrophobicContact CG2-CD1 3.73Å; I8-L12 WeakPolarHBondContact O-CD1 3.37Å; I8-L12 PolarHBondContact O-N 3.12Å
9	L	86.4	Confident	75.9	Confident	102 Å²	102	116.5 Å²	116.5	53%	0.534	66%	0.656	S	S	.	*	H	α-helix	trans	-62.9	-42.8	177.6	-73.6	161.2	0	0	0	112.1	L5 T6 L7 V11 L12 M13	L5-L9 HydrophobicContact CD2-CD1 4.25Å; L5-L9 WeakPolarHBondContact O-CD1 3.4Å; L5-L9 WeakPolarHBondContact O-CG 3.34Å; L5-L9 PolarHBondContact O-N 3.11Å; L5-L9 VanDerWaalsContact O-N 3.08Å; T6-L9 PolarHBondContact O-N 3.11Å; L7-L9 VanDerWaalsContact C-N 3.34Å; L7-L9 PolarHBondContact O-N 3.47Å; L9-V11 VanDerWaalsContact C-N 3.34Å; L9-V11 PolarHBondContact O-N 3.23Å; L9-L12 PolarHBondContact O-N 3.36Å; L9-M13 WeakPolarHBondContact O-CG 3.45Å; L9-M13 PolarHBondContact O-N 3.08Å; L9-M13 VanDerWaalsContact O-N 3.11Å
10	V	84.4	Confident	75.8	Confident	108 Å²	108	113.2 Å²	113.2	66%	0.655	64%	0.644	S	S	*	*	H	α-helix	trans	-63.1	-41.3	176.8	171.2	0	0	0	0	111.3	T6 L7 M13 G14	T6-V10 WeakPolarHBondContact O-CG2 3.39Å; T6-V10 PolarHBondContact O-N 3.43Å; T6-V10 VanDerWaalsContact O-N 3.11Å; L7-V10 PolarHBondContact O-N 3.44Å; V10-M13 PolarHBondContact O-N 3.01Å; V10-G14 PolarHBondContact O-N 3.46Å
11	V	84.2	Confident	76.5	Confident	86 Å²	86	110.5 Å²	110.5	52%	0.521	63%	0.627	S	S	.	*	H	α-helix	trans	-62.9	-47.5	177	171.3	0	0	0	0	110.9	L7 I8 L9 M13 G14 L15	L7-V11 WeakPolarHBondContact O-CG2 3.19Å; L7-V11 PolarHBondContact O-N 3.17Å; I8-V11 PolarHBondContact O-N 3.48Å; L9-V11 VanDerWaalsContact C-N 3.34Å; L9-V11 PolarHBondContact O-N 3.23Å; V11-M13 VanDerWaalsContact C-N 3.31Å; V11-M13 PolarHBondContact O-N 3.34Å; V11-G14 PolarHBondContact O-N 2.99Å; V11-G14 VanDerWaalsContact O-N 3.12Å; V11-L15 HydrophobicContact CG1-CD1 3.97Å; V11-L15 WeakPolarHBondContact O-CD1 3.25Å; V11-L15 PolarHBondContact O-N 3.04Å
12	L	81.9	Confident	78.1	Confident	112 Å²	112	104.9 Å²	104.9	59%	0.586	60%	0.601	S	S	*	*	H	α-helix	trans	-59.1	-38	178.1	-98.7	103.1	0	0	0	113.5	I8 L9 G14 L15	I8-L12 HydrophobicContact CG2-CD1 3.73Å; I8-L12 WeakPolarHBondContact O-CD1 3.37Å; I8-L12 PolarHBondContact O-N 3.12Å; L9-L12 PolarHBondContact O-N 3.36Å; L12-G14 VanDerWaalsContact C-N 3.28Å; L12-G14 PolarHBondContact O-N 3.32Å; L12-L15 PolarHBondContact O-N 3.47Å
13	M	76.8	Confident	79.2	Confident	171 Å²	171	99.6 Å²	99.6	84%	0.842	57%	0.569	S	S	*	*	H	α-helix	trans	-75	-20.3	179.8	-61.8	-68.4	-80.7	0	0	112.8	L9 V10 V11	L9-M13 WeakPolarHBondContact O-CG 3.45Å; L9-M13 PolarHBondContact O-N 3.08Å; L9-M13 VanDerWaalsContact O-N 3.11Å; V10-M13 PolarHBondContact O-N 3.01Å; V11-M13 VanDerWaalsContact C-N 3.31Å; V11-M13 PolarHBondContact O-N 3.34Å
14	G	68.4	Low	80.1	Confident	60 Å²	60	99.1 Å²	99.1	62%	0.619	56%	0.559	S	S	*	*	H	α-helix	trans	-93.4	-6.6	176.2	0	0	0	0	0	114.4	V10 V11 L12 P16	V10-G14 PolarHBondContact O-N 3.46Å; V11-G14 PolarHBondContact O-N 2.99Å; V11-G14 VanDerWaalsContact O-N 3.12Å; L12-G14 VanDerWaalsContact C-N 3.28Å; L12-G14 PolarHBondContact O-N 3.32Å; G14-P16 VanDerWaalsContact O-CD 3.23Å; G14-P16 WeakPolarHBondContact O-CD 3.23Å
15	L	69.3	Low	80.6	Confident	99 Å²	99	95.3 Å²	95.3	52%	0.518	54%	0.541	S	S	.	.	S	Bend	trans	-72.1	113.6	179.6	-94.9	136.4	0	0	0	109.6	V11 L12 L17	V11-L15 HydrophobicContact CG1-CD1 3.97Å; V11-L15 WeakPolarHBondContact O-CD1 3.25Å; V11-L15 PolarHBondContact O-N 3.04Å; L12-L15 PolarHBondContact O-N 3.47Å; L15-L17 PolarHBondContact O-N 3.05Å
16	P	61.2	Low	81.3	Confident	112 Å²	112	91 Å²	91	73%	0.727	52%	0.521	S	S	*	.			trans	-65.9	111	175.7	26.8	-31.5	0	0	0	108.6	G14 A18	G14-P16 VanDerWaalsContact O-CD 3.23Å; G14-P16 WeakPolarHBondContact O-CD 3.23Å; P16-A18 PolarHBondContact O-N 2.98Å; P16-A18 VanDerWaalsContact O-N 3.11Å
17	L	60.3	Low	81.9	Confident	168 Å²	168	90.3 Å²	90.3	88%	0.88	52%	0.523	S	S	*	.			trans	-69.1	-1	175.6	-114.9	83.6	0	0	0	113.5	L15 Q19	L15-L17 PolarHBondContact O-N 3.05Å; L17-Q19 PolarHBondContact O-N 3.39Å; L17-Q19 VanDerWaalsContact O-N 3.09Å
18	A	61.7	Low	82.4	Confident	74 Å²	74	91.2 Å²	91.2	61%	0.612	52%	0.519	S	S	*	.			trans	-80.6	93	-177.3	0	0	0	0	0	110	P16 A20	P16-A18 PolarHBondContact O-N 2.98Å; P16-A18 VanDerWaalsContact O-N 3.11Å; A18-A20 PolarHBondContact O-N 3.49Å
19	Q	67.8	Low	82.8	Confident	192 Å²	192	92.8 Å²	92.8	90%	0.897	53%	0.529	S	S	*	.			trans	-64	103.2	161.6	-61.2	-163.1	12.2	0	0	107.6	L17 L21	L17-Q19 PolarHBondContact O-N 3.39Å; L17-Q19 VanDerWaalsContact O-N 3.09Å; Q19-L21 PolarHBondContact O-N 3.09Å
20	A	73.6	Confident	83	Confident	49 Å²	49	88.5 Å²	88.5	41%	0.405	51%	0.509	S	S	.	.			trans	-79.9	108.4	-177.2	0	0	0	0	0	107.8	A18 R38	A18-A20 PolarHBondContact O-N 3.49Å; A20-R38 HydrophobicContact CB-CG 4.46Å; A20-R38 PolarHBondContact O-NH1 3.01Å
21	L	91.5	Very high	83.3	Confident	57 Å²	57	88.6 Å²	88.6	30%	0.298	51%	0.506	S	S	.	.			trans	-77.5	127.4	-176.8	-171.2	72	0	0	0	110.2	Q19 C39 V43 A44	Q19-L21 PolarHBondContact O-N 3.09Å; L21-C39 HydrophobicContact CB-CB 4.36Å; L21-C39 WeakPolarHBondContact O-CB 3.31Å; L21-C39 PolarHBondContact O-N 3.25Å; L21-V43 HydrophobicContact CD2-CG1 4.04Å; L21-A44 VanDerWaalsContact CD2-C 3.41Å
22	D	95.1	Very high	83.8	Confident	91 Å²	91	87.6 Å²	87.6	49%	0.487	50%	0.498	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.6	121.7	174.7	-75.5	-66.1	0	0	0	109.9	R38	D22-R38 WeakPolarHBondContact OD1-CA 3.21Å; D22-R38 VanDerWaalsContact OD1-CD 3.31Å; D22-R38 WeakPolarHBondContact OD1-CD 3.09Å; D22-R38 IonicContact OD1-NE 3.85Å; D22-R38 IonicContact OD1-NH1 3.97Å; D22-R38 IonicContact OD2-CZ 3.63Å; D22-R38 IonicContact OD2-NE 3.97Å; D22-R38 IonicContact OD2-NH1 2.78Å; D22-R38 PolarHBondContact OD2-NH1 2.98Å
23	C	96.1	Very high	84.5	Confident	5 Å²	5	82.9 Å²	82.9	3%	0.034	47%	0.474	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.1	163.8	179.4	-62.5	0	0	0	0	110.6	P36 M37 C39 C46	C23-P36 CarbonylContact O-C 3.59Å; C23-P36 WeakPolarHBondContact O-CA 3.11Å; C23-M37 PolarHBondContact N-O 3.11Å; C23-M37 PolarHBondContact O-N 2.78Å; C23-M37 VanDerWaalsContact O-O 3.07Å; C23-C39 VanDerWaalsContact CB-SG 3.58Å; C23-C39 PolarHBondContact SG-SG 2.97Å; C23-C46 HydrophobicContact CB-CB 3.81Å; C23-C46 WeakPolarHBondContact CB-SG 3.34Å; C23-C46 WeakPolarHBondContact SG-CA 3.45Å; C23-C46 WeakPolarHBondContact SG-CB 3.46Å; C23-C46 CovalentContact SG-SG 2.03Å; C23-C46 PolarHBondContact SG-SG 2.85Å
24	H	97.3	Very high	85.4	Confident	72 Å²	72	82.1 Å²	82.1	33%	0.333	47%	0.466	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-83.2	130.7	163.3	-64	-68.9	0	0	0	110	N35 K62	H24-N35 CarbonylContact C-O 3.6Å; H24-N35 VanDerWaalsContact CA-O 3.27Å; H24-N35 WeakPolarHBondContact CA-O 3.41Å; H24-N35 PolarHBondContact ND1-N 3.46Å; H24-K62 HydrophobicContact CB-CB 4.31Å; H24-K62 HydrophobicContact CB-CD 3.56Å; H24-K62 CarbonylContact O-C 3.57Å; H24-K62 WeakPolarHBondContact O-CB 3.41Å
25	V	97	Very high	86.8	Confident	43 Å²	43	82.6 Å²	82.6	26%	0.261	46%	0.455	S	S	.	.			trans	-125.2	98.5	177.9	179.3	0	0	0	0	109.4	N35 M37 K62 C64	V25-N35 PolarHBondContact N-O 3.48Å; V25-N35 WeakPolarHBondContact O-CB 3.37Å; V25-N35 PolarHBondContact O-ND2 3.22Å; V25-M37 HydrophobicContact CB-CB 4.49Å; V25-M37 HydrophobicContact CB-CE 3.41Å; V25-M37 VanDerWaalsContact CB-CE 3.41Å; V25-M37 HydrophobicContact CG1-CE 3.65Å; V25-M37 HydrophobicContact CG2-CB 4.34Å; V25-M37 HydrophobicContact CG2-CE 4.46Å; V25-M37 WeakPolarHBondContact O-CE 3.1Å; V25-K62 WeakPolarHBondContact CA-O 3.33Å; V25-C64 VanDerWaalsContact CG2-SG 3.53Å
26	C	97.6	Very high	88.1	Confident	26 Å²	26	82.4 Å²	82.4	18%	0.176	46%	0.459	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-162.4	164.1	-173	54.2	0	0	0	0	111.9	C33 N35 S61 K62	C26-C33 HydrophobicContact CB-CB 3.85Å; C26-C33 WeakPolarHBondContact CB-SG 3.4Å; C26-C33 WeakPolarHBondContact SG-CB 3.39Å; C26-C33 PolarHBondContact SG-O 3.27Å; C26-C33 VanDerWaalsContact SG-O 3.39Å; C26-C33 CovalentContact SG-SG 2.04Å; C26-C33 PolarHBondContact SG-SG 2.82Å; C26-N35 HydrophobicContact CB-CB 3.85Å; C26-S61 CarbonylContact O-C 3.55Å; C26-S61 WeakPolarHBondContact O-CA 3.39Å; C26-K62 PolarHBondContact N-O 2.85Å; C26-K62 VanDerWaalsContact N-O 3.1Å; C26-K62 PolarHBondContact O-N 2.89Å
27	A	96.6	Very high	89.7	Confident	65 Å²	65	80.8 Å²	80.8	54%	0.537	44%	0.443	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-136.8	137.2	168.7	0	0	0	0	0	109.8	V60	A27-V60 WeakPolarHBondContact CA-O 3.33Å
28	Y	96.8	Very high	91.3	Very high	137 Å²	137	80.4 Å²	80.4	54%	0.537	43%	0.429	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-150.3	145.3	-179	-176.7	-114.4	0	0	0	111.8	G30 N32 K59 V60	Y28-G30 PolarHBondContact O-N 2.99Å; Y28-N32 WeakPolarHBondContact CD1-O 3.13Å; Y28-K59 CarbonylContact O-C 3.4Å; Y28-K59 WeakPolarHBondContact O-CA 3.48Å; Y28-K59 WeakPolarHBondContact O-CG 3.27Å; Y28-V60 PolarHBondContact N-O 2.98Å; Y28-V60 PolarHBondContact O-N 2.78Å
29	N	95.1	Very high	92.9	Very high	120 Å²	120	77.3 Å²	77.3	64%	0.642	40%	0.404	S	S	*	.	S	Bend	trans	-86.7	80.4	173.7	-65.5	-28.5	0	0	0	109.1	M58	N29-M58 CarbonylContact C-O 3.59Å
30	G	91.7	Very high	94	Very high	12 Å²	12	71.8 Å²	71.8	12%	0.124	38%	0.384	C	S	.	.	S	Bend	trans	174.8	-165.7	178.4	0	0	0	0	0	110.9	Y28 N32 M58	Y28-G30 PolarHBondContact O-N 2.99Å; G30-N32 PolarHBondContact O-N 2.04Å; G30-M58 PolarHBondContact N-O 2.85Å
31	D	90.4	Very high	94.7	Very high	109 Å²	109	74.4 Å²	74.4	58%	0.583	41%	0.406	S	S	*	.	S	Bend	trans	-62.8	-43.8	-174.5	-58.6	-96.3	0	0	0	113.6	M58	D31-M58 HydrophobicContact CB-CE 3.84Å; D31-M58 WeakPolarHBondContact OD1-CE 3.45Å
32	N	93.5	Very high	94.4	Very high	66 Å²	66	79 Å²	79	35%	0.353	43%	0.428	S	S	.	.			trans	-154.6	163.2	-172.1	-151.9	7.8	0	0	0	112.5	Y28 G30 F34 K62	Y28-N32 WeakPolarHBondContact CD1-O 3.13Å; G30-N32 PolarHBondContact O-N 2.04Å; N32-F34 HydrophobicContact CB-CE2 4.3Å; N32-F34 HydrophobicContact CB-CZ 4.45Å; N32-F34 WeakPolarHBondContact ND2-CZ 3.47Å; N32-K62 WeakPolarHBondContact OD1-CE 3.32Å; N32-K62 PolarHBondContact OD1-NZ 3.19Å
33	C	96.2	Very high	94.2	Very high	13 Å²	13	75.3 Å²	75.3	9%	0.088	41%	0.409	C	S	.	.			trans	-142.1	151	171.7	67.8	0	0	0	0	110.1	C26 V60 K62	C26-C33 HydrophobicContact CB-CB 3.85Å; C26-C33 WeakPolarHBondContact CB-SG 3.4Å; C26-C33 WeakPolarHBondContact SG-CB 3.39Å; C26-C33 PolarHBondContact SG-O 3.27Å; C26-C33 VanDerWaalsContact SG-O 3.39Å; C26-C33 CovalentContact SG-SG 2.04Å; C26-C33 PolarHBondContact SG-SG 2.82Å; C33-V60 HydrophobicContact CB-CG1 4.08Å; C33-K62 WeakPolarHBondContact O-CE 2.82Å
34	F	97.3	Very high	94	Very high	155 Å²	155	77.9 Å²	77.9	68%	0.68	43%	0.43	S	S	*	.			trans	-130.3	114.5	-176.5	-59.4	-86.5	0	0	0	109.8	N32	N32-F34 HydrophobicContact CB-CE2 4.3Å; N32-F34 HydrophobicContact CB-CZ 4.45Å; N32-F34 WeakPolarHBondContact ND2-CZ 3.47Å
35	N	97.4	Very high	93.8	Very high	70 Å²	70	80.6 Å²	80.6	37%	0.374	44%	0.438	S	S	.	.			trans	-153.3	82	172.9	-172.8	25.8	0	0	0	109.3	H24 V25 C26 M37	H24-N35 CarbonylContact C-O 3.6Å; H24-N35 VanDerWaalsContact CA-O 3.27Å; H24-N35 WeakPolarHBondContact CA-O 3.41Å; H24-N35 PolarHBondContact ND1-N 3.46Å; V25-N35 PolarHBondContact N-O 3.48Å; V25-N35 WeakPolarHBondContact O-CB 3.37Å; V25-N35 PolarHBondContact O-ND2 3.22Å; C26-N35 HydrophobicContact CB-CB 3.85Å; N35-M37 WeakPolarHBondContact ND2-CE 3.41Å; N35-M37 PolarHBondContact O-N 3.2Å
36	P	96.2	Very high	93.7	Very high	94 Å²	94	81.5 Å²	81.5	61%	0.61	45%	0.446	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-64.6	129.4	-176.8	27.9	-32.9	0	0	0	110.4	C23	C23-P36 CarbonylContact O-C 3.59Å; C23-P36 WeakPolarHBondContact O-CA 3.11Å
37	M	94.8	Very high	93.5	Very high	78 Å²	78	82.6 Å²	82.6	38%	0.384	45%	0.449	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-143.8	146.5	179.9	-69	-155.4	-103	0	0	110.5	C23 V25 N35	C23-M37 PolarHBondContact N-O 3.11Å; C23-M37 PolarHBondContact O-N 2.78Å; C23-M37 VanDerWaalsContact O-O 3.07Å; V25-M37 HydrophobicContact CB-CB 4.49Å; V25-M37 HydrophobicContact CB-CE 3.41Å; V25-M37 VanDerWaalsContact CB-CE 3.41Å; V25-M37 HydrophobicContact CG1-CE 3.65Å; V25-M37 HydrophobicContact CG2-CB 4.34Å; V25-M37 HydrophobicContact CG2-CE 4.46Å; V25-M37 WeakPolarHBondContact O-CE 3.1Å; N35-M37 WeakPolarHBondContact ND2-CE 3.41Å; N35-M37 PolarHBondContact O-N 3.2Å
38	R	94.9	Very high	93.4	Very high	160 Å²	160	83.1 Å²	83.1	60%	0.604	45%	0.446	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-73.1	124.8	171.5	-166.8	80.8	90.3	169.4	7.3	109.8	A20 D22	A20-R38 HydrophobicContact CB-CG 4.46Å; A20-R38 PolarHBondContact O-NH1 3.01Å; D22-R38 WeakPolarHBondContact OD1-CA 3.21Å; D22-R38 VanDerWaalsContact OD1-CD 3.31Å; D22-R38 WeakPolarHBondContact OD1-CD 3.09Å; D22-R38 IonicContact OD1-NE 3.85Å; D22-R38 IonicContact OD1-NH1 3.97Å; D22-R38 IonicContact OD2-CZ 3.63Å; D22-R38 IonicContact OD2-NE 3.97Å; D22-R38 IonicContact OD2-NH1 2.78Å; D22-R38 PolarHBondContact OD2-NH1 2.98Å
39	C	93.5	Very high	93.1	Very high	10 Å²	10	78.9 Å²	78.9	7%	0.068	43%	0.434	C	S	.	.	P	Polyproline II helix	trans	-77.4	153.8	174.9	-62.7	0	0	0	0	112	L21 C23 V43 C64	L21-C39 HydrophobicContact CB-CB 4.36Å; L21-C39 WeakPolarHBondContact O-CB 3.31Å; L21-C39 PolarHBondContact O-N 3.25Å; C23-C39 VanDerWaalsContact CB-SG 3.58Å; C23-C39 PolarHBondContact SG-SG 2.97Å; C39-V43 HydrophobicContact CB-CB 3.96Å; C39-V43 HydrophobicContact CB-CG1 3.84Å; C39-C64 VanDerWaalsContact CA-SG 3.57Å; C39-C64 HydrophobicContact CB-CB 3.79Å; C39-C64 WeakPolarHBondContact CB-SG 3.06Å; C39-C64 WeakPolarHBondContact SG-CB 3.11Å; C39-C64 CovalentContact SG-SG 2.04Å; C39-C64 PolarHBondContact SG-SG 2.04Å
40	P	91.7	Very high	92.9	Very high	75 Å²	75	79.1 Å²	79.1	49%	0.487	43%	0.426	S	S	.	.	P	Polyproline II helix	trans	-59.6	152.2	170.7	-20.7	32	0	0	0	112	M42 V43	P40-M42 HydrophobicContact CB-CG 4.31Å; P40-M42 PolarHBondContact O-N 2.98Å; P40-V43 WeakPolarHBondContact O-CB 3.42Å; P40-V43 PolarHBondContact O-N 2.97Å
41	A	87.9	Confident	92.8	Very high	105 Å²	105	81.2 Å²	81.2	87%	0.868	44%	0.437	S	S	*	.	T	Hydrogen-bonded Turn	trans	-59.2	-21	-176.5	0	0	0	0	0	115	V43	A41-V43 VanDerWaalsContact C-N 3.28Å; A41-V43 PolarHBondContact O-N 3.39Å
42	M	85.4	Confident	92.7	Very high	153 Å²	153	82.5 Å²	82.5	75%	0.754	43%	0.434	S	S	*	.	T	Hydrogen-bonded Turn	trans	-80.1	-5.6	177.6	70.7	-174.6	-166.3	0	0	114.1	P40	P40-M42 HydrophobicContact CB-CG 4.31Å; P40-M42 PolarHBondContact O-N 2.98Å
43	V	91.9	Very high	92.3	Very high	14 Å²	14	86.3 Å²	86.3	9%	0.085	45%	0.445	C	S	.	.			trans	-98.5	133.3	-178.2	168.6	0	0	0	0	109.7	L21 C39 P40 A41 Y45 C64 V65	L21-V43 HydrophobicContact CD2-CG1 4.04Å; C39-V43 HydrophobicContact CB-CB 3.96Å; C39-V43 HydrophobicContact CB-CG1 3.84Å; P40-V43 WeakPolarHBondContact O-CB 3.42Å; P40-V43 PolarHBondContact O-N 2.97Å; A41-V43 VanDerWaalsContact C-N 3.28Å; A41-V43 PolarHBondContact O-N 3.39Å; V43-Y45 WeakPolarHBondContact CG1-O 3.31Å; V43-C64 HydrophobicContact CB-CB 4.4Å; V43-C64 HydrophobicContact CG1-CB 3.77Å; V43-C64 HydrophobicContact CG2-CB 4.05Å; V43-V65 WeakPolarHBondContact CG1-O 3.28Å
44	A	91.4	Very high	92	Very high	59 Å²	59	88.6 Å²	88.6	49%	0.488	46%	0.458	S	S	.	.			trans	-116.1	-7.5	176.9	0	0	0	0	0	113.7	L21	L21-A44 VanDerWaalsContact CD2-C 3.41Å
45	Y	92.8	Very high	91.6	Very high	128 Å²	128	87.7 Å²	87.7	50%	0.502	47%	0.468	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-138.5	148.1	-173.8	-56.5	-81.6	0	0	0	113.7	V43 V65 P66 C68	V43-Y45 WeakPolarHBondContact CG1-O 3.31Å; Y45-V65 PolarHBondContact N-O 3.08Å; Y45-V65 PolarHBondContact O-N 3.39Å; Y45-P66 WeakPolarHBondContact CD2-O 3.13Å; Y45-C68 HydrophobicContact CG-CB 4.33Å
46	C	94.6	Very high	91.2	Very high	62 Å²	62	90.5 Å²	90.5	42%	0.419	49%	0.488	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-94.3	124.5	165.8	-49.2	0	0	0	0	109.4	C23	C23-C46 HydrophobicContact CB-CB 3.81Å; C23-C46 WeakPolarHBondContact CB-SG 3.34Å; C23-C46 WeakPolarHBondContact SG-CA 3.45Å; C23-C46 WeakPolarHBondContact SG-CB 3.46Å; C23-C46 CovalentContact SG-SG 2.03Å; C23-C46 PolarHBondContact SG-SG 2.85Å
47	M	93.9	Very high	90.9	Very high	49 Å²	49	94.8 Å²	94.8	24%	0.241	49%	0.492	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.7	131.8	173.5	-172.3	178.2	-172.5	0	0	109.8	K62 S63 V65	M47-K62 CarbonylContact O-C 3.57Å; M47-K62 VanDerWaalsContact O-CA 3.25Å; M47-K62 WeakPolarHBondContact O-CA 3.45Å; M47-S63 PolarHBondContact N-O 2.93Å; M47-S63 PolarHBondContact O-N 3.41Å; M47-V65 HydrophobicContact CB-CG1 4.01Å; M47-V65 HydrophobicContact CB-CG2 3.73Å; M47-V65 HydrophobicContact SD-CG1 4.13Å
48	T	93.7	Very high	90.7	Very high	76 Å²	76	92.5 Å²	92.5	47%	0.466	48%	0.48	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.2	116.4	168.6	-66.3	0	0	0	0	108.9	R50 V60 S61 K62	T48-R50 HydrophobicContact CG2-CG 4.44Å; T48-V60 HydrophobicContact CG2-CG2 4.01Å; T48-S61 CarbonylContact C-O 3.46Å; T48-S61 WeakPolarHBondContact CA-O 3.03Å; T48-K62 HydrophobicContact CG2-CG 4.14Å
49	T	91.8	Very high	90.6	Very high	49 Å²	49	88.4 Å²	88.4	30%	0.301	47%	0.467	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.2	125.5	174.1	-53.6	0	0	0	0	109.2	V60 S61	T49-V60 CarbonylContact O-C 3.56Å; T49-V60 WeakPolarHBondContact O-CA 3.25Å; T49-S61 PolarHBondContact N-O 3.1Å; T49-S61 PolarHBondContact O-N 2.81Å
50	R	90.3	Very high	90.6	Very high	125 Å²	125	88 Å²	88	47%	0.472	46%	0.464	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.5	119.4	170.5	-67.2	178.5	77.7	-178.6	5.3	108.8	T48 Y52 M58 V60	T48-R50 HydrophobicContact CG2-CG 4.44Å; R50-Y52 HydrophobicContact CB-CE2 4.04Å; R50-Y52 PolarHBondContact NE-OH 2.9Å; R50-Y52 PolarHBondContact NH1-OH 3.42Å; R50-Y52 PolarHBondContact NH2-OH 2.79Å; R50-Y52 VanDerWaalsContact NH2-OH 3.12Å; R50-M58 PolarHBondContact NH2-SD 2.03Å; R50-V60 HydrophobicContact CG-CG2 4.25Å
51	T	88.6	Confident	90.8	Very high	56 Å²	56	86.7 Å²	86.7	34%	0.344	46%	0.457	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.4	116.4	177.1	-51.5	0	0	0	0	108.9	Y53 M58 K59	T51-Y53 HydrophobicContact CG2-CD2 4.48Å; T51-Y53 HydrophobicContact CG2-CE1 4.05Å; T51-Y53 HydrophobicContact CG2-CE2 4.02Å; T51-M58 CarbonylContact O-C 3.42Å; T51-M58 WeakPolarHBondContact O-CA 3.08Å; T51-M58 VanDerWaalsContact O-CB 3.28Å; T51-M58 WeakPolarHBondContact O-CB 3.06Å; T51-K59 PolarHBondContact N-O 2.99Å; T51-K59 PolarHBondContact O-N 2.96Å
52	Y	89.1	Confident	91.2	Very high	135 Å²	135	82.8 Å²	82.8	53%	0.529	42%	0.42	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-94.1	114.8	173.6	-63.9	-93	0	0	0	108.9	R50 M58	R50-Y52 HydrophobicContact CB-CE2 4.04Å; R50-Y52 PolarHBondContact NE-OH 2.9Å; R50-Y52 PolarHBondContact NH1-OH 3.42Å; R50-Y52 PolarHBondContact NH2-OH 2.79Å; R50-Y52 VanDerWaalsContact NH2-OH 3.12Å; Y52-M58 HydrophobicContact CD1-CB 3.89Å; Y52-M58 HydrophobicContact CD1-SD 4.22Å; Y52-M58 HydrophobicContact CE1-CB 4.26Å; Y52-M58 HydrophobicContact CE1-CE 4.49Å; Y52-M58 HydrophobicContact CE1-SD 3.64Å; Y52-M58 HydrophobicContact CG-CB 4.37Å
53	Y	85.8	Confident	91.7	Very high	147 Å²	147	77.3 Å²	77.3	58%	0.576	40%	0.397	S	S	*	.	S	Bend	trans	-88.5	-40.7	174.9	-64.1	-80.1	0	0	0	110.9	T51 R57 K59	T51-Y53 HydrophobicContact CG2-CD2 4.48Å; T51-Y53 HydrophobicContact CG2-CE1 4.05Å; T51-Y53 HydrophobicContact CG2-CE2 4.02Å; Y53-R57 PolarHBondContact N-O 2.94Å; Y53-K59 HydrophobicContact CE2-CB 3.75Å
54	T	90.3	Very high	91.9	Very high	60 Å²	60	78.1 Å²	78.1	37%	0.368	40%	0.403	S	S	.	.	S	Bend	trans	-139.5	171.1	171.7	72.5	0	0	0	0	108.4	T56 R57	T54-T56 PolarHBondContact O-N 2.89Å; T54-T56 PolarHBondContact OG1-N 2.99Å; T54-T56 PolarHBondContact OG1-OG1 2.8Å; T54-R57 PolarHBondContact N-O 3.32Å; T54-R57 VanDerWaalsContact N-O 3.08Å; T54-R57 PolarHBondContact O-N 2.64Å; T54-R57 VanDerWaalsContact O-O 3.08Å; T54-R57 WeakPolarHBondContact OG1-CB 3.07Å; T54-R57 PolarHBondContact OG1-N 3.27Å
55	P	87.6	Confident	92	Very high	137 Å²	137	76.4 Å²	76.4	89%	0.89	39%	0.387	S	S	*	.	S	Bend	trans	-56	-24	175.4	-27.1	36.2	0	0	0	114.2
56	T	88.3	Confident	91.9	Very high	129 Å²	129	74.2 Å²	74.2	79%	0.791	39%	0.388	S	S	*	.	S	Bend	trans	-112.7	-11.2	-177.1	55.6	0	0	0	0	114	T54	T54-T56 PolarHBondContact O-N 2.89Å; T54-T56 PolarHBondContact OG1-N 2.99Å; T54-T56 PolarHBondContact OG1-OG1 2.8Å
57	R	90.6	Very high	91.7	Very high	184 Å²	184	80.1 Å²	80.1	69%	0.694	40%	0.401	S	S	*	.			trans	-118.4	117.5	177.5	-68	-169.6	-177.9	-177.8	1.9	110.5	Y53 T54	Y53-R57 PolarHBondContact N-O 2.94Å; T54-R57 PolarHBondContact N-O 3.32Å; T54-R57 VanDerWaalsContact N-O 3.08Å; T54-R57 PolarHBondContact O-N 2.64Å; T54-R57 VanDerWaalsContact O-O 3.08Å; T54-R57 WeakPolarHBondContact OG1-CB 3.07Å; T54-R57 PolarHBondContact OG1-N 3.27Å
58	M	91.7	Very high	91.4	Very high	29 Å²	29	80.7 Å²	80.7	14%	0.143	41%	0.409	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-134.6	164.8	172.9	63	174.4	139.7	0	0	111.4	N29 G30 D31 R50 T51 Y52	N29-M58 CarbonylContact C-O 3.59Å; G30-M58 PolarHBondContact N-O 2.85Å; D31-M58 HydrophobicContact CB-CE 3.84Å; D31-M58 WeakPolarHBondContact OD1-CE 3.45Å; R50-M58 PolarHBondContact NH2-SD 2.03Å; T51-M58 CarbonylContact O-C 3.42Å; T51-M58 WeakPolarHBondContact O-CA 3.08Å; T51-M58 VanDerWaalsContact O-CB 3.28Å; T51-M58 WeakPolarHBondContact O-CB 3.06Å; Y52-M58 HydrophobicContact CD1-CB 3.89Å; Y52-M58 HydrophobicContact CD1-SD 4.22Å; Y52-M58 HydrophobicContact CE1-CB 4.26Å; Y52-M58 HydrophobicContact CE1-CE 4.49Å; Y52-M58 HydrophobicContact CE1-SD 3.64Å; Y52-M58 HydrophobicContact CG-CB 4.37Å
59	K	92.1	Very high	91	Very high	75 Å²	75	84.4 Å²	84.4	33%	0.326	42%	0.419	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.7	138.6	171.9	179.8	179.8	-177.7	-179.3	0	108.6	Y28 T51 Y53	Y28-K59 CarbonylContact O-C 3.4Å; Y28-K59 WeakPolarHBondContact O-CA 3.48Å; Y28-K59 WeakPolarHBondContact O-CG 3.27Å; T51-K59 PolarHBondContact N-O 2.99Å; T51-K59 PolarHBondContact O-N 2.96Å; Y53-K59 HydrophobicContact CE2-CB 3.75Å
60	V	94.4	Very high	90.3	Very high	1 Å²	1	90.5 Å²	90.5	1%	0.006	44%	0.444	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.7	141.7	170.1	66.8	0	0	0	0	109.2	A27 Y28 C33 T48 T49 R50 K62	A27-V60 WeakPolarHBondContact CA-O 3.33Å; Y28-V60 PolarHBondContact N-O 2.98Å; Y28-V60 PolarHBondContact O-N 2.78Å; C33-V60 HydrophobicContact CB-CG1 4.08Å; T48-V60 HydrophobicContact CG2-CG2 4.01Å; T49-V60 CarbonylContact O-C 3.56Å; T49-V60 WeakPolarHBondContact O-CA 3.25Å; R50-V60 HydrophobicContact CG-CG2 4.25Å; V60-K62 HydrophobicContact CG2-CG 4.14Å
61	S	95.5	Very high	89.4	Confident	47 Å²	47	90 Å²	90	33%	0.329	46%	0.455	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.9	130.7	168.8	-177.9	0	0	0	0	109	C26 T48 T49	C26-S61 CarbonylContact O-C 3.55Å; C26-S61 WeakPolarHBondContact O-CA 3.39Å; T48-S61 CarbonylContact C-O 3.46Å; T48-S61 WeakPolarHBondContact CA-O 3.03Å; T49-S61 PolarHBondContact N-O 3.1Å; T49-S61 PolarHBondContact O-N 2.81Å
62	K	96.8	Very high	88.6	Confident	23 Å²	23	91.3 Å²	91.3	10%	0.1	46%	0.463	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.2	136.6	179.4	-52.2	-177.4	-173.8	-76.5	0	109.5	H24 V25 C26 N32 C33 M47 T48 V60	H24-K62 HydrophobicContact CB-CB 4.31Å; H24-K62 HydrophobicContact CB-CD 3.56Å; H24-K62 CarbonylContact O-C 3.57Å; H24-K62 WeakPolarHBondContact O-CB 3.41Å; V25-K62 WeakPolarHBondContact CA-O 3.33Å; C26-K62 PolarHBondContact N-O 2.85Å; C26-K62 VanDerWaalsContact N-O 3.1Å; C26-K62 PolarHBondContact O-N 2.89Å; N32-K62 WeakPolarHBondContact OD1-CE 3.32Å; N32-K62 PolarHBondContact OD1-NZ 3.19Å; C33-K62 WeakPolarHBondContact O-CE 2.82Å; M47-K62 CarbonylContact O-C 3.57Å; M47-K62 VanDerWaalsContact O-CA 3.25Å; M47-K62 WeakPolarHBondContact O-CA 3.45Å; T48-K62 HydrophobicContact CG2-CG 4.14Å; V60-K62 HydrophobicContact CG2-CG 4.14Å
63	S	95.5	Very high	87.1	Confident	38 Å²	38	94.1 Å²	94.1	27%	0.266	47%	0.474	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-154	164.7	-175.8	61.7	0	0	0	0	112.8	M47	M47-S63 PolarHBondContact N-O 2.93Å; M47-S63 PolarHBondContact O-N 3.41Å
64	C	95.6	Very high	85.5	Confident	32 Å²	32	91.7 Å²	91.7	22%	0.216	47%	0.471	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-89.4	124.4	172	-66.6	0	0	0	0	109.1	V25 C39 V43	V25-C64 VanDerWaalsContact CG2-SG 3.53Å; C39-C64 VanDerWaalsContact CA-SG 3.57Å; C39-C64 HydrophobicContact CB-CB 3.79Å; C39-C64 WeakPolarHBondContact CB-SG 3.06Å; C39-C64 WeakPolarHBondContact SG-CB 3.11Å; C39-C64 CovalentContact SG-SG 2.04Å; C39-C64 PolarHBondContact SG-SG 2.04Å; V43-C64 HydrophobicContact CB-CB 4.4Å; V43-C64 HydrophobicContact CG1-CB 3.77Å; V43-C64 HydrophobicContact CG2-CB 4.05Å
65	V	94	Very high	83.8	Confident	23 Å²	23	91.8 Å²	91.8	14%	0.139	48%	0.484	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-134.7	143.8	179.3	-62.2	0	0	0	0	113	V43 Y45 M47 R67 C68	V43-V65 WeakPolarHBondContact CG1-O 3.28Å; Y45-V65 PolarHBondContact N-O 3.08Å; Y45-V65 PolarHBondContact O-N 3.39Å; M47-V65 HydrophobicContact CB-CG1 4.01Å; M47-V65 HydrophobicContact CB-CG2 3.73Å; M47-V65 HydrophobicContact SD-CG1 4.13Å; V65-R67 VanDerWaalsContact C-N 3.26Å; V65-R67 WeakPolarHBondContact CB-O 3.35Å; V65-R67 WeakPolarHBondContact CG2-O 3.24Å; V65-R67 PolarHBondContact O-N 2.88Å; V65-C68 HydrophobicContact CG2-CB 4.12Å
66	P	91.1	Very high	82	Confident	81 Å²	81	93.9 Å²	93.9	53%	0.526	48%	0.475	S	S	.	.	S	Bend	trans	-67.8	-27.8	177.8	28	-34.8	0	0	0	112.6	Y45	Y45-P66 WeakPolarHBondContact CD2-O 3.13Å
67	R	89.3	Confident	80.2	Confident	187 Å²	187	90.4 Å²	90.4	71%	0.706	46%	0.456	S	S	*	.	S	Bend	trans	-141.3	143.1	174.5	-70.8	-171.4	164.8	150.1	-2.1	109.5	V65 F69	V65-R67 VanDerWaalsContact C-N 3.26Å; V65-R67 WeakPolarHBondContact CB-O 3.35Å; V65-R67 WeakPolarHBondContact CG2-O 3.24Å; V65-R67 PolarHBondContact O-N 2.88Å; R67-F69 HydrophobicContact CB-CE2 4.18Å; R67-F69 HydrophobicContact CB-CZ 4.23Å
68	C	87.4	Confident	78.1	Confident	60 Å²	60	89 Å²	89	41%	0.405	46%	0.455	S	S	.	.			trans	-118.6	131.6	176.8	-169	0	0	0	0	108.9	Y45 V65	Y45-C68 HydrophobicContact CG-CB 4.33Å; V65-C68 HydrophobicContact CG2-CB 4.12Å
69	F	84.7	Confident	76	Confident	155 Å²	155	95.2 Å²	95.2	68%	0.68	48%	0.484	S	S	*	.			trans	-117.2	130.8	173.9	-57.5	-76.1	0	0	0	108.1	R67 T71	R67-F69 HydrophobicContact CB-CE2 4.18Å; R67-F69 HydrophobicContact CB-CZ 4.23Å; F69-T71 PolarHBondContact O-N 3.12Å
70	E	78.3	Confident	73.7	Confident	177 Å²	177	96 Å²	96	83%	0.827	50%	0.504	S	S	*	.			trans	-73.2	123.5	175.5	-165.7	164.5	-161	0	0	108.8	V72	E70-V72 VanDerWaalsContact C-N 3.28Å; E70-V72 PolarHBondContact O-N 2.83Å
71	T	71.6	Confident	71.3	Confident	113 Å²	113	101.5 Å²	101.5	69%	0.693	54%	0.542	S	S	*	.			trans	-76.6	86.6	171.4	55.9	0	0	0	0	107.7	F69 Y73	F69-T71 PolarHBondContact O-N 3.12Å; T71-Y73 PolarHBondContact O-N 3.34Å
72	V	70.4	Confident	68.4	Low	85 Å²	85	109.2 Å²	109.2	52%	0.515	59%	0.588	S	S	.	*			trans	-66	120.8	172.2	-177.8	0	0	0	0	107.4	E70 D74 S77	E70-V72 VanDerWaalsContact C-N 3.28Å; E70-V72 PolarHBondContact O-N 2.83Å; V72-D74 HydrophobicContact CG1-CB 4.33Å; V72-D74 PolarHBondContact O-N 3.36Å; V72-S77 VanDerWaalsContact O-CB 3.31Å; V72-S77 WeakPolarHBondContact O-CB 2.78Å; V72-S77 PolarHBondContact O-OG 3.05Å
73	Y	58.3	Low	67	Low	193 Å²	193	113.6 Å²	113.6	76%	0.757	61%	0.612	S	S	*	*			trans	-82.8	76.1	176	-144.9	-87.9	0	0	0	108.8	T71 G75	T71-Y73 PolarHBondContact O-N 3.34Å; Y73-G75 VanDerWaalsContact C-N 3.3Å
74	D	52.9	Low	65.5	Low	97 Å²	97	117.5 Å²	117.5	52%	0.519	63%	0.631	S	S	.	*	S	Bend	trans	-88.3	3.9	175.1	63.8	-10.9	0	0	0	112.9	V72 Y76 S77	V72-D74 HydrophobicContact CG1-CB 4.33Å; V72-D74 PolarHBondContact O-N 3.36Å; D74-Y76 PolarHBondContact O-N 3.5Å; D74-Y76 PolarHBondContact OD1-N 3.29Å; D74-S77 WeakPolarHBondContact OD1-CB 3.35Å; D74-S77 PolarHBondContact OD1-N 3.46Å; D74-S77 PolarHBondContact OD1-OG 3.03Å
75	G	54.2	Low	63.8	Low	61 Å²	61	122.3 Å²	122.3	63%	0.629	65%	0.654	S	S	*	*	S	Bend	trans	78.5	-8.7	-173	0	0	0	0	0	114.3	Y73	Y73-G75 VanDerWaalsContact C-N 3.3Å
76	Y	49.1	Very low	62.1	Low	181 Å²	181	128.1 Å²	128.1	71%	0.71	68%	0.684	S	S	*	*			trans	-108.3	-20.9	-177.7	-157.9	-100.3	0	0	0	113.1	D74 K78	D74-Y76 PolarHBondContact O-N 3.5Å; D74-Y76 PolarHBondContact OD1-N 3.29Å; Y76-K78 PolarHBondContact O-N 3.38Å
77	S	51	Low	60.2	Low	57 Å²	57	131.1 Å²	131.1	40%	0.399	69%	0.694	S	S	.	*	G	3₁₀ helix	trans	-73.2	10.9	-169.5	-64.8	0	0	0	0	117.2	V72 D74 H79	V72-S77 VanDerWaalsContact O-CB 3.31Å; V72-S77 WeakPolarHBondContact O-CB 2.78Å; V72-S77 PolarHBondContact O-OG 3.05Å; D74-S77 WeakPolarHBondContact OD1-CB 3.35Å; D74-S77 PolarHBondContact OD1-N 3.46Å; D74-S77 PolarHBondContact OD1-OG 3.03Å; S77-H79 PolarHBondContact O-N 2.96Å
78	K	46.2	Very low	58.3	Low	154 Å²	154	127.3 Å²	127.3	67%	0.67	69%	0.693	S	S	*	*	G	3₁₀ helix	trans	-72.1	-5.1	177.3	-54.9	-155	-177.7	-167.9	0	113.8	Y76	Y76-K78 PolarHBondContact O-N 3.38Å
79	H	46.6	Very low	56.2	Low	160 Å²	160	132.1 Å²	132.1	74%	0.741	71%	0.713	S	S	*	*	G	3₁₀ helix	trans	-99.4	0.7	-174.9	-64.9	-64.8	0	0	0	115.3	S77 S81	S77-H79 PolarHBondContact O-N 2.96Å; H79-S81 PolarHBondContact O-N 3.37Å
80	A	44.6	Very low	54	Low	90 Å²	90	130.4 Å²	130.4	74%	0.744	72%	0.716	S	S	*	*			trans	-94.7	20.3	-176.3	0	0	0	0	0	114.6
81	S	43.3	Very low	52	Low	117 Å²	117	126.5 Å²	126.5	82%	0.818	71%	0.707	S	S	*	*			trans	-110.6	92.7	170.1	-58	0	0	0	0	108.6	H79	H79-S81 PolarHBondContact O-N 3.37Å
82	T	36	Very low	50.2	Low	210 Å²	210	127.7 Å²	127.7	100%	1.288	71%	0.708	S	S	*	*			trans	-84.4	0	162.5	-57.5	0	0	0	0	109.1

Retrieved 82 of 82 residues in 254.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).