A0A087X0A7_HUMAN Loading...

Latent transforming growth factor beta binding protein 4

AlphaFold DB , UniProt , Accession A0A087X0A7, Species HUMAN (Homo sapiens, Human), Gene LTBP4, Length 44 aa.

						>A0A087X0A7_HUMAN|A0A087X0A7|LTBP4
MGDVKALLFVAAARARRLGGAAASEPSAGSEAASPKSVQAPSGA
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	66.7	Low	85.9	Confident	197 Å²	197	112 Å²	112	97%	0.97	63%	0.626	S	S	*	*				0	-20.9	0	-92.4	89.8	153.1	0	0	114.9
2	G	80.8	Confident	85.9	Confident	51 Å²	51	107.2 Å²	107.2	53%	0.526	61%	0.611	S	S	.	*	H	α-helix	trans	-68.1	-41.7	-175.5	0	0	0	0	0	114.2	V4 K5 A6	G2-V4 PolarHBondContact O-N 3.5Å; G2-V4 VanDerWaalsContact C-N 3.33Å; G2-K5 VanDerWaalsContact O-N 3.16Å; G2-K5 PolarHBondContact O-N 3.07Å; G2-A6 PolarHBondContact O-N 3.02Å; G2-A6 VanDerWaalsContact O-N 3.12Å
3	D	83.3	Confident	85.9	Confident	128 Å²	128	101.7 Å²	101.7	68%	0.684	59%	0.587	S	S	*	*	H	α-helix	trans	-66	-36.4	-176.5	-46.7	-68.5	0	0	0	112.3	K5 A6 L7	D3-K5 VanDerWaalsContact C-N 3.34Å; D3-K5 PolarHBondContact O-N 3.43Å; D3-A6 PolarHBondContact O-N 2.89Å; D3-L7 WeakPolarHBondContact O-CG 3.39Å; D3-L7 PolarHBondContact O-N 3.31Å
4	V	88.3	Confident	85.9	Confident	91 Å²	91	106.7 Å²	106.7	55%	0.552	59%	0.592	S	S	*	*	H	α-helix	trans	-62.3	-41.5	175.6	-179.6	0	0	0	0	111	G2 L7 L8	G2-V4 PolarHBondContact O-N 3.5Å; G2-V4 VanDerWaalsContact C-N 3.33Å; V4-L7 PolarHBondContact O-N 3.19Å; V4-L8 HydrophobicContact CG1-CD1 4.4Å; V4-L8 WeakPolarHBondContact O-CG 3.15Å; V4-L8 PolarHBondContact O-N 3.2Å; V4-L8 VanDerWaalsContact O-N 3.13Å
5	K	83.1	Confident	85.8	Confident	157 Å²	157	103.5 Å²	103.5	68%	0.683	59%	0.585	S	S	*	*	H	α-helix	trans	-67.1	-39.2	177.4	-68.1	-178.3	179	-179.7	0	111.6	G2 D3 L8 F9	G2-K5 VanDerWaalsContact O-N 3.16Å; G2-K5 PolarHBondContact O-N 3.07Å; D3-K5 VanDerWaalsContact C-N 3.34Å; D3-K5 PolarHBondContact O-N 3.43Å; K5-L8 PolarHBondContact O-N 3.39Å; K5-F9 VanDerWaalsContact O-N 3.08Å; K5-F9 PolarHBondContact O-N 3.12Å
6	A	91.4	Very high	85.4	Confident	57 Å²	57	109.8 Å²	109.8	47%	0.471	60%	0.596	S	S	.	*	H	α-helix	trans	-64.1	-43.2	177	0	0	0	0	0	111.8	G2 D3 L8 F9 V10	G2-A6 PolarHBondContact O-N 3.02Å; G2-A6 VanDerWaalsContact O-N 3.12Å; D3-A6 PolarHBondContact O-N 2.89Å; A6-L8 PolarHBondContact O-N 3.28Å; A6-F9 PolarHBondContact O-N 3.01Å; A6-V10 WeakPolarHBondContact O-CG2 3.35Å; A6-V10 PolarHBondContact O-N 3Å
7	L	92.2	Very high	85	Confident	126 Å²	126	116.4 Å²	116.4	66%	0.66	61%	0.61	S	S	*	*	H	α-helix	trans	-60.9	-44	176.2	-73.2	170.2	0	0	0	112.3	D3 V4 F9 V10 A11	D3-L7 WeakPolarHBondContact O-CG 3.39Å; D3-L7 PolarHBondContact O-N 3.31Å; V4-L7 PolarHBondContact O-N 3.19Å; L7-F9 PolarHBondContact O-N 2.99Å; L7-V10 PolarHBondContact O-N 3.4Å; L7-A11 PolarHBondContact O-N 3.37Å; L7-A11 WeakPolarHBondContact O-CB 3.44Å
8	L	90.6	Very high	84.7	Confident	117 Å²	117	117.4 Å²	117.4	61%	0.613	62%	0.615	S	S	*	*	H	α-helix	trans	-63	-40.5	177	-70.5	172.8	0	0	0	112.3	V4 K5 A6 A11 A12	V4-L8 HydrophobicContact CG1-CD1 4.4Å; V4-L8 WeakPolarHBondContact O-CG 3.15Å; V4-L8 PolarHBondContact O-N 3.2Å; V4-L8 VanDerWaalsContact O-N 3.13Å; K5-L8 PolarHBondContact O-N 3.39Å; A6-L8 PolarHBondContact O-N 3.28Å; L8-A11 PolarHBondContact O-N 3.47Å; L8-A12 WeakPolarHBondContact O-CB 3.33Å; L8-A12 PolarHBondContact O-N 3.49Å
9	F	90	Very high	84	Confident	156 Å²	156	114.4 Å²	114.4	68%	0.684	62%	0.616	S	S	*	*	H	α-helix	trans	-64.2	-44.7	177.3	-176.2	-96.3	0	0	0	112.1	K5 A6 L7 A12 A13	K5-F9 VanDerWaalsContact O-N 3.08Å; K5-F9 PolarHBondContact O-N 3.12Å; A6-F9 PolarHBondContact O-N 3.01Å; L7-F9 PolarHBondContact O-N 2.99Å; F9-A12 PolarHBondContact O-N 2.94Å; F9-A13 WeakPolarHBondContact O-CB 3.42Å; F9-A13 PolarHBondContact O-N 2.88Å
10	V	90.9	Very high	82.7	Confident	95 Å²	95	111.1 Å²	111.1	58%	0.576	61%	0.61	S	S	*	*	H	α-helix	trans	-64.8	-42.1	177.5	173.3	0	0	0	0	111	A6 L7 A13 R14	A6-V10 WeakPolarHBondContact O-CG2 3.35Å; A6-V10 PolarHBondContact O-N 3Å; L7-V10 PolarHBondContact O-N 3.4Å; V10-A13 PolarHBondContact O-N 3.31Å; V10-R14 WeakPolarHBondContact O-CB 3.44Å; V10-R14 PolarHBondContact O-N 2.92Å
11	A	87.8	Confident	81.4	Confident	57 Å²	57	111 Å²	111	47%	0.471	62%	0.624	S	S	.	*	H	α-helix	trans	-61.6	-45.2	175.7	0	0	0	0	0	111.9	L7 L8 R14 A15	L7-A11 PolarHBondContact O-N 3.37Å; L7-A11 WeakPolarHBondContact O-CB 3.44Å; L8-A11 PolarHBondContact O-N 3.47Å; A11-R14 PolarHBondContact O-N 2.94Å; A11-A15 WeakPolarHBondContact O-CB 3.37Å; A11-A15 PolarHBondContact O-N 3.4Å
12	A	85.2	Confident	81	Confident	54 Å²	54	106.1 Å²	106.1	45%	0.446	62%	0.615	S	S	.	*	H	α-helix	trans	-63.4	-43	176.6	0	0	0	0	0	112.3	L8 F9 R14 A15 R16	L8-A12 WeakPolarHBondContact O-CB 3.33Å; L8-A12 PolarHBondContact O-N 3.49Å; F9-A12 PolarHBondContact O-N 2.94Å; A12-R14 VanDerWaalsContact C-N 3.33Å; A12-R14 PolarHBondContact O-N 3.45Å; A12-A15 PolarHBondContact O-N 2.92Å; A12-R16 WeakPolarHBondContact O-CG 3.36Å; A12-R16 PolarHBondContact O-N 3.04Å
13	A	86.4	Confident	80	Confident	36 Å²	36	108.1 Å²	108.1	30%	0.298	63%	0.626	S	S	.	*	H	α-helix	trans	-63.7	-38.8	176.3	0	0	0	0	0	112	F9 V10 R17	F9-A13 WeakPolarHBondContact O-CB 3.42Å; F9-A13 PolarHBondContact O-N 2.88Å; V10-A13 PolarHBondContact O-N 3.31Å; A13-R17 PolarHBondContact O-N 3.48Å
14	R	86.6	Confident	78.7	Confident	172 Å²	172	108 Å²	108	65%	0.649	64%	0.636	S	S	*	*	H	α-helix	trans	-68.9	-41.3	176.2	-170	176.3	-176	-165.5	-0.4	111.8	V10 A11 A12 R16 R17 L18	V10-R14 WeakPolarHBondContact O-CB 3.44Å; V10-R14 PolarHBondContact O-N 2.92Å; A11-R14 PolarHBondContact O-N 2.94Å; A12-R14 VanDerWaalsContact C-N 3.33Å; A12-R14 PolarHBondContact O-N 3.45Å; R14-R16 PolarHBondContact O-N 3.38Å; R14-R17 PolarHBondContact O-N 3.3Å; R14-L18 HydrophobicContact CG-CD1 3.74Å; R14-L18 HydrophobicContact CG-CG 4.23Å; R14-L18 WeakPolarHBondContact O-CB 3.37Å; R14-L18 WeakPolarHBondContact O-CG 3.34Å; R14-L18 PolarHBondContact O-N 3.48Å
15	A	83.9	Confident	77	Confident	59 Å²	59	112.3 Å²	112.3	49%	0.488	65%	0.65	S	S	.	*	H	α-helix	trans	-61.7	-41.9	175.3	0	0	0	0	0	111.9	A11 A12 R17 L18 G19 G20	A11-A15 WeakPolarHBondContact O-CB 3.37Å; A11-A15 PolarHBondContact O-N 3.4Å; A12-A15 PolarHBondContact O-N 2.92Å; A15-R17 VanDerWaalsContact C-N 3.31Å; A15-R17 PolarHBondContact O-N 3.08Å; A15-L18 PolarHBondContact O-N 3.13Å; A15-G19 PolarHBondContact O-N 3.43Å; A15-G20 PolarHBondContact O-N 3.38Å; A15-G20 VanDerWaalsContact O-N 3.12Å
16	R	79.4	Confident	75.6	Confident	204 Å²	204	110.2 Å²	110.2	77%	0.77	65%	0.652	S	S	*	*	H	α-helix	trans	-56.7	-43.2	172.5	-77.1	177.6	167.2	175.1	-3.5	112.4	A12 R14 G20	A12-R16 WeakPolarHBondContact O-CG 3.36Å; A12-R16 PolarHBondContact O-N 3.04Å; R14-R16 PolarHBondContact O-N 3.38Å; R16-G20 PolarHBondContact O-N 3.16Å
17	R	77.7	Confident	73.8	Confident	222 Å²	222	113.9 Å²	113.9	84%	0.838	68%	0.675	S	S	*	*	H	α-helix	trans	-73.2	-34	178.8	-77.1	-167.9	157.3	117.7	0	114.4	A13 R14 A15	A13-R17 PolarHBondContact O-N 3.48Å; R14-R17 PolarHBondContact O-N 3.3Å; A15-R17 VanDerWaalsContact C-N 3.31Å; A15-R17 PolarHBondContact O-N 3.08Å
18	L	79.6	Confident	72.4	Confident	134 Å²	134	111.8 Å²	111.8	70%	0.702	68%	0.676	S	S	*	*	H	α-helix	trans	-87.1	-18.7	-176.2	-68.4	177.6	0	0	0	113.7	R14 A15	R14-L18 HydrophobicContact CG-CD1 3.74Å; R14-L18 HydrophobicContact CG-CG 4.23Å; R14-L18 WeakPolarHBondContact O-CB 3.37Å; R14-L18 WeakPolarHBondContact O-CG 3.34Å; R14-L18 PolarHBondContact O-N 3.48Å; A15-L18 PolarHBondContact O-N 3.13Å
19	G	71.7	Confident	70.6	Confident	60 Å²	60	109.2 Å²	109.2	62%	0.619	68%	0.677	S	S	*	*	H	α-helix	trans	174.5	22.6	178.9	0	0	0	0	0	116.6	A15 A21	A15-G19 PolarHBondContact O-N 3.43Å; G19-A21 PolarHBondContact O-N 3.12Å
20	G	58.6	Low	69.1	Low	49 Å²	49	106.8 Å²	106.8	51%	0.505	68%	0.68	S	S	.	*			trans	-82.6	44	-174.2	0	0	0	0	0	115.4	A15 R16 A22	A15-G20 PolarHBondContact O-N 3.38Å; A15-G20 VanDerWaalsContact O-N 3.12Å; R16-G20 PolarHBondContact O-N 3.16Å; G20-A22 VanDerWaalsContact C-N 3.33Å
21	A	56.1	Low	67.3	Low	108 Å²	108	111.2 Å²	111.2	89%	0.893	69%	0.694	S	S	*	*	S	Bend	trans	-89.5	7.4	167	0	0	0	0	0	112.9	G19	G19-A21 PolarHBondContact O-N 3.12Å
22	A	57	Low	65.9	Low	95 Å²	95	112.4 Å²	112.4	79%	0.785	70%	0.704	S	S	*	*	S	Bend	trans	-126.9	15	-166.9	0	0	0	0	0	116.6	G20	G20-A22 VanDerWaalsContact C-N 3.33Å
23	A	59.7	Low	64.9	Low	93 Å²	93	114.7 Å²	114.7	77%	0.769	72%	0.722	S	S	*	*	S	Bend	trans	-147.6	92.3	171.8	0	0	0	0	0	112.7
24	S	56.7	Low	63.6	Low	127 Å²	127	118 Å²	118	89%	0.888	74%	0.744	S	S	*	*			trans	67	129.8	151.7	-64.2	0	0	0	0	120.2
25	E	51.9	Low	62.4	Low	181 Å²	181	115.4 Å²	115.4	85%	0.846	75%	0.749	S	S	*	*			trans	-51.4	152.1	178.2	-62.1	-179.6	137	0	0	113.8	S27	E25-S27 PolarHBondContact O-N 3.27Å
26	P	54.1	Low	61.4	Low	112 Å²	112	121.8 Å²	121.8	73%	0.727	77%	0.766	S	S	*	*			trans	-74.7	118.8	168.7	31.7	-29.9	0	0	0	109	A28	P26-A28 HydrophobicContact CB-CB 4.09Å; P26-A28 PolarHBondContact O-N 3.46Å
27	S	54.5	Low	60.9	Low	135 Å²	135	117.2 Å²	117.2	94%	0.944	77%	0.765	S	S	*	*			trans	-80.5	74.9	153.1	-165.5	0	0	0	0	107.4	E25	E25-S27 PolarHBondContact O-N 3.27Å
28	A	61.9	Low	60.1	Low	82 Å²	82	113 Å²	113	68%	0.678	76%	0.764	S	S	*	*			trans	-112.3	102.7	171	0	0	0	0	0	107.7	P26	P26-A28 HydrophobicContact CB-CB 4.09Å; P26-A28 PolarHBondContact O-N 3.46Å
29	G	52.8	Low	59.6	Low	63 Å²	63	114.8 Å²	114.8	65%	0.649	77%	0.768	S	S	*	*			trans	75.2	150.7	175.3	0	0	0	0	0	112.9
30	S	57.8	Low	59.4	Low	105 Å²	105	116 Å²	116	73%	0.734	77%	0.772	S	S	*	*			cis	-164.6	149.2	13	-79.6	0	0	0	0	106.6
31	E	54.3	Low	59.7	Low	188 Å²	188	119.2 Å²	119.2	88%	0.879	79%	0.785	S	S	*	*			trans	44.7	122.8	143	-56.4	-170.7	111.6	0	0	118.1
32	A	59.2	Low	60	Low	81 Å²	81	120 Å²	120	67%	0.669	78%	0.784	S	S	*	*				-157.1	130.1	58.5	0	0	0	0	0	111.2	S34	A32-S34 VanDerWaalsContact C-N 3.28Å; A32-S34 PolarHBondContact O-N 2.97Å; A32-S34 VanDerWaalsContact O-N 3.07Å
33	A	63.7	Low	60.3	Low	102 Å²	102	119 Å²	119	84%	0.843	78%	0.783	S	S	*	*			trans	-65.1	98.4	145	0	0	0	0	0	106.8	P35	A33-P35 WeakPolarHBondContact O-CD 3.34Å
34	S	58.4	Low	60	Low	107 Å²	107	123.3 Å²	123.3	75%	0.748	82%	0.818	S	S	*	*			trans	-87.2	102.9	160.2	-72.3	0	0	0	0	107.6	A32 K36	A32-S34 VanDerWaalsContact C-N 3.28Å; A32-S34 PolarHBondContact O-N 2.97Å; A32-S34 VanDerWaalsContact O-N 3.07Å; S34-K36 PolarHBondContact O-N 3.45Å
35	P	60.8	Low	60.1	Low	116 Å²	116	123.2 Å²	123.2	75%	0.753	82%	0.815	S	S	*	*			trans	-71.7	132.2	172.8	29.5	-32.5	0	0	0	110.3	A33	A33-P35 WeakPolarHBondContact O-CD 3.34Å
36	K	63	Low	60.6	Low	193 Å²	193	120.1 Å²	120.1	84%	0.839	81%	0.813	S	S	*	*			trans	68.8	110.1	157.7	-75.2	179.9	176.7	165.5	0	119.4	S34	S34-K36 PolarHBondContact O-N 3.45Å
37	S	68.8	Low	60.9	Low	109 Å²	109	120.6 Å²	120.6	76%	0.762	82%	0.818	S	S	*	*			trans	-34.7	126.3	139.1	176	0	0	0	0	112.8
38	V	61.8	Low	61.3	Low	133 Å²	133	119.7 Å²	119.7	81%	0.806	81%	0.811	S	S	*	*			trans	-132.6	97.8	149.1	-175.7	0	0	0	0	107.2
39	Q	68.5	Low	61.3	Low	171 Å²	171	122.1 Å²	122.1	80%	0.799	82%	0.819	S	S	*	*			trans	-70.8	124.2	161.6	178.1	179.5	6.8	0	0	108.2
40	A	67.2	Low	61.8	Low	85 Å²	85	126 Å²	126	70%	0.702	83%	0.83	S	S	*	*			trans	-128.4	118.3	161.3	0	0	0	0	0	108.2
41	P	65.3	Low	62.1	Low	118 Å²	118	127.5 Å²	127.5	77%	0.766	84%	0.837	S	S	*	*			trans	-80.2	134	167	32.8	-27.6	0	0	0	107.8
42	S	62.9	Low	62.7	Low	124 Å²	124	122.8 Å²	122.8	87%	0.867	83%	0.834	S	S	*	*			trans	-143.2	100.5	159.4	-161.2	0	0	0	0	108.3
43	G	62.5	Low	63	Low	75 Å²	75	126.3 Å²	126.3	77%	0.773	85%	0.848	S	S	*	*			trans	-86.2	142.3	161.4	0	0	0	0	0	109.7
44	A	53.4	Low	63	Low	183 Å²	183	128.5 Å²	128.5	100%	1.512	85%	0.848	S	S	*	*			trans	-173.8	0	145.1	0	0	0	0	0	107.4

Retrieved 44 of 44 residues in 90 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).