A0A087X016_HUMAN Loading...

SH2B adaptor protein 2

AlphaFold DB , UniProt , Accession A0A087X016, Species HUMAN (Homo sapiens, Human), Gene SH2B2, Length 47 aa.

						>A0A087X016_HUMAN|A0A087X016|SH2B2
MDPSYCPAHGFPSQDPLWPLSSQQWSSAHYSEPGLQAQGQHPTVSHH
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	58.9	Low	63.4	Low	238 Å²	238	131.2 Å²	131.2	100%	1.172	74%	0.741	S	S	*	*				0	121.1	0	-51	-51.3	177.6	106.4
2	D	68.6	Low	63.2	Low	109 Å²	109	128.3 Å²	128.3	58%	0.583	73%	0.732	S	S	*	*			trans	-79	130.5	-176.1	-176.1	-94.6	0	110.5	S4 Y5	D2-S4 VanDerWaalsContact OD1-CA 3.31Å; D2-S4 PolarHBondContact O-N 3.43Å; D2-S4 PolarHBondContact OD1-OG 3.23Å; D2-S4 PolarHBondContact OD1-N 3.31Å; D2-S4 WeakPolarHBondContact OD1-CA 3.4Å; D2-S4 WeakPolarHBondContact OD1-CB 3.22Å; D2-Y5 PolarHBondContact O-N 3.4Å
3	P	62	Low	63.3	Low	120 Å²	120	127.5 Å²	127.5	78%	0.779	74%	0.739	S	S	*	*	T	Hydrogen-bonded Turn	trans	-72.3	-3.5	-178.2	28.4	-34.2	0	114.2
4	S	65.9	Low	63.2	Low	97 Å²	97	129.1 Å²	129.1	68%	0.678	74%	0.736	S	S	*	*	T	Hydrogen-bonded Turn	trans	-88.3	-3.2	178.7	-32.7	0	0	113.3	D2 C6	D2-S4 VanDerWaalsContact OD1-CA 3.31Å; D2-S4 PolarHBondContact O-N 3.43Å; D2-S4 PolarHBondContact OD1-OG 3.23Å; D2-S4 PolarHBondContact OD1-N 3.31Å; D2-S4 WeakPolarHBondContact OD1-CA 3.4Å; D2-S4 WeakPolarHBondContact OD1-CB 3.22Å; S4-C6 PolarHBondContact O-N 2.84Å
5	Y	63.4	Low	63.1	Low	197 Å²	197	127.9 Å²	127.9	77%	0.773	73%	0.727	S	S	*	*			trans	-82.7	63	175.1	-154.7	-93.4	0	111.1	D2 P7	D2-Y5 PolarHBondContact O-N 3.4Å; Y5-P7 HydrophobicContact CE1-CG 4.26Å; Y5-P7 VanDerWaalsContact O-CD 3.23Å; Y5-P7 WeakPolarHBondContact O-CD 3.46Å
6	C	67.2	Low	62.8	Low	107 Å²	107	127.1 Å²	127.1	72%	0.723	73%	0.728	S	S	*	*			trans	-90.2	101	155.7	-77.7	0	0	106.2	S4 A8	S4-C6 PolarHBondContact O-N 2.84Å; C6-A8 VanDerWaalsContact C-N 3.25Å; C6-A8 PolarHBondContact O-N 2.92Å
7	P	61.2	Low	62.6	Low	74 Å²	74	127.6 Å²	127.6	48%	0.481	73%	0.727	S	S	.	*			trans	-62.6	105.5	159.1	25.3	-24.2	0	104.1	Y5 H9	Y5-P7 HydrophobicContact CE1-CG 4.26Å; Y5-P7 VanDerWaalsContact O-CD 3.23Å; Y5-P7 WeakPolarHBondContact O-CD 3.46Å; P7-H9 PolarHBondContact O-N 2.8Å
8	A	65	Low	62.6	Low	93 Å²	93	131.7 Å²	131.7	77%	0.769	73%	0.729	S	S	*	*			trans	-56.1	99.1	163.7	0	0	0	104.4	C6 G10	C6-A8 VanDerWaalsContact C-N 3.25Å; C6-A8 PolarHBondContact O-N 2.92Å; A8-G10 PolarHBondContact O-N 3.24Å
9	H	63.2	Low	62.5	Low	172 Å²	172	128.5 Å²	128.5	80%	0.796	72%	0.715	S	S	*	*			trans	-67.8	61.6	158.3	-78.6	-80.6	0	106.1	P7 F11	P7-H9 PolarHBondContact O-N 2.8Å; H9-F11 PolarHBondContact O-N 3.38Å
10	G	58.7	Low	62.3	Low	62 Å²	62	128.9 Å²	128.9	64%	0.639	72%	0.715	S	S	*	*			trans	-63.7	95.1	159.9	0	0	0	103.7	A8	A8-G10 PolarHBondContact O-N 3.24Å
11	F	63.9	Low	62.1	Low	174 Å²	174	125.3 Å²	125.3	76%	0.763	70%	0.698	S	S	*	*			trans	-36.9	131.4	158.8	-114.2	-102.9	0	107.7	H9 S13	H9-F11 PolarHBondContact O-N 3.38Å; F11-S13 PolarHBondContact O-N 3.25Å
12	P	60.6	Low	62.1	Low	96 Å²	96	116.2 Å²	116.2	62%	0.623	66%	0.659	S	S	*	*			trans	-55.6	126.2	166.2	25.5	-30.6	0	105.5	Q14	P12-Q14 PolarHBondContact O-N 3.5Å
13	S	64.3	Low	61.6	Low	118 Å²	118	117.9 Å²	117.9	83%	0.825	66%	0.663	S	S	*	*			trans	-52.8	98.4	164.5	177.2	0	0	104.9	F11 D15	F11-S13 PolarHBondContact O-N 3.25Å; S13-D15 PolarHBondContact O-N 3.43Å
14	Q	61.9	Low	61.7	Low	151 Å²	151	119.5 Å²	119.5	71%	0.706	66%	0.66	S	S	*	*			trans	-67.6	95.8	-178.6	-72.6	-170.3	-29.1	105.2	P12 P16	P12-Q14 PolarHBondContact O-N 3.5Å; Q14-P16 WeakPolarHBondContact O-CD 3.44Å; Q14-P16 VanDerWaalsContact O-N 3.16Å
15	D	61.9	Low	61.5	Low	110 Å²	110	124.6 Å²	124.6	59%	0.588	66%	0.664	S	S	*	*			trans	-51.5	119.6	162.4	-145.5	-46.3	0	105.7	S13 L17	S13-D15 PolarHBondContact O-N 3.43Å; D15-L17 PolarHBondContact O-N 3.14Å
16	P	57.5	Low	61.4	Low	115 Å²	115	120.2 Å²	120.2	75%	0.747	66%	0.663	S	S	*	*	S	Bend	trans	-68.6	5.8	-175.2	26.7	-32.1	0	112.6	Q14 W18	Q14-P16 WeakPolarHBondContact O-CD 3.44Å; Q14-P16 VanDerWaalsContact O-N 3.16Å; P16-W18 PolarHBondContact O-N 2.8Å
17	L	60.3	Low	61.2	Low	136 Å²	136	119.3 Å²	119.3	71%	0.712	66%	0.658	S	S	*	*			trans	-74.8	61.3	165.6	-56.2	176.8	0	109.9	D15 P19	D15-L17 PolarHBondContact O-N 3.14Å; L17-P19 VanDerWaalsContact O-N 3.14Å
18	W	61.6	Low	61.3	Low	202 Å²	202	120.5 Å²	120.5	77%	0.765	67%	0.673	S	S	*	*			trans	-40.7	125.7	145	-102.7	71.1	0	106.7	P16 L20	P16-W18 PolarHBondContact O-N 2.8Å; W18-L20 PolarHBondContact O-N 2.73Å
19	P	61.7	Low	61.4	Low	71 Å²	71	123.1 Å²	123.1	46%	0.461	67%	0.669	S	S	.	*			trans	-61.6	122.8	-168.6	27.3	-34.1	0	106.2	L17 S21 S22	L17-P19 VanDerWaalsContact O-N 3.14Å; P19-S21 WeakPolarHBondContact CB-OG 3.4Å; P19-S21 PolarHBondContact O-N 2.8Å; P19-S22 PolarHBondContact O-N 2.85Å
20	L	58.4	Low	61.2	Low	136 Å²	136	125.6 Å²	125.6	71%	0.712	67%	0.673	S	S	*	*	G	3₁₀ helix	trans	-51.6	-18.8	178	-154.4	73.7	0	111	W18 S22 Q23	W18-L20 PolarHBondContact O-N 2.73Å; L20-S22 PolarHBondContact O-N 2.89Å; L20-Q23 PolarHBondContact O-N 2.9Å
21	S	57.8	Low	61.4	Low	53 Å²	53	128.2 Å²	128.2	37%	0.371	68%	0.682	S	S	.	*	G	3₁₀ helix	trans	-65.4	-23.9	171.1	66.6	0	0	115.8	P19 Q23 Q24	P19-S21 WeakPolarHBondContact CB-OG 3.4Å; P19-S21 PolarHBondContact O-N 2.8Å; S21-Q23 VanDerWaalsContact C-N 3.25Å; S21-Q23 PolarHBondContact O-N 2.72Å; S21-Q24 VanDerWaalsContact CA-OE1 3.31Å; S21-Q24 WeakPolarHBondContact O-CB 3.43Å; S21-Q24 PolarHBondContact O-N 2.96Å; S21-Q24 VanDerWaalsContact O-N 3.14Å
22	S	59.6	Low	61.1	Low	48 Å²	48	125.9 Å²	125.9	34%	0.336	67%	0.673	S	S	.	*	G	3₁₀ helix	trans	-68.5	-25.4	171.7	-66.2	0	0	112.3	P19 L20	P19-S22 PolarHBondContact O-N 2.85Å; L20-S22 PolarHBondContact O-N 2.89Å
23	Q	57.8	Low	60.9	Low	143 Å²	143	127.1 Å²	127.1	67%	0.668	68%	0.681	S	S	*	*	G	3₁₀ helix	trans	-79.3	-20.1	171.5	-71.5	-175.8	81.4	112.5	L20 S21 W25 S26	L20-Q23 PolarHBondContact O-N 2.9Å; S21-Q23 VanDerWaalsContact C-N 3.25Å; S21-Q23 PolarHBondContact O-N 2.72Å; Q23-W25 PolarHBondContact O-N 2.91Å; Q23-S26 PolarHBondContact O-N 3.04Å
24	Q	63.6	Low	60.5	Low	155 Å²	155	124.4 Å²	124.4	72%	0.724	67%	0.672	S	S	*	*	G	3₁₀ helix	trans	-74.3	-6	-179.4	-62.9	-176.6	-69.4	113.2	S21 S26	S21-Q24 VanDerWaalsContact CA-OE1 3.31Å; S21-Q24 WeakPolarHBondContact O-CB 3.43Å; S21-Q24 PolarHBondContact O-N 2.96Å; S21-Q24 VanDerWaalsContact O-N 3.14Å; Q24-S26 VanDerWaalsContact C-N 3.35Å
25	W	61.6	Low	60.3	Low	204 Å²	204	123.5 Å²	123.5	77%	0.773	67%	0.671	S	S	*	*	G	3₁₀ helix	trans	-94.1	18.7	173.7	-58.7	-20.5	0	113.9	Q23 S27	Q23-W25 PolarHBondContact O-N 2.91Å; W25-S27 PolarHBondContact O-N 2.73Å
26	S	60.9	Low	60.1	Low	105 Å²	105	126.7 Å²	126.7	73%	0.734	68%	0.682	S	S	*	*			trans	-72	77.9	161.6	-62	0	0	108.4	Q23 Q24 A28	Q23-S26 PolarHBondContact O-N 3.04Å; Q24-S26 VanDerWaalsContact C-N 3.35Å; S26-A28 PolarHBondContact O-N 2.86Å
27	S	63.9	Low	59.6	Low	88 Å²	88	126.3 Å²	126.3	62%	0.615	69%	0.689	S	S	*	*			trans	-66.2	73.5	170.4	50.3	0	0	109.7	W25 H29	W25-S27 PolarHBondContact O-N 2.73Å; S27-H29 VanDerWaalsContact CB-CD2 3.46Å; S27-H29 WeakPolarHBondContact CB-CD2 3.23Å; S27-H29 PolarHBondContact O-N 3.22Å
28	A	63.9	Low	59.3	Low	98 Å²	98	129.2 Å²	129.2	81%	0.81	70%	0.699	S	S	*	*			trans	-78	64	161.5	0	0	0	108.8	S26 Y30	S26-A28 PolarHBondContact O-N 2.86Å; A28-Y30 PolarHBondContact O-N 2.96Å
29	H	65.9	Low	59.1	Low	148 Å²	148	122.7 Å²	122.7	69%	0.685	70%	0.695	S	S	*	*			trans	-77.5	95.1	168.8	-75.3	-120.9	0	108.2	S27	S27-H29 VanDerWaalsContact CB-CD2 3.46Å; S27-H29 WeakPolarHBondContact CB-CD2 3.23Å; S27-H29 PolarHBondContact O-N 3.22Å
30	Y	59.9	Low	58.7	Low	225 Å²	225	127.9 Å²	127.9	88%	0.882	71%	0.713	S	S	*	*			trans	-150.5	85.9	143.6	-71.7	-69.7	0	108.9	A28	A28-Y30 PolarHBondContact O-N 2.96Å
31	S	63.3	Low	58.4	Low	117 Å²	117	130.4 Å²	130.4	82%	0.818	72%	0.721	S	S	*	*			trans	-74.3	114.3	144.9	-64.2	0	0	105.7	P33	S31-P33 WeakPolarHBondContact O-CD 2.95Å
32	E	55.8	Low	58.2	Low	125 Å²	125	133.6 Å²	133.6	58%	0.584	74%	0.74	S	S	*	*			trans	-97.5	98	165.7	-119.6	-69.7	112.7	107	G34 L35	E32-G34 PolarHBondContact O-N 3.49Å; E32-L35 WeakPolarHBondContact OE2-CB 3.31Å; E32-L35 PolarHBondContact OE2-N 2.75Å
33	P	57.4	Low	58.1	Low	121 Å²	121	137.1 Å²	137.1	79%	0.786	76%	0.76	S	S	*	*			trans	-90.5	72.6	173.3	36.5	-30.3	0	108	S31	S31-P33 WeakPolarHBondContact O-CD 2.95Å
34	G	55.3	Low	57.8	Low	61 Å²	61	136 Å²	136	63%	0.629	76%	0.763	S	S	*	*	S	Bend	trans	170.3	-6.5	175.6	0	0	0	122.6	E32	E32-G34 PolarHBondContact O-N 3.49Å
35	L	58.7	Low	57.3	Low	133 Å²	133	134.1 Å²	134.1	70%	0.696	77%	0.766	S	S	*	*	S	Bend	trans	-128.6	104	-176.5	-69.6	164.7	0	113.2	E32	E32-L35 WeakPolarHBondContact OE2-CB 3.31Å; E32-L35 PolarHBondContact OE2-N 2.75Å
36	Q	56.3	Low	57	Low	176 Å²	176	132.3 Å²	132.3	82%	0.822	77%	0.766	S	S	*	*			trans	89.5	62.8	151.1	-51.8	177.5	19.9	118.4
37	A	48.5	Very low	56.5	Low	108 Å²	108	139.5 Å²	139.5	89%	0.893	79%	0.788	S	S	*	*			trans	-109.6	36.6	132.7	0	0	0	110.7	G39	A37-G39 PolarHBondContact O-N 2.84Å
38	Q	53.8	Low	56.1	Low	196 Å²	196	142.1 Å²	142.1	92%	0.916	80%	0.796	S	S	*	*			trans	-85.6	92.4	156.3	-69.9	-154	-17.1	106.8
39	G	57	Low	55.7	Low	66 Å²	66	144.4 Å²	144.4	68%	0.68	80%	0.796	S	S	*	*			trans	-178.1	-4.3	-178.7	0	0	0	118.4	A37	A37-G39 PolarHBondContact O-N 2.84Å
40	Q	52.4	Low	55.1	Low	180 Å²	180	144.2 Å²	144.2	84%	0.841	80%	0.802	S	S	*	*			trans	-140.2	70.5	173	-65.1	-175.4	9	111.4
41	H	53.1	Low	54.8	Low	188 Å²	188	139.4 Å²	139.4	87%	0.87	80%	0.797	S	S	*	*			trans	-113.8	114.4	143.1	-75.4	-125.5	0	106.4
42	P	54.3	Low	54.3	Low	121 Å²	121	140.8 Å²	140.8	79%	0.786	80%	0.796	S	S	*	*				-109.6	117.5	127.7	28.7	-28.8	0	110.1
43	T	56.8	Low	54.2	Low	121 Å²	121	141.9 Å²	141.9	74%	0.742	81%	0.81	S	S	*	*			trans	-41	129.1	156.5	-52	0	0	111.2
44	V	51.9	Low	54	Low	121 Å²	121	143.4 Å²	143.4	73%	0.733	81%	0.811	S	S	*	*				178	134.2	117	-83.4	0	0	112
45	S	53.3	Low	53.9	Low	114 Å²	114	149.7 Å²	149.7	80%	0.797	83%	0.825	S	S	*	*			trans	-54.6	139	170.2	-57.8	0	0	114.4
46	H	54.9	Low	53.5	Low	166 Å²	166	151.1 Å²	151.1	77%	0.769	84%	0.836	S	S	*	*			trans	-159.5	128.1	150.5	-68.9	99.6	0	104.7
47	H	49.3	Very low	53.2	Low	256 Å²	256	148.8 Å²	148.8	100%	1.185	84%	0.838	S	S	*	*			cis	-159.8	0	21.7	36.9	-87.7	0	107.6

Retrieved 47 of 47 residues in 98 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).