A0A087WZX2_HUMAN Loading...

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

AlphaFold DB , UniProt , Accession A0A087WZX2, Species HUMAN (Homo sapiens, Human), Gene NDUFB6, Length 97 aa.

						>A0A087WZX2_HUMAN|A0A087WZX2|NDUFB6
MTGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPQKMGPMEKFWNKFLENKSPWRKMEKPYGIVEKKSRIFPGDTILETGEVIPPMKEFPDQHH
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	46.5	Very low	82.7	Confident	244 Å²	244	125.3 Å²	125.3	100%	1.202	65%	0.653	S	S	*	*				0	82.3	0	-68.7	-177.4	171.8	0	0	108	G3	M1-G3 PolarHBondContact O-N 3.1Å
2	T	62.8	Low	83.8	Confident	148 Å²	148	119.8 Å²	119.8	91%	0.908	63%	0.625	S	S	*	*			trans	-78	106.9	179.4	43.1	0	0	0	0	108
3	G	79.1	Confident	84.6	Confident	63 Å²	63	118.6 Å²	118.6	65%	0.649	61%	0.614	S	S	*	*			trans	-72.4	175.2	173.6	0	0	0	0	0	112.2	M1	M1-G3 PolarHBondContact O-N 3.1Å
4	Y	82.9	Confident	85.4	Confident	152 Å²	152	117.6 Å²	117.6	60%	0.596	61%	0.605	S	S	*	*			trans	-48.6	137.4	-178.7	-61.5	-77	0	0	0	113.8	E8 K9 L12	Y4-E8 WeakPolarHBondContact CA-OE2 3.44Å; Y4-E8 HydrophobicContact CD1-CB 4.29Å; Y4-K9 WeakPolarHBondContact O-CE 3.3Å; Y4-L12 HydrophobicContact CD1-CD1 3.8Å; Y4-L12 HydrophobicContact CE1-CD1 3.74Å; Y4-L12 HydrophobicContact CG-CD1 4.23Å
5	T	90.1	Very high	86.2	Confident	66 Å²	66	116.1 Å²	116.1	41%	0.405	60%	0.598	S	S	.	*			trans	-67.8	159.4	172	66.2	0	0	0	0	110.9	D7 E8 K9	T5-D7 VanDerWaalsContact C-N 3.27Å; T5-D7 PolarHBondContact O-N 3.32Å; T5-E8 PolarHBondContact N-OE2 3.05Å; T5-E8 PolarHBondContact O-N 3.44Å; T5-E8 WeakPolarHBondContact OG1-CB 3.39Å; T5-E8 WeakPolarHBondContact OG1-CG 3.3Å; T5-E8 PolarHBondContact OG1-N 3.29Å; T5-E8 PolarHBondContact OG1-OE1 3.43Å; T5-E8 PolarHBondContact OG1-OE2 2.86Å; T5-K9 WeakPolarHBondContact O-CG 3.47Å; T5-K9 PolarHBondContact O-N 3.03Å
6	P	88.4	Confident	86.7	Confident	104 Å²	104	119.1 Å²	119.1	68%	0.675	60%	0.599	S	S	*	*	H	α-helix	trans	-55.6	-39.6	179.6	-26.9	36	0	0	0	113.6	K9 L10	P6-K9 PolarHBondContact O-N 2.93Å; P6-L10 PolarHBondContact O-N 2.87Å
7	D	89.6	Confident	87.3	Confident	126 Å²	126	117.3 Å²	117.3	67%	0.674	59%	0.588	S	S	*	*	H	α-helix	trans	-70.9	-37.2	179	-64.9	-33.7	0	0	0	112.3	T5 K9 L10 R11	T5-D7 VanDerWaalsContact C-N 3.27Å; T5-D7 PolarHBondContact O-N 3.32Å; D7-K9 VanDerWaalsContact C-N 3.32Å; D7-L10 PolarHBondContact O-N 3.38Å; D7-R11 WeakPolarHBondContact O-CB 3.46Å; D7-R11 PolarHBondContact O-N 2.76Å
8	E	91.4	Very high	87.8	Confident	88 Å²	88	116.8 Å²	116.8	41%	0.411	59%	0.587	S	S	.	*	H	α-helix	trans	-63.9	-39.9	172.9	-74.2	163.7	-170.6	0	0	111.4	Y4 T5 R11 L12	Y4-E8 WeakPolarHBondContact CA-OE2 3.44Å; Y4-E8 HydrophobicContact CD1-CB 4.29Å; T5-E8 PolarHBondContact N-OE2 3.05Å; T5-E8 PolarHBondContact O-N 3.44Å; T5-E8 WeakPolarHBondContact OG1-CB 3.39Å; T5-E8 WeakPolarHBondContact OG1-CG 3.3Å; T5-E8 PolarHBondContact OG1-N 3.29Å; T5-E8 PolarHBondContact OG1-OE1 3.43Å; T5-E8 PolarHBondContact OG1-OE2 2.86Å; E8-R11 PolarHBondContact O-N 3.25Å; E8-L12 VanDerWaalsContact O-CB 3.32Å; E8-L12 WeakPolarHBondContact O-CB 3.19Å; E8-L12 WeakPolarHBondContact O-CG 3.28Å; E8-L12 PolarHBondContact O-N 3.34Å
9	K	91.8	Very high	88.1	Confident	125 Å²	125	118.3 Å²	118.3	54%	0.543	59%	0.585	S	S	.	*	H	α-helix	trans	-64	-43.9	175.3	-71.2	175.1	178.6	170.2	0	111.4	Y4 T5 P6 D7 L12 Q13	Y4-K9 WeakPolarHBondContact O-CE 3.3Å; T5-K9 WeakPolarHBondContact O-CG 3.47Å; T5-K9 PolarHBondContact O-N 3.03Å; P6-K9 PolarHBondContact O-N 2.93Å; D7-K9 VanDerWaalsContact C-N 3.32Å; K9-L12 PolarHBondContact O-N 3.36Å; K9-Q13 WeakPolarHBondContact O-CB 3.45Å; K9-Q13 PolarHBondContact O-N 3.33Å
10	L	93.9	Very high	88.4	Confident	89 Å²	89	121.8 Å²	121.8	47%	0.466	59%	0.591	S	S	.	*	H	α-helix	trans	-62.4	-45.5	177.1	-178.1	63.5	0	0	0	111.1	P6 D7 L12 Q13 Q14	P6-L10 PolarHBondContact O-N 2.87Å; D7-L10 PolarHBondContact O-N 3.38Å; L10-L12 PolarHBondContact O-N 2.75Å; L10-Q13 WeakPolarHBondContact O-CB 3.43Å; L10-Q13 PolarHBondContact O-N 3.33Å; L10-Q14 WeakPolarHBondContact O-CG 3.33Å; L10-Q14 PolarHBondContact O-N 3.32Å
11	R	93.8	Very high	88.6	Confident	173 Å²	173	123.9 Å²	123.9	65%	0.653	59%	0.593	S	S	*	*	H	α-helix	trans	-62.5	-43	176.8	-173.2	-179.5	-179.4	97.5	0	112.1	D7 E8 Q13 Q14 L15	D7-R11 WeakPolarHBondContact O-CB 3.46Å; D7-R11 PolarHBondContact O-N 2.76Å; E8-R11 PolarHBondContact O-N 3.25Å; R11-Q13 VanDerWaalsContact C-N 3.32Å; R11-Q13 PolarHBondContact O-N 2.96Å; R11-Q14 PolarHBondContact O-N 3.05Å; R11-L15 HydrophobicContact CG-CD1 4.27Å; R11-L15 WeakPolarHBondContact O-CB 3.33Å; R11-L15 WeakPolarHBondContact O-CG 3.49Å; R11-L15 PolarHBondContact O-N 3.42Å
12	L	95	Very high	90.7	Very high	60 Å²	60	119.4 Å²	119.4	31%	0.314	56%	0.563	S	S	.	*	H	α-helix	trans	-65.4	-36.3	176.9	-74.9	171.4	0	0	0	112	Y4 E8 K9 L10 R16	Y4-L12 HydrophobicContact CD1-CD1 3.8Å; Y4-L12 HydrophobicContact CE1-CD1 3.74Å; Y4-L12 HydrophobicContact CG-CD1 4.23Å; E8-L12 VanDerWaalsContact O-CB 3.32Å; E8-L12 WeakPolarHBondContact O-CB 3.19Å; E8-L12 WeakPolarHBondContact O-CG 3.28Å; E8-L12 PolarHBondContact O-N 3.34Å; K9-L12 PolarHBondContact O-N 3.36Å; L10-L12 PolarHBondContact O-N 2.75Å; L12-R16 WeakPolarHBondContact O-CB 3.21Å; L12-R16 VanDerWaalsContact O-CG 3.32Å; L12-R16 WeakPolarHBondContact O-CG 3.18Å; L12-R16 PolarHBondContact O-N 3.18Å
13	Q	95	Very high	91.9	Very high	104 Å²	104	116.4 Å²	116.4	49%	0.486	54%	0.541	S	S	.	.	H	α-helix	trans	-64.6	-48.2	174.1	-176.8	-179.8	-16.4	0	0	111.1	K9 L10 R11 L15 R16 E17	K9-Q13 WeakPolarHBondContact O-CB 3.45Å; K9-Q13 PolarHBondContact O-N 3.33Å; L10-Q13 WeakPolarHBondContact O-CB 3.43Å; L10-Q13 PolarHBondContact O-N 3.33Å; R11-Q13 VanDerWaalsContact C-N 3.32Å; R11-Q13 PolarHBondContact O-N 2.96Å; Q13-L15 VanDerWaalsContact C-N 3.34Å; Q13-L15 PolarHBondContact O-N 3.29Å; Q13-R16 WeakPolarHBondContact O-CB 3.42Å; Q13-R16 PolarHBondContact O-N 2.93Å; Q13-R16 VanDerWaalsContact O-N 3.15Å; Q13-E17 PolarHBondContact NE2-OE1 3.25Å; Q13-E17 PolarHBondContact O-N 3.37Å
14	Q	95.6	Very high	92.3	Very high	105 Å²	105	120.3 Å²	120.3	49%	0.491	54%	0.54	S	S	.	.	H	α-helix	trans	-58.1	-45.5	176.7	-71.5	172.6	-7.5	0	0	111.6	L10 R11 R16 E17 L18	L10-Q14 WeakPolarHBondContact O-CG 3.33Å; L10-Q14 PolarHBondContact O-N 3.32Å; R11-Q14 PolarHBondContact O-N 3.05Å; Q14-R16 PolarHBondContact O-N 3.25Å; Q14-E17 PolarHBondContact O-N 2.73Å; Q14-L18 WeakPolarHBondContact O-CG 3.46Å; Q14-L18 PolarHBondContact O-N 3.37Å
15	L	96.6	Very high	92.5	Very high	94 Å²	94	118.8 Å²	118.8	49%	0.492	54%	0.542	S	S	.	.	H	α-helix	trans	-64.7	-37.7	176.8	-72.3	172.4	0	0	0	112.4	R11 Q13 R19	R11-L15 HydrophobicContact CG-CD1 4.27Å; R11-L15 WeakPolarHBondContact O-CB 3.33Å; R11-L15 WeakPolarHBondContact O-CG 3.49Å; R11-L15 PolarHBondContact O-N 3.42Å; Q13-L15 VanDerWaalsContact C-N 3.34Å; Q13-L15 PolarHBondContact O-N 3.29Å; L15-R19 VanDerWaalsContact O-CB 3.23Å; L15-R19 WeakPolarHBondContact O-CB 3.3Å; L15-R19 PolarHBondContact O-N 3.13Å
16	R	95.6	Very high	92	Very high	165 Å²	165	121.2 Å²	121.2	62%	0.623	55%	0.549	S	S	*	.	H	α-helix	trans	-64.4	-41.3	174.8	-83.3	177.6	-174.7	161.1	2.8	112.2	L12 Q13 Q14 R19 R20	L12-R16 WeakPolarHBondContact O-CB 3.21Å; L12-R16 VanDerWaalsContact O-CG 3.32Å; L12-R16 WeakPolarHBondContact O-CG 3.18Å; L12-R16 PolarHBondContact O-N 3.18Å; Q13-R16 WeakPolarHBondContact O-CB 3.42Å; Q13-R16 PolarHBondContact O-N 2.93Å; Q13-R16 VanDerWaalsContact O-N 3.15Å; Q14-R16 PolarHBondContact O-N 3.25Å; R16-R19 PolarHBondContact O-N 2.92Å; R16-R20 WeakPolarHBondContact O-CB 3.33Å; R16-R20 WeakPolarHBondContact O-CG 3.1Å; R16-R20 PolarHBondContact O-N 3.19Å
17	E	95.6	Very high	91.5	Very high	88 Å²	88	123.6 Å²	123.6	41%	0.411	55%	0.551	S	S	.	*	H	α-helix	trans	-64.7	-45.7	178.4	-74.8	178.1	-165.6	0	0	111.6	Q13 Q14 R19 R20 R21	Q13-E17 PolarHBondContact NE2-OE1 3.25Å; Q13-E17 PolarHBondContact O-N 3.37Å; Q14-E17 PolarHBondContact O-N 2.73Å; E17-R19 VanDerWaalsContact C-N 3.33Å; E17-R19 PolarHBondContact O-N 3.2Å; E17-R20 PolarHBondContact O-N 3.34Å; E17-R21 PolarHBondContact O-N 3.3Å; E17-R21 VanDerWaalsContact O-N 3.12Å
18	L	96	Very high	90.4	Very high	109 Å²	109	124.3 Å²	124.3	57%	0.571	55%	0.554	S	S	*	*	H	α-helix	trans	-61	-43.2	173.9	-68.5	173.8	0	0	0	111.5	Q14 R20 R21 W22	Q14-L18 WeakPolarHBondContact O-CG 3.46Å; Q14-L18 PolarHBondContact O-N 3.37Å; L18-R20 PolarHBondContact O-N 2.86Å; L18-R21 PolarHBondContact O-N 2.75Å; L18-W22 WeakPolarHBondContact O-CB 3.32Å; L18-W22 PolarHBondContact O-N 3.18Å
19	R	94.6	Very high	89.3	Confident	145 Å²	145	123.2 Å²	123.2	55%	0.547	56%	0.556	S	S	.	*	H	α-helix	trans	-64.1	-39.5	179.1	-175.4	58.7	175.3	176.4	1.1	112.3	L15 R16 E17 L23	L15-R19 VanDerWaalsContact O-CB 3.23Å; L15-R19 WeakPolarHBondContact O-CB 3.3Å; L15-R19 PolarHBondContact O-N 3.13Å; R16-R19 PolarHBondContact O-N 2.92Å; E17-R19 VanDerWaalsContact C-N 3.33Å; E17-R19 PolarHBondContact O-N 3.2Å; R19-L23 HydrophobicContact CG-CD1 4.01Å; R19-L23 HydrophobicContact CG-CG 4.45Å; R19-L23 WeakPolarHBondContact O-CB 3.48Å; R19-L23 VanDerWaalsContact O-CG 3.23Å; R19-L23 WeakPolarHBondContact O-CG 3.38Å; R19-L23 PolarHBondContact O-N 2.91Å
20	R	93.5	Very high	88	Confident	188 Å²	188	123.3 Å²	123.3	71%	0.709	57%	0.569	S	S	*	*	H	α-helix	trans	-65.2	-42.6	177	-76.9	176.1	178.5	-177.4	-0.7	112	R16 E17 L18 K24	R16-R20 WeakPolarHBondContact O-CB 3.33Å; R16-R20 WeakPolarHBondContact O-CG 3.1Å; R16-R20 PolarHBondContact O-N 3.19Å; E17-R20 PolarHBondContact O-N 3.34Å; L18-R20 PolarHBondContact O-N 2.86Å; R20-K24 WeakPolarHBondContact O-CB 3.44Å; R20-K24 PolarHBondContact O-N 3.38Å
21	R	92.9	Very high	86.5	Confident	166 Å²	166	129.2 Å²	129.2	63%	0.626	59%	0.586	S	S	*	*	H	α-helix	trans	-64.2	-47.3	175.7	-71.4	177.8	-176.9	170.7	3.4	111.2	E17 L18 L23 K24 D25	E17-R21 PolarHBondContact O-N 3.3Å; E17-R21 VanDerWaalsContact O-N 3.12Å; L18-R21 PolarHBondContact O-N 2.75Å; R21-L23 PolarHBondContact O-N 2.86Å; R21-K24 WeakPolarHBondContact O-CB 3.2Å; R21-K24 PolarHBondContact O-N 3.26Å; R21-K24 VanDerWaalsContact O-N 3.14Å; R21-D25 PolarHBondContact O-N 3.36Å
22	W	90.6	Very high	85.1	Confident	150 Å²	150	127.4 Å²	127.4	57%	0.568	58%	0.584	S	S	*	*	H	α-helix	trans	-57.6	-45.6	176.3	-179.1	-92.1	0	0	0	112.8	L18 K24 D25 Q26	L18-W22 WeakPolarHBondContact O-CB 3.32Å; L18-W22 PolarHBondContact O-N 3.18Å; W22-K24 VanDerWaalsContact C-N 3.31Å; W22-K24 PolarHBondContact O-N 2.92Å; W22-D25 PolarHBondContact O-N 3.41Å; W22-Q26 WeakPolarHBondContact O-CG 3.23Å; W22-Q26 PolarHBondContact O-N 3.25Å; W22-Q26 VanDerWaalsContact O-N 3.14Å
23	L	88.8	Confident	83.4	Confident	85 Å²	85	130.8 Å²	130.8	45%	0.445	61%	0.61	S	S	.	*	H	α-helix	trans	-64.5	-36.2	178.2	-74.2	170.2	0	0	0	112.3	R19 R21 D25 Q26 E27	R19-L23 HydrophobicContact CG-CD1 4.01Å; R19-L23 HydrophobicContact CG-CG 4.45Å; R19-L23 WeakPolarHBondContact O-CB 3.48Å; R19-L23 VanDerWaalsContact O-CG 3.23Å; R19-L23 WeakPolarHBondContact O-CG 3.38Å; R19-L23 PolarHBondContact O-N 2.91Å; R21-L23 PolarHBondContact O-N 2.86Å; L23-D25 VanDerWaalsContact C-N 3.35Å; L23-Q26 WeakPolarHBondContact O-CB 3.16Å; L23-Q26 PolarHBondContact O-N 3.33Å; L23-E27 PolarHBondContact O-N 2.97Å
24	K	87.1	Confident	81.9	Confident	145 Å²	145	130.9 Å²	130.9	63%	0.63	62%	0.617	S	S	*	*	H	α-helix	trans	-65.8	-38.3	174.2	-173.1	178	-179.8	-179.4	0	111.8	R20 R21 W22 Q26 E27	R20-K24 WeakPolarHBondContact O-CB 3.44Å; R20-K24 PolarHBondContact O-N 3.38Å; R21-K24 WeakPolarHBondContact O-CB 3.2Å; R21-K24 PolarHBondContact O-N 3.26Å; R21-K24 VanDerWaalsContact O-N 3.14Å; W22-K24 VanDerWaalsContact C-N 3.31Å; W22-K24 PolarHBondContact O-N 2.92Å; K24-Q26 PolarHBondContact O-N 3.43Å; K24-E27 WeakPolarHBondContact O-CB 3.38Å; K24-E27 PolarHBondContact O-N 3.42Å; K24-E27 VanDerWaalsContact O-N 3.1Å
25	D	86.1	Confident	80.9	Confident	120 Å²	120	132.9 Å²	132.9	64%	0.642	63%	0.63	S	S	*	*	H	α-helix	trans	-71.5	-14.6	176.1	-63.8	-22.2	0	0	0	112.8	R21 W22 L23	R21-D25 PolarHBondContact O-N 3.36Å; W22-D25 PolarHBondContact O-N 3.41Å; L23-D25 VanDerWaalsContact C-N 3.35Å
26	Q	80.2	Confident	79.8	Confident	117 Å²	117	133.8 Å²	133.8	55%	0.547	64%	0.642	S	S	.	*	T	Hydrogen-bonded Turn	trans	-85	-10.3	170.5	-66.2	-63.8	-79	0	0	113.3	W22 L23 K24 L28	W22-Q26 WeakPolarHBondContact O-CG 3.23Å; W22-Q26 PolarHBondContact O-N 3.25Å; W22-Q26 VanDerWaalsContact O-N 3.14Å; L23-Q26 WeakPolarHBondContact O-CB 3.16Å; L23-Q26 PolarHBondContact O-N 3.33Å; K24-Q26 PolarHBondContact O-N 3.43Å; Q26-L28 VanDerWaalsContact C-N 3.31Å; Q26-L28 PolarHBondContact O-N 2.99Å
27	E	77.8	Confident	78.8	Confident	153 Å²	153	131.3 Å²	131.3	72%	0.715	65%	0.647	S	S	*	*	S	Bend	trans	-70	95	169.9	-65.4	-179.2	179.7	0	0	107.9	L23 K24 S29	L23-E27 PolarHBondContact O-N 2.97Å; K24-E27 WeakPolarHBondContact O-CB 3.38Å; K24-E27 PolarHBondContact O-N 3.42Å; K24-E27 VanDerWaalsContact O-N 3.1Å; E27-S29 PolarHBondContact O-N 3.3Å
28	L	67.2	Low	77.9	Confident	142 Å²	142	136 Å²	136	74%	0.743	67%	0.669	S	S	*	*			trans	-56.3	127.1	178.4	-126.6	76.7	0	0	0	109.1	Q26	Q26-L28 VanDerWaalsContact C-N 3.31Å; Q26-L28 PolarHBondContact O-N 2.99Å
29	S	68	Low	77.1	Confident	64 Å²	64	140.1 Å²	140.1	45%	0.448	68%	0.683	S	S	.	*			trans	-57.7	147.1	164.7	-171.7	0	0	0	0	108.3	E27 R31	E27-S29 PolarHBondContact O-N 3.3Å; S29-R31 CarbonylContact O-C 3.55Å; S29-R31 PolarHBondContact O-N 3.35Å
30	P	64.4	Low	76.5	Confident	128 Å²	128	137 Å²	137	83%	0.831	68%	0.675	S	S	*	*	S	Bend	trans	-54.9	-8.7	174.1	-25.7	34.3	0	0	0	114.6	E32	P30-E32 PolarHBondContact O-N 3.21Å
31	R	63	Low	76.3	Confident	213 Å²	213	129.7 Å²	129.7	80%	0.804	66%	0.658	S	S	*	*			trans	-75.6	77.6	170.4	-65	-173.1	175.7	113.4	-1	110.1	S29	S29-R31 CarbonylContact O-C 3.55Å; S29-R31 PolarHBondContact O-N 3.35Å
32	E	63.1	Low	76.2	Confident	135 Å²	135	127.5 Å²	127.5	63%	0.631	67%	0.666	S	S	*	*			trans	-55.9	138.5	153.1	-68.4	178.6	169.5	0	0	108.6	P30 V34	P30-E32 PolarHBondContact O-N 3.21Å; E32-V34 HydrophobicContact CB-CG2 3.73Å; E32-V34 PolarHBondContact O-N 3.38Å
33	P	60	Low	76.2	Confident	131 Å²	131	126 Å²	126	85%	0.851	67%	0.666	S	S	*	*			trans	-69.4	77.2	157.3	30.6	-31	0	0	0	106.7	L35	P33-L35 PolarHBondContact O-N 2.92Å
34	V	64.3	Low	76.2	Confident	105 Å²	105	126.8 Å²	126.8	64%	0.636	67%	0.668	S	S	*	*	P	Polyproline II helix	trans	-64.1	122.2	173.3	-163.5	0	0	0	0	105.3	E32	E32-V34 HydrophobicContact CB-CG2 3.73Å; E32-V34 PolarHBondContact O-N 3.38Å
35	L	73.8	Confident	76.3	Confident	147 Å²	147	125.6 Å²	125.6	77%	0.77	66%	0.662	S	S	*	*	P	Polyproline II helix	trans	-48.2	139.5	166.2	-68.6	173	0	0	0	107.5	P33 P37	P33-L35 PolarHBondContact O-N 2.92Å; L35-P37 VanDerWaalsContact O-N 3.14Å
36	P	73.5	Confident	76.6	Confident	113 Å²	113	125.2 Å²	125.2	73%	0.734	66%	0.655	S	S	*	*	P	Polyproline II helix	trans	-51.7	131.6	179.5	22.9	-33	0	0	0	107.8	Q38	P36-Q38 PolarHBondContact O-N 3.41Å
37	P	73.9	Confident	77	Confident	113 Å²	113	125.3 Å²	125.3	73%	0.734	65%	0.651	S	S	*	*	P	Polyproline II helix	trans	-53.7	139.2	-178.6	22	-32.7	0	0	0	108.2	L35 K39	L35-P37 VanDerWaalsContact O-N 3.14Å; P37-K39 PolarHBondContact O-N 3.15Å; P37-K39 VanDerWaalsContact O-N 3.13Å
38	Q	78.1	Confident	77.4	Confident	187 Å²	187	121.7 Å²	121.7	87%	0.874	64%	0.636	S	S	*	*	P	Polyproline II helix	trans	-50.6	126.6	-178.8	-169.7	169.2	27.8	0	0	109	P36 M40	P36-Q38 PolarHBondContact O-N 3.41Å; Q38-M40 PolarHBondContact O-N 2.95Å
39	K	78.8	Confident	78.4	Confident	196 Å²	196	122.2 Å²	122.2	85%	0.852	63%	0.632	S	S	*	*			trans	-64.5	100.8	-175.6	-73.4	-177.1	-179.2	178	0	108.7	P37 G41	P37-K39 PolarHBondContact O-N 3.15Å; P37-K39 VanDerWaalsContact O-N 3.13Å; K39-G41 PolarHBondContact O-N 3.26Å
40	M	82.4	Confident	79.3	Confident	80 Å²	80	121.1 Å²	121.1	39%	0.394	62%	0.62	S	S	.	*			trans	-56.9	136.3	169.8	-70.3	178.6	148.9	0	0	109.7	Q38 E44 K45 N48	Q38-M40 PolarHBondContact O-N 2.95Å; M40-E44 HydrophobicContact CB-CB 4.25Å; M40-E44 HydrophobicContact CB-CG 4.29Å; M40-E44 HydrophobicContact CE-CG 4.18Å; M40-E44 HydrophobicContact CG-CG 4.22Å; M40-E44 HydrophobicContact SD-CG 4.29Å; M40-K45 HydrophobicContact CB-CG 3.75Å; M40-K45 WeakPolarHBondContact O-CE 3.48Å; M40-N48 WeakPolarHBondContact CE-ND2 3.49Å; M40-N48 PolarHBondContact SD-ND2 3.47Å
41	G	89.1	Confident	80.2	Confident	34 Å²	34	118.8 Å²	118.8	35%	0.351	60%	0.6	S	S	.	*			trans	-63	162	174.9	0	0	0	0	0	111.5	K39 M43 E44 K45	K39-G41 PolarHBondContact O-N 3.26Å; G41-M43 PolarHBondContact O-N 3.48Å; G41-E44 PolarHBondContact O-N 2.89Å; G41-K45 PolarHBondContact O-N 2.94Å
42	P	90.7	Very high	81.2	Confident	120 Å²	120	115.5 Å²	115.5	78%	0.779	59%	0.593	S	S	*	*	H	α-helix	trans	-54	-37.5	179.1	-27.1	35.2	0	0	0	113.8	F46	P42-F46 WeakPolarHBondContact O-CB 3.43Å; P42-F46 PolarHBondContact O-N 3.44Å
43	M	90.5	Very high	82	Confident	119 Å²	119	114 Å²	114	59%	0.586	59%	0.59	S	S	*	*	H	α-helix	trans	-68.8	-40.5	179.9	-166.1	67	-174.9	0	0	112.9	G41 F46 W47	G41-M43 PolarHBondContact O-N 3.48Å; M43-F46 WeakPolarHBondContact O-CB 3.48Å; M43-F46 PolarHBondContact O-N 2.92Å; M43-W47 HydrophobicContact CE-CZ2 4.04Å; M43-W47 VanDerWaalsContact O-CD1 3.24Å; M43-W47 PolarHBondContact O-N 2.92Å
44	E	87.9	Confident	82.6	Confident	100 Å²	100	115.5 Å²	115.5	47%	0.467	58%	0.583	S	S	.	*	H	α-helix	trans	-71	-40.6	-179.8	-170.6	176.7	-165.2	0	0	110.8	M40 G41 F46 W47 N48	M40-E44 HydrophobicContact CB-CB 4.25Å; M40-E44 HydrophobicContact CB-CG 4.29Å; M40-E44 HydrophobicContact CE-CG 4.18Å; M40-E44 HydrophobicContact CG-CG 4.22Å; M40-E44 HydrophobicContact SD-CG 4.29Å; G41-E44 PolarHBondContact O-N 2.89Å; E44-F46 VanDerWaalsContact C-N 3.27Å; E44-F46 PolarHBondContact O-N 3.47Å; E44-W47 PolarHBondContact O-N 2.88Å; E44-N48 WeakPolarHBondContact O-CB 3.37Å; E44-N48 VanDerWaalsContact O-CG 3.29Å; E44-N48 PolarHBondContact O-N 3.46Å; E44-N48 PolarHBondContact O-ND2 3.31Å
45	K	90.1	Very high	83.3	Confident	120 Å²	120	112.4 Å²	112.4	52%	0.522	57%	0.566	S	S	.	*	H	α-helix	trans	-58.1	-41.4	170	-71.4	-179.9	175.2	173.7	0	112	M40 G41 K49	M40-K45 HydrophobicContact CB-CG 3.75Å; M40-K45 WeakPolarHBondContact O-CE 3.48Å; G41-K45 PolarHBondContact O-N 2.94Å; K45-K49 WeakPolarHBondContact O-CB 3.32Å; K45-K49 PolarHBondContact O-N 3.35Å
46	F	91.2	Very high	83.3	Confident	112 Å²	112	109.1 Å²	109.1	49%	0.491	55%	0.554	S	S	.	*	H	α-helix	trans	-62	-52.8	176.7	171.6	-93.6	0	0	0	111.5	P42 M43 E44 N48 K49 F50	P42-F46 WeakPolarHBondContact O-CB 3.43Å; P42-F46 PolarHBondContact O-N 3.44Å; M43-F46 WeakPolarHBondContact O-CB 3.48Å; M43-F46 PolarHBondContact O-N 2.92Å; E44-F46 VanDerWaalsContact C-N 3.27Å; E44-F46 PolarHBondContact O-N 3.47Å; F46-N48 VanDerWaalsContact C-N 3.35Å; F46-N48 PolarHBondContact O-N 3.36Å; F46-K49 PolarHBondContact O-N 3.12Å; F46-F50 HydrophobicContact CZ-CD2 4.41Å; F46-F50 VanDerWaalsContact O-CB 3.23Å; F46-F50 WeakPolarHBondContact O-CB 3.33Å; F46-F50 PolarHBondContact O-N 3.05Å
47	W	88.8	Confident	83.6	Confident	120 Å²	120	111.5 Å²	111.5	46%	0.455	55%	0.548	S	S	.	.	H	α-helix	trans	-62.7	-39.9	-179.9	-77.4	118.1	0	0	0	112.9	M43 E44 F50 L51	M43-W47 HydrophobicContact CE-CZ2 4.04Å; M43-W47 VanDerWaalsContact O-CD1 3.24Å; M43-W47 PolarHBondContact O-N 2.92Å; E44-W47 PolarHBondContact O-N 2.88Å; W47-F50 AromaticContact CE3-CD1 3.96Å; W47-F50 HydrophobicContact CE3-CD1 3.96Å; W47-F50 AromaticContact CZ3-CD1 3.95Å; W47-F50 HydrophobicContact CZ3-CD1 3.95Å; W47-F50 HydrophobicContact CZ3-CE1 4.11Å; W47-F50 WeakPolarHBondContact O-CB 3.32Å; W47-F50 PolarHBondContact O-N 2.94Å; W47-L51 WeakPolarHBondContact O-CB 3.48Å; W47-L51 WeakPolarHBondContact O-CG 3.23Å; W47-L51 PolarHBondContact O-N 2.95Å
48	N	87.4	Confident	83.9	Confident	76 Å²	76	109.4 Å²	109.4	41%	0.406	53%	0.525	S	S	.	.	H	α-helix	trans	-61.6	-48.5	176.3	-74.3	-26.5	0	0	0	111.4	M40 E44 F46 F50 L51 E52	M40-N48 WeakPolarHBondContact CE-ND2 3.49Å; M40-N48 PolarHBondContact SD-ND2 3.47Å; E44-N48 WeakPolarHBondContact O-CB 3.37Å; E44-N48 VanDerWaalsContact O-CG 3.29Å; E44-N48 PolarHBondContact O-N 3.46Å; E44-N48 PolarHBondContact O-ND2 3.31Å; F46-N48 VanDerWaalsContact C-N 3.35Å; F46-N48 PolarHBondContact O-N 3.36Å; N48-F50 VanDerWaalsContact C-N 3.27Å; N48-F50 PolarHBondContact O-N 3.36Å; N48-L51 PolarHBondContact O-N 2.89Å; N48-E52 VanDerWaalsContact O-CB 3.3Å; N48-E52 WeakPolarHBondContact O-CB 3.49Å; N48-E52 PolarHBondContact O-N 3.23Å
49	K	87.4	Confident	83.7	Confident	153 Å²	153	104.8 Å²	104.8	67%	0.665	50%	0.502	S	S	*	.	H	α-helix	trans	-65.5	-31.9	176	-168.7	174.2	-174.6	178.9	0	112.5	K45 F46	K45-K49 WeakPolarHBondContact O-CB 3.32Å; K45-K49 PolarHBondContact O-N 3.35Å; F46-K49 PolarHBondContact O-N 3.12Å
50	F	86.5	Confident	83.2	Confident	42 Å²	42	102.6 Å²	102.6	18%	0.184	50%	0.497	C	S	.	.	H	α-helix	trans	-68.3	-43.5	176.4	-177.5	-96.8	0	0	0	111.4	F46 W47 N48 W57 R58	F46-F50 HydrophobicContact CZ-CD2 4.41Å; F46-F50 VanDerWaalsContact O-CB 3.23Å; F46-F50 WeakPolarHBondContact O-CB 3.33Å; F46-F50 PolarHBondContact O-N 3.05Å; W47-F50 AromaticContact CE3-CD1 3.96Å; W47-F50 HydrophobicContact CE3-CD1 3.96Å; W47-F50 AromaticContact CZ3-CD1 3.95Å; W47-F50 HydrophobicContact CZ3-CD1 3.95Å; W47-F50 HydrophobicContact CZ3-CE1 4.11Å; W47-F50 WeakPolarHBondContact O-CB 3.32Å; W47-F50 PolarHBondContact O-N 2.94Å; N48-F50 VanDerWaalsContact C-N 3.27Å; N48-F50 PolarHBondContact O-N 3.36Å; F50-W57 HydrophobicContact CE1-CZ3 4.45Å; F50-W57 AromaticContact CE2-CH2 3.64Å; F50-W57 HydrophobicContact CE2-CH2 3.64Å; F50-W57 HydrophobicContact CE2-CZ2 4.46Å; F50-W57 HydrophobicContact CE2-CZ3 4.21Å; F50-W57 AromaticContact CZ-CH2 3.41Å; F50-W57 HydrophobicContact CZ-CH2 3.41Å; F50-W57 VanDerWaalsContact CZ-CH2 3.41Å; F50-W57 HydrophobicContact CZ-CZ2 4.36Å; F50-W57 AromaticContact CZ-CZ3 3.5Å; F50-W57 HydrophobicContact CZ-CZ3 3.5Å; F50-R58 HydrophobicContact CD1-CG 4.49Å; F50-R58 HydrophobicContact CE1-CB 4.02Å; F50-R58 HydrophobicContact CE1-CG 3.81Å; F50-R58 HydrophobicContact CE2-CG 4.46Å; F50-R58 HydrophobicContact CZ-CB 4.5Å; F50-R58 HydrophobicContact CZ-CG 3.81Å; F50-R58 WeakPolarHBondContact O-CD 3.35Å; F50-R58 PolarHBondContact O-NH1 3.04Å
51	L	84.3	Confident	82.9	Confident	78 Å²	78	104.3 Å²	104.3	41%	0.408	50%	0.504	S	S	.	.	H	α-helix	trans	-85.7	-17.1	-178.2	-65.4	175.5	0	0	0	114.4	W47 N48 N53 R58	W47-L51 WeakPolarHBondContact O-CB 3.48Å; W47-L51 WeakPolarHBondContact O-CG 3.23Å; W47-L51 PolarHBondContact O-N 2.95Å; N48-L51 PolarHBondContact O-N 2.89Å; L51-N53 VanDerWaalsContact C-N 3.25Å; L51-N53 PolarHBondContact O-N 3.32Å; L51-R58 HydrophobicContact CD2-CB 4.39Å; L51-R58 WeakPolarHBondContact CD2-O 3.43Å
52	E	84.4	Confident	82.4	Confident	144 Å²	144	110.3 Å²	110.3	67%	0.673	52%	0.521	S	S	*	.	H	α-helix	trans	-54.3	-42.8	175.6	-177.5	176.6	-168	0	0	111.6	N48 K54	N48-E52 VanDerWaalsContact O-CB 3.3Å; N48-E52 WeakPolarHBondContact O-CB 3.49Å; N48-E52 PolarHBondContact O-N 3.23Å; E52-K54 PolarHBondContact O-N 3.1Å
53	N	78.6	Confident	81.9	Confident	105 Å²	105	109.6 Å²	109.6	56%	0.561	52%	0.516	S	S	*	.	S	Bend	trans	-75.8	105.7	169.7	-74.5	-42.3	0	0	0	109.5	L51 S55	L51-N53 VanDerWaalsContact C-N 3.25Å; L51-N53 PolarHBondContact O-N 3.32Å; N53-S55 PolarHBondContact O-N 3.14Å
54	K	72.3	Confident	81.5	Confident	162 Å²	162	113.5 Å²	113.5	70%	0.704	53%	0.526	S	S	*	.			trans	-68.4	46.5	-179.1	-54.7	-177.4	-178.9	176.5	0	113.6	E52 K59	E52-K54 PolarHBondContact O-N 3.1Å; K54-K59 HydrophobicContact CB-CD 4.34Å
55	S	80.7	Confident	81.2	Confident	40 Å²	40	111.3 Å²	111.3	28%	0.28	53%	0.53	S	S	.	.			trans	-72.1	133.6	174.1	-168	0	0	0	0	109.6	N53 W57 R58 K59	N53-S55 PolarHBondContact O-N 3.14Å; S55-W57 VanDerWaalsContact C-N 3.27Å; S55-W57 PolarHBondContact O-N 2.98Å; S55-W57 PolarHBondContact OG-NE1 3.49Å; S55-W57 VanDerWaalsContact OG-NE1 3.13Å; S55-R58 WeakPolarHBondContact O-CB 3.4Å; S55-R58 PolarHBondContact O-N 3.45Å; S55-K59 PolarHBondContact O-N 3.14Å
56	P	73.6	Confident	80.9	Confident	78 Å²	78	112.8 Å²	112.8	51%	0.506	54%	0.542	S	S	.	.	H	α-helix	trans	-55.5	-37	-174.3	-29.4	35.5	0	0	0	114.5	R58 K59 M60 E61	P56-R58 VanDerWaalsContact C-N 3.27Å; P56-R58 PolarHBondContact O-N 3.22Å; P56-K59 PolarHBondContact O-N 2.9Å; P56-M60 PolarHBondContact O-N 3.28Å; P56-E61 PolarHBondContact O-N 2.78Å
57	W	78.8	Confident	80.7	Confident	163 Å²	163	112.6 Å²	112.6	62%	0.617	55%	0.55	S	S	*	.	H	α-helix	trans	-68.7	-25.4	177.9	73.4	-94.8	0	0	0	113.2	F50 S55	F50-W57 HydrophobicContact CE1-CZ3 4.45Å; F50-W57 AromaticContact CE2-CH2 3.64Å; F50-W57 HydrophobicContact CE2-CH2 3.64Å; F50-W57 HydrophobicContact CE2-CZ2 4.46Å; F50-W57 HydrophobicContact CE2-CZ3 4.21Å; F50-W57 AromaticContact CZ-CH2 3.41Å; F50-W57 HydrophobicContact CZ-CH2 3.41Å; F50-W57 VanDerWaalsContact CZ-CH2 3.41Å; F50-W57 HydrophobicContact CZ-CZ2 4.36Å; F50-W57 AromaticContact CZ-CZ3 3.5Å; F50-W57 HydrophobicContact CZ-CZ3 3.5Å; S55-W57 VanDerWaalsContact C-N 3.27Å; S55-W57 PolarHBondContact O-N 2.98Å; S55-W57 PolarHBondContact OG-NE1 3.49Å; S55-W57 VanDerWaalsContact OG-NE1 3.13Å
58	R	80.3	Confident	80.7	Confident	68 Å²	68	114.8 Å²	114.8	26%	0.257	57%	0.565	S	S	.	*	H	α-helix	trans	-80.9	-34.5	176.8	-61.3	-169.8	-177.5	-159.2	-3.7	112.1	F50 L51 S55 P56 M60	F50-R58 HydrophobicContact CD1-CG 4.49Å; F50-R58 HydrophobicContact CE1-CB 4.02Å; F50-R58 HydrophobicContact CE1-CG 3.81Å; F50-R58 HydrophobicContact CE2-CG 4.46Å; F50-R58 HydrophobicContact CZ-CB 4.5Å; F50-R58 HydrophobicContact CZ-CG 3.81Å; F50-R58 WeakPolarHBondContact O-CD 3.35Å; F50-R58 PolarHBondContact O-NH1 3.04Å; L51-R58 HydrophobicContact CD2-CB 4.39Å; L51-R58 WeakPolarHBondContact CD2-O 3.43Å; S55-R58 WeakPolarHBondContact O-CB 3.4Å; S55-R58 PolarHBondContact O-N 3.45Å; P56-R58 VanDerWaalsContact C-N 3.27Å; P56-R58 PolarHBondContact O-N 3.22Å; R58-M60 VanDerWaalsContact C-N 3.34Å
59	K	73.6	Confident	80.9	Confident	90 Å²	90	119.9 Å²	119.9	39%	0.391	58%	0.584	S	S	.	*	H	α-helix	trans	-85.7	-4.6	177.1	-75.8	-170.7	168.5	-168.2	0	114.2	K54 S55 P56 E61	K54-K59 HydrophobicContact CB-CD 4.34Å; S55-K59 PolarHBondContact O-N 3.14Å; P56-K59 PolarHBondContact O-N 2.9Å; K59-E61 HydrophobicContact CB-CG 3.96Å; K59-E61 VanDerWaalsContact CD-OE1 3.28Å; K59-E61 WeakPolarHBondContact CD-OE1 3.23Å; K59-E61 PolarHBondContact O-N 3.32Å
60	M	69.3	Low	81	Confident	150 Å²	150	121.8 Å²	121.8	74%	0.739	59%	0.592	S	S	*	*	T	Hydrogen-bonded Turn	trans	48.4	38.2	-171.6	-57.8	-164.4	-144.8	0	0	112.2	P56 R58 K62	P56-M60 PolarHBondContact O-N 3.28Å; R58-M60 VanDerWaalsContact C-N 3.34Å; M60-K62 VanDerWaalsContact C-N 3.33Å; M60-K62 PolarHBondContact O-N 2.81Å
61	E	75.3	Confident	81.1	Confident	116 Å²	116	124.5 Å²	124.5	54%	0.542	62%	0.616	S	S	.	*			trans	-71.4	96.2	171.2	-74.5	173.5	-166.3	0	0	106.7	P56 K59 P63	P56-E61 PolarHBondContact O-N 2.78Å; K59-E61 HydrophobicContact CB-CG 3.96Å; K59-E61 VanDerWaalsContact CD-OE1 3.28Å; K59-E61 WeakPolarHBondContact CD-OE1 3.23Å; K59-E61 PolarHBondContact O-N 3.32Å; E61-P63 WeakPolarHBondContact O-CD 3.38Å
62	K	78.9	Confident	81.4	Confident	160 Å²	160	130.2 Å²	130.2	70%	0.696	63%	0.632	S	S	*	*			trans	-82.7	107.1	177.8	-66.5	-176.5	-177.7	-179.9	0	108	M60 Y64 G65	M60-K62 VanDerWaalsContact C-N 3.33Å; M60-K62 PolarHBondContact O-N 2.81Å; K62-Y64 PolarHBondContact O-N 3.38Å; K62-G65 PolarHBondContact O-N 3.22Å
63	P	79.7	Confident	81.7	Confident	106 Å²	106	128.1 Å²	128.1	69%	0.688	63%	0.625	S	S	*	*	T	Hydrogen-bonded Turn	trans	-57.5	136.5	169.6	27.2	-33.9	0	0	0	107.6	E61 G65	E61-P63 WeakPolarHBondContact O-CD 3.38Å; P63-G65 PolarHBondContact O-N 3.18Å
64	Y	82.1	Confident	82.3	Confident	201 Å²	201	128.8 Å²	128.8	79%	0.788	62%	0.622	S	S	*	*	T	Hydrogen-bonded Turn	trans	64.4	19	-174.9	-42.9	-77.6	0	0	0	115	K62 I66 V67	K62-Y64 PolarHBondContact O-N 3.38Å; Y64-I66 PolarHBondContact O-N 3.29Å; Y64-V67 HydrophobicContact CD1-CG2 4.16Å; Y64-V67 HydrophobicContact CG-CG2 4.42Å; Y64-V67 WeakPolarHBondContact O-CG2 3.41Å
65	G	81.6	Confident	83.2	Confident	54 Å²	54	123.7 Å²	123.7	56%	0.557	61%	0.606	S	S	*	*	S	Bend	trans	-61.1	-30.9	172.5	0	0	0	0	0	112.9	K62 P63	K62-G65 PolarHBondContact O-N 3.22Å; P63-G65 PolarHBondContact O-N 3.18Å
66	I	85	Confident	83.4	Confident	150 Å²	150	124 Å²	124	77%	0.769	62%	0.616	S	S	*	*	S	Bend	trans	-127	120.3	169.2	-58.3	171.1	0	0	0	106.1	Y64 E68	Y64-I66 PolarHBondContact O-N 3.29Å; I66-E68 HydrophobicContact CG2-CG 4.34Å
67	V	86.7	Confident	84.3	Confident	109 Å²	109	123.5 Å²	123.5	66%	0.661	61%	0.608	S	S	*	*			trans	-121.2	115.7	174.3	-177.8	0	0	0	0	107.8	Y64	Y64-V67 HydrophobicContact CD1-CG2 4.16Å; Y64-V67 HydrophobicContact CG-CG2 4.42Å; Y64-V67 WeakPolarHBondContact O-CG2 3.41Å
68	E	88.8	Confident	84.7	Confident	165 Å²	165	119.7 Å²	119.7	77%	0.771	60%	0.603	S	S	*	*	P	Polyproline II helix	trans	-94.9	149.2	175.2	-65.5	-177.8	175.2	0	0	110.2	I66	I66-E68 HydrophobicContact CG2-CG 4.34Å
69	K	91.8	Very high	85.1	Confident	184 Å²	184	119.2 Å²	119.2	80%	0.8	61%	0.606	S	S	*	*	P	Polyproline II helix	trans	-71.2	134.1	170.5	-178	174.6	174.8	158.7	0	108.3	S71	K69-S71 PolarHBondContact O-N 3.02Å
70	K	89.7	Confident	85.7	Confident	193 Å²	193	123.1 Å²	123.1	84%	0.839	63%	0.63	S	S	*	*	P	Polyproline II helix	trans	-51.3	137.4	171.3	-64.2	-173.4	177	-172.3	0	110.3
71	S	88.4	Confident	86.6	Confident	98 Å²	98	125 Å²	125	69%	0.685	64%	0.636	S	S	*	*	P	Polyproline II helix	trans	-54.9	148	176.5	44.3	0	0	0	0	110.7	K69	K69-S71 PolarHBondContact O-N 3.02Å
72	R	90.8	Very high	87.3	Confident	199 Å²	199	123.4 Å²	123.4	75%	0.751	64%	0.635	S	S	*	*	P	Polyproline II helix	trans	-70.4	142.6	169.2	-68.3	-176	-171.3	-178.2	1.5	108	F74	R72-F74 HydrophobicContact CB-CE2 3.98Å; R72-F74 HydrophobicContact CB-CZ 4.32Å
73	I	89.8	Confident	87.7	Confident	100 Å²	100	118.2 Å²	118.2	51%	0.513	63%	0.627	S	S	.	*			trans	-127.9	129.7	-172.5	-69.9	-176.5	0	0	0	107.1	I86	I73-I86 HydrophobicContact CB-CD1 4.29Å; I73-I86 HydrophobicContact CG2-CD1 2.8Å; I73-I86 HydrophobicContact CG2-CG1 4.28Å
74	F	90.9	Very high	88.1	Confident	118 Å²	118	119.2 Å²	119.2	52%	0.518	62%	0.623	S	S	.	*			trans	-121.6	158.1	-176.6	-67.2	-75.4	0	0	0	112.3	R72 G76 D77	R72-F74 HydrophobicContact CB-CE2 3.98Å; R72-F74 HydrophobicContact CB-CZ 4.32Å; F74-G76 PolarHBondContact O-N 3.05Å; F74-D77 PolarHBondContact N-OD2 2.97Å; F74-D77 VanDerWaalsContact O-CB 3.3Å; F74-D77 WeakPolarHBondContact O-CB 3.45Å; F74-D77 PolarHBondContact O-N 3.34Å
75	P	91.1	Very high	88.4	Confident	56 Å²	56	114.2 Å²	114.2	36%	0.364	61%	0.613	S	S	.	*	T	Hydrogen-bonded Turn	trans	-54.2	128	171.2	-20.6	30.1	0	0	0	111.4	P87 M89	P75-P87 WeakPolarHBondContact CB-O 3.39Å; P75-M89 HydrophobicContact CG-CB 4.49Å; P75-M89 HydrophobicContact CG-CE 4.27Å; P75-M89 HydrophobicContact CG-CG 3.65Å; P75-M89 HydrophobicContact CG-SD 4.3Å
76	G	85.4	Confident	88.8	Confident	46 Å²	46	113.4 Å²	113.4	47%	0.474	60%	0.595	S	S	.	*	T	Hydrogen-bonded Turn	trans	93.7	-12.2	-174.3	0	0	0	0	0	115.5	F74 I86	F74-G76 PolarHBondContact O-N 3.05Å; G76-I86 PolarHBondContact N-O 3.36Å
77	D	91.8	Very high	89.1	Confident	67 Å²	67	111 Å²	111	36%	0.358	59%	0.589	S	S	.	*			trans	-66.1	148.4	174.1	-72.4	-15.3	0	0	0	111.1	F74 V85 I86	F74-D77 PolarHBondContact N-OD2 2.97Å; F74-D77 VanDerWaalsContact O-CB 3.3Å; F74-D77 WeakPolarHBondContact O-CB 3.45Å; F74-D77 PolarHBondContact O-N 3.34Å; D77-V85 WeakPolarHBondContact O-CA 3.41Å; D77-I86 HydrophobicContact CB-CD1 4.28Å; D77-I86 WeakPolarHBondContact O-CG1 3.34Å; D77-I86 PolarHBondContact O-N 2.96Å
78	T	87.9	Confident	89.1	Confident	83 Å²	83	111.1 Å²	111.1	51%	0.509	59%	0.592	S	S	.	*	B	Isolated β-bridge	trans	-108.2	127	175.4	-48.7	0	0	0	0	110.2	L80 E84 V85	T78-L80 PolarHBondContact O-N 2.83Å; T78-E84 WeakPolarHBondContact CA-O 3.4Å; T78-V85 HydrophobicContact CG2-CG2 4.28Å
79	I	88.9	Confident	88.9	Confident	59 Å²	59	109.7 Å²	109.7	30%	0.303	59%	0.587	S	S	.	*			trans	-77.5	114.4	174.8	-58.8	173.4	0	0	0	108.2	E81 T82 G83 E84	I79-E81 HydrophobicContact CG2-CB 4.35Å; I79-E81 PolarHBondContact O-N 3.32Å; I79-T82 WeakPolarHBondContact CB-OG1 3.42Å; I79-T82 HydrophobicContact CG2-CG2 4.29Å; I79-T82 WeakPolarHBondContact CG2-OG1 3.43Å; I79-T82 PolarHBondContact O-N 3.48Å; I79-G83 VanDerWaalsContact O-CA 3.3Å; I79-G83 WeakPolarHBondContact O-CA 3.35Å; I79-G83 PolarHBondContact O-N 3.19Å; I79-E84 PolarHBondContact N-O 3.49Å
80	L	86.8	Confident	88.5	Confident	172 Å²	172	109.8 Å²	109.8	90%	0.901	59%	0.588	S	S	*	*	T	Hydrogen-bonded Turn	trans	-61.6	-31.4	-176.6	-65.8	176.5	0	0	0	113.6	T78	T78-L80 PolarHBondContact O-N 2.83Å
81	E	87.8	Confident	88.1	Confident	188 Å²	188	109.4 Å²	109.4	88%	0.879	59%	0.589	S	S	*	*	T	Hydrogen-bonded Turn	trans	-75.2	-33.1	-178	-62.3	179.8	177.9	0	0	112.9	I79	I79-E81 HydrophobicContact CG2-CB 4.35Å; I79-E81 PolarHBondContact O-N 3.32Å
82	T	89.1	Confident	87.7	Confident	83 Å²	83	112.6 Å²	112.6	51%	0.509	59%	0.591	S	S	.	*	T	Hydrogen-bonded Turn	trans	-111	-17.7	-175.2	62	0	0	0	0	113.6	I79 E84	I79-T82 WeakPolarHBondContact CB-OG1 3.42Å; I79-T82 HydrophobicContact CG2-CG2 4.29Å; I79-T82 WeakPolarHBondContact CG2-OG1 3.43Å; I79-T82 PolarHBondContact O-N 3.48Å; T82-E84 PolarHBondContact O-N 3.17Å; T82-E84 PolarHBondContact OG1-N 3.32Å
83	G	87.4	Confident	87.2	Confident	52 Å²	52	108.5 Å²	108.5	54%	0.536	59%	0.59	S	S	.	*			trans	70.9	5.5	-171.6	0	0	0	0	0	114.1	I79	I79-G83 VanDerWaalsContact O-CA 3.3Å; I79-G83 WeakPolarHBondContact O-CA 3.35Å; I79-G83 PolarHBondContact O-N 3.19Å
84	E	87.5	Confident	86.4	Confident	127 Å²	127	110.4 Å²	110.4	59%	0.593	60%	0.601	S	S	*	*	P	Polyproline II helix	trans	-76.1	131.9	-178.3	-67.4	179.5	167.1	0	0	111.1	T78 I79 T82	T78-E84 WeakPolarHBondContact CA-O 3.4Å; I79-E84 PolarHBondContact N-O 3.49Å; T82-E84 PolarHBondContact O-N 3.17Å; T82-E84 PolarHBondContact OG1-N 3.32Å
85	V	89.8	Confident	85.8	Confident	95 Å²	95	112.9 Å²	112.9	58%	0.576	61%	0.614	S	S	*	*	B	Isolated β-bridge	trans	-93.2	133.2	174.4	-177.4	0	0	0	0	109.1	D77 T78	D77-V85 WeakPolarHBondContact O-CA 3.41Å; T78-V85 HydrophobicContact CG2-CG2 4.28Å
86	I	90.4	Very high	84.5	Confident	37 Å²	37	118.6 Å²	118.6	19%	0.19	64%	0.636	C	S	.	*	P	Polyproline II helix	trans	-78	130.1	-174.8	-64.9	-177.1	0	0	0	110.3	I73 G76 D77	I73-I86 HydrophobicContact CB-CD1 4.29Å; I73-I86 HydrophobicContact CG2-CD1 2.8Å; I73-I86 HydrophobicContact CG2-CG1 4.28Å; G76-I86 PolarHBondContact N-O 3.36Å; D77-I86 HydrophobicContact CB-CD1 4.28Å; D77-I86 WeakPolarHBondContact O-CG1 3.34Å; D77-I86 PolarHBondContact O-N 2.96Å
87	P	89.4	Confident	82.8	Confident	99 Å²	99	128.4 Å²	128.4	64%	0.643	67%	0.669	S	S	*	*	P	Polyproline II helix	trans	-61	142.7	-174.1	23.3	-33.6	0	0	0	111.5	P75	P75-P87 WeakPolarHBondContact CB-O 3.39Å
88	P	86.9	Confident	82.4	Confident	112 Å²	112	131.5 Å²	131.5	73%	0.727	68%	0.684	S	S	*	*	P	Polyproline II helix	trans	-61.2	152.3	175.8	26.8	-33.8	0	0	0	111
89	M	85.8	Confident	82.1	Confident	136 Å²	136	134 Å²	134	67%	0.67	69%	0.694	S	S	*	*	P	Polyproline II helix	trans	-64.3	148.6	170.2	-81.1	-176.6	-56.5	0	0	110.4	P75 E91	P75-M89 HydrophobicContact CG-CB 4.49Å; P75-M89 HydrophobicContact CG-CE 4.27Å; P75-M89 HydrophobicContact CG-CG 3.65Å; P75-M89 HydrophobicContact CG-SD 4.3Å; M89-E91 PolarHBondContact O-N 3.06Å
90	K	83.7	Confident	81.7	Confident	186 Å²	186	138.2 Å²	138.2	81%	0.809	72%	0.715	S	S	*	*	P	Polyproline II helix	trans	-59.3	133.9	173	-170.6	173.7	-178	178.5	0	109.4	F92	K90-F92 WeakPolarHBondContact O-CD2 3.18Å; K90-F92 PolarHBondContact O-N 2.93Å
91	E	80.7	Confident	81.4	Confident	185 Å²	185	136.2 Å²	136.2	86%	0.864	70%	0.704	S	S	*	*	P	Polyproline II helix	trans	-58	125.9	178	-64.8	178.6	-178.5	0	0	110.1	M89	M89-E91 PolarHBondContact O-N 3.06Å
92	F	80.4	Confident	81	Confident	164 Å²	164	132.9 Å²	132.9	72%	0.719	69%	0.694	S	S	*	*	P	Polyproline II helix	trans	-90.4	137	170.5	-66.3	-80.9	0	0	0	108.2	K90 D94	K90-F92 WeakPolarHBondContact O-CD2 3.18Å; K90-F92 PolarHBondContact O-N 2.93Å; F92-D94 PolarHBondContact O-N 3.38Å
93	P	80.3	Confident	80.5	Confident	114 Å²	114	136.3 Å²	136.3	74%	0.74	71%	0.706	S	S	*	*			trans	-61.3	114.5	174.6	24.2	-30.9	0	0	0	108.9	Q95	P93-Q95 PolarHBondContact O-N 2.8Å
94	D	73.4	Confident	80	Confident	140 Å²	140	142.3 Å²	142.3	75%	0.749	72%	0.718	S	S	*	*			trans	-70.2	123.6	-178.1	-156.8	-3	0	0	0	109.4	F92	F92-D94 PolarHBondContact O-N 3.38Å
95	Q	76.6	Confident	79.4	Confident	169 Å²	169	143.5 Å²	143.5	79%	0.79	73%	0.728	S	S	*	*			trans	-103	11.8	-179.1	-68.2	-172.5	-2.5	0	0	112.5	P93 H97	P93-Q95 PolarHBondContact O-N 2.8Å; Q95-H97 PolarHBondContact O-N 3.13Å; Q95-H97 VanDerWaalsContact O-N 3.1Å
96	H	63.9	Low	78.5	Confident	177 Å²	177	147.5 Å²	147.5	82%	0.819	74%	0.74	S	S	*	*			trans	-76.9	98.1	174.9	-93.4	-74.3	0	0	0	111.2
97	H	50.8	Low	77.4	Confident	251 Å²	251	157.5 Å²	157.5	100%	1.162	79%	0.79	S	S	*	*			trans	-75.3	0	164.1	-73.6	-75.4	0	0	0	112.1	Q95	Q95-H97 PolarHBondContact O-N 3.13Å; Q95-H97 VanDerWaalsContact O-N 3.1Å

Retrieved 97 of 97 residues in 121.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).